المساعد الشخصي الرقمي

مشاهدة النسخة كاملة : المنتدى الطبى


nosa_aic
09 - 12 - 2011, 13:43
http://www.samysoft.net/forumim/slam/sdfsdu.gif



موسوعة الأدويه :بالصور والبيانات

http://grenadine.g.r.pic.centerblog.net/jfuxz4y4.gif



اسم الدواء ترامادول

http://www.alhorya.com/pics/1776951264943371.jpg (http://www.libyanyouths.com/vb/t116536.html)






اسماء أخرى له
ترامال- أمادول- تراماكس- كونترامال- ألترادول- تراموندين.
دواعي الاستعمال لتسكين الآلام المتوسطة و الشديدة .

كيفية الاستعمال
الجرعة في الكبار:
50-100 مجم كل 6 ساعات بدون إرتباط بمواعيد الطعام.
الجرعة اليومية يجب ألا تتعدي 400 مجم يومياً.
كبار السن فوق 75 عاماً: نفس الجرعة علي ألا تزيد عن
300 مجم في اليوم الواحد.
الإختلال الشديد في وظائف الكلي: يعطي 50-100 مدم كل 12 ساعة.
في حالة تليف الكبد: يعطي 50 مجم كل 12 ساعة.
الأطفال:
لا تتوافر معلومات عن مدى امان استعماله.

الآثار الجانبية
دوخة, صداع, دوار, نعاس, إمساك, غثيان, إرتباك, هلوسة, عصبية, رعشة, هرش, طفح جلدي, عسر هضم و إنتفاخ, و زغللة في الرؤية.
في حالات نادرة قد يسبب: صعوبة في التنفس, خلل بالكبد, تشنجات, متلازمة ستيفن جونسون, قابلية للإنتحار.


الدواء قد يسبب التعود و يحتاج المريض إلي زيادة الجرعة بشكل مستمر للحصول علي التأثير المطلوب. و هنا لا يجب إيقافه فجأة بل يتم سحبه بالتدريج.
قد يزيد من إحتمالية حدوث تشنجات للمرضي المعرضين لذلك.
قد يسبب تثبيط للجهاز العصبي و الجهاز التنفسي.
يجب الحرص عند قيادة السيارات أو استخدام الآلات.

موانع الاستعمال:
الحساسية للدواء أو مشتقاته أو مشتقات المورفين.
المرضي الذين يعانون من تعود المورفينات
في حالات التسمم الدوائي بالكحوليات, المنومات, المورفين, الأدوية المؤثرة علي الحالة النفسية.
يستخدم بحذر: للمرضي المعرضين للإصابة بالتشنجات, أو هبوط في التنفس, أو من يعاني من زيادة ضغط الجمجمة, أو إصابات بالرأس أو آلام البطن الحادة, أو إختلاف وظائف الكبد أو الكلي.

التفاعلات الدوائية
الأمفيتامين قد يزد من حدوث التشنجات.
السايمتدين قد يطيل من وجود الدواء في الجسم.
مضادات الإكتئاب المعروفة ب SSRI , مضادات ال MAO , المورفين و مشتقاته:
قد تزيد من إحتمالية التشنجات.
الكيندين قد يزيد من تركيز الدواء في الدم
الكاربامازبين قد يقلل من التأثير العلاجي للدواء و يزد من التشنجات.
يجب تجنب الكحوليات لما لها من تأثير مهبط لجهاز العصبي.
الأعشاب: يجب تجنب الفاليرين, عشبة سان جون, كافا كافا, عشب الكولا.

الحمل و الرضاعة
الدواء لا يمكن استعماله أثناء الحمل لأنه يسبب مشاكل عديدة للجنين مثل التشنجات, أعراض الإنسحاب أو الوفاة. كذلك لا يجب أن يستعمل أثناء الولادة.
يوصي بتجنب استعماله أثناء الرضاعة.

الجرعة الزائدة
أعراضها: هبوط في الجهاز العصبي و التنفسي, إغماء, تشنجات, توقف القلب و الوفاة.
العلاج: يحقن المريض بالنالوكسون وريد بجرعة 2 مجم. كما يمكن تكرار الجرعة حتي 18 مجم. و يجب الحرص لأنه يمكن أن يزيد من إحتمالية حدوث التشنجات.

الجرعة المنسية
قم بأخذ الجرعة المنسية فور تذكرك.
و لكن لا تقوم بأخذ الجرعة المنسية إذا كان ميعاد الجرعة التالية قد قرب. في هذه الحالة اترك الجرعة المنسية و خذ الجرعة التالية في موعدها. لا تقوم بمضاعفة الجرعة اذا نسيب جرعة

التخزين
احتفظ بالدواء في عبوته الأصلية. احفظه في درجة حرارة الغرفة بعيداً عن الحرارة الزائدة و الرطوبة. لا تخزنه في الحمام.




احفظه بعيداً عن متناول الأطفال.





اسم الدواء كلاريناس



http://m002.maktoob.com/alfrasha/up/16491898391838940715.jpg (http://www.libyanyouths.com/vb/t116536.html)




يستخدم ليخفف الأعراض المرتبطه بالحساسيه مثل :
• جيب انفي والعطس كلاريناس يحتوي على مزيج من الادوية لوراتاديني ( انتيهيستامين ) والسودوايفيدرين ( مزيل احتقان )
انتيهيستاميني يساعد على تخفيف اعراض الحساسيه من خلال منع اثار مادة تسمى الهستامين.والهستامين ينتج استجابة للمواد الغريبة .
مزيلات الاحتقان تعمل على تضييق الاوعيه الدمويه. وهذا يؤدي الى تطهير وفتح اي انسداد في الانف.
الطبيب او الصيدلي قد يصرف كلاريناس لغرض آخر وهو متاح في الصيدليه من دون وصفة طبية.

لا تأخذ كلاريناس اذا :
1) لديك حساسيه لكلاريناس او اي من المكونات المذكورة في نهاية هذه النشرة.
2) لا تأخذ كلاريناس اذا كان لديك :
• الزرق • صعوبة مرور البول
• ارتفاع حاد في ضغط الدم الشديد
• امراض الدم وفرط الغده الدرقيه
3) لا تأخذ كلاريناس اذا كنت :
تتناول أو لك فقط 14 يوما من ايقاف الدواء المنوم ( مثبطات مونو امينو اوكسيداز ) ، والأدوية المستخدمة في علاج الاكتئاب.
4) لا تأخذ كلاريناس اذا انت حامل او مرضعه ما لم تناقش الفوائد والاضرار مع الطبيب او الصيدلي.
5) كلاريناس لا تعطى للاطفال دون سن 12 سنة.
6) لا تأخذ كلاريناس بعد انقضاء التاريخ المطبوع في علبة.
7) لا تأخذ كلاريناس اذا كانت العبوة ممزقه او علامات العبث موجودة.
8) اخبر الطبيب او الصيدلي اذا كانت لديك حساسيه لـــ :
• اي ادويه اخرى
• اي مواد اخرى ، مثل الاغذيه ، والمواد الحافظه او الأصباغ اخبر الطبيب او الصيدلي اذا كانت لديكم اي ظروف صحيه ، ولا سيما ما يلي :
• مشاكل في العين ( مثل ارتفاع الضغط في العين او الغلوكوما )
• قرحة المعده
• البروستات ومن اعاقة او مشاكل المثانه البوليه
• امراض القلب
• السكري
• اذا كنت 60 عاما او اكثر ، كبار السن قد يكونوا اكثر حساسيه لآثار الدواء.

بسبب السودوايفيدرين في كلاريناسي يعتبر منشط رياضي واستخدامه في التنافس الرياضي لا يوصه به .
اذا كنت تـأخذ ادوية اخرى اخبر الطبيب او الصيدلي.

بعض الادوية ينبغي الا تؤخذ مع كلاريناس وهي تتضمن :
• القلب او ضغط الدم الادوية
•المنومات ، والأدوية المستخدمة في علاج الاكتئاب
• مضادات الحموضة
• الكاولين فهذه الادوية قد تؤثر على مدى نجاحه.

الجرعة من الكلاريناس ؟؟
في البالغين والاطفال الاكثر من 12 عاماقرص واحد كل 12 ساعة.
ولا يهم اذا كنت تأخذ كلاريناس قبل او بعد الطعام.
لا تستخدم في الاطفال تحت سن 12 سنة.
واذا كنت لا تتبع التعليمات فإنك قد لا تحصل على شفاء من اعراض المرض.

كيف تأتخذ كلاريناس ؟
ابتلاع قرص الدواء مع كاس من المياه. لا يسحق او يكسر او يمضغ قبل البلع.
اذا كنت نسيت ان تأخذ جرعة من الدوء فتجهالخا وركز على الجرعة الجديدة.أو خذها فور تذكرها، ثم عودوا الى الطريقه الاعتيادية. لا تأخذ جرعة مضاعفة لتعويض الجرعه التي فاتتك.

اذا كنت تعتقد انك او اي شخص آخر قد أخذ الكثير من كلاريناس فيجب مراجعة الطبيب حتى اذا لم تكن هناك علامات المغص او التسمم فقد تحتاج الى عنايه طبية عاجلة.

يجب عليك الا تعطى الكلاريناس لشخص آخر ، حتى لو أعراض مرضه تبدو شبيها لك.
كلاريناس يحتمل ان تجعلك نعسان. اذا كنت نعسان ، لا تقود السيارة او تعمل مع الآلات.

أوقف اخذ كلاريناسي قبل 48 ساعة من أجراء اي اختبارات للجلد.
فالانتيهيستامين قد تتداخل مع نتائج الاختبارات الجلديه.

الآثار الجانبية
اخبر الطبيب او الصيدلي في اقرب وقت ممكن اذا كنت تشعر انك غير جيد خلال فتره اشتخدام الكلاريناس.
كلاريناسي يساعد معظم الناس لعلاج الحساسيه ، لكنها قد تكون غير مرغوب فيها في عدد قليل من الناس مثل الادوية الاخرى .

كلاريناسي يمكن ان يسبب بعض الآثار الجانبية اذا حدثت فانها من الارجح ان تكون بسيطة وعابرة بيد أن البعض قد تكون خطيرة وتحتاج الى عنايه طبية.
الاثار الجانبية للكلاريناس والتي توصف بانها خفيفة الى معتدلة تتضمن :
• متاعب النوم
• جفاف الفم الصداع
• دوخة
• اتعاب اخرى غير مرغوب فيها.
لا تشعر بالانزعاج من هذه القائمة من الاثار الجانبية المحتملة انك قد لا تشهد اي منها.

التخزين
بعد استعمال اقراص الكلاريناس فالتخزين يكون بابقاء العلبة في مكان جاف حتى يحين الوقت للجرعة القادمة ولا تخزنها في الحمام .
لا تتركها في السياره في الايام الحاره او على عتبات النوافذ.
ترفع الاقراص في مكان لا يستطيعون الاطفال الوصول اليها.

وصف المنتج
قرص دائري ابيض اللون.
كلاريناسي متاح في علب من 6 اقراص.
المكونات الفعالة
لوراتاديني 5مغ
السودوايفيدرين سلفات 120مغ

مكونات اخرى
• اللاكتوز
• السكروز
• نشا الذرة
• بوفيدوني
• المغنيسيوم الاستارات
• الشمع
• ثاني أكسيد التيتانيوم
• التلك .


اسم الدواء فوساماكس


http://www.fosamax-lawyer.com/images/fosamax.jpg (http://www.libyanyouths.com/vb/t116536.html)








اسماء أخري له :
أليندرونيت - بونابكس- أوستيوماكس- ألندوماكس- أوستيونات- أوستيوميفا.

دواعي الاستعمال :
علاج و الوقاية من هشاشة العظام لدي السيدات بعد أنقطاع الطمث.
علاج هشاشة العظام الناتجة عن استعمال الكورتيزون
بالإضافة إلي الكالسيوم و فيتامين د .
علاج هشاشة العظام لدي الرجال.
Paget's Disease of bone.
الدواء لا يستعمل في الأطفال.

كيفية الاستعمال :
الجرعة: قرص واحد يومياً 10 مجم
أو
قرص واحد أسبوعياً 70 مجم
يؤخذ القرص علي الريق مع كوب ماء كامل
( و لا يجب تناوله مع عصير البرتقال أو القهوة أو حتي المياه المعدنية )
لا يسمح بتناول أية أدوية أو أكل لمدة نصف ساعة بعده
لا يجب مضغ القرص أو تركه يذوب في الفم.
يجب ألا يرقد أو يستلقي علي ظهره المريض بعد تناول القرص لمدة نصف ساعة كاملة( بل يظل جالساً أو واقفاً )
يبدأ الأكل بعد نصف ساعة من الدواء.
إذا شعرت بصعوبة في البلع أو حرقان يجب الرجوع للطبيب فوراً

الآثار الجانبية
صداع, ألم بالمعدة, غثيان, عسر هضم, إمساك, إنتفاخ, إرتجاع أو قرحة في المرئ, قئ, صعوبة في البلع, أو ألم بالعضلات.

موانع الاستعمال:
الحساسية للدواء أو مشتقاته
عدم القدرة علي البقاء جالساً لمدة نصف ساعة
نقص الكالسيوم في الدم أو الأختلال الشديد في وظائف الكلي
يستخدم بحذر للمرضي المصابين بقرحة في الجهاز الهضمي مثل :
صعوبة في البلع, أمراض في المرئ, قرحة في المعدة أو الأثني عشر أو في حالات الأختلال المتوسط في وظائف الكلي.

التفاعلات الدوائية
أدوية الحموضة و الأدوية المحتوية علي الكالسيوم: تقلل من إمتصاص الدواء لذا يجب أخذها بعد ساعتين من تناول الدواء.
الأسبرين و المسكنات: يمكن أن تزيد من إحتمالية حدوث قرحة بالمعدة لذا يجب ملاحظة المريض جيداً.

الحمل و الرضاعة
الدواء يمكن أن يسبب آثار جانبية للجنين لذا لا يجب استخدامه إلا إذا كانت الفوائد المحتملة تفوق المضار.
الدواء يمكن أن يصل من خلال اللبن إلي الطفل لذا لا يجب استعماله لمن ترضع .

الجرعة الزائدة
أعراضها: نقص معدل الكالسيوم في الدم, نقص الفوسفات في الدم, مشاكل بالجزء العلوي من الجهاز الهضمي مثل حرقان, إلتهاب المرئ, أو حدوث قرحة.
في هذه الحالة يجب إعطاء المريض اللبن أو مضادات الحموضة لكي تقلل من إمتصاص الدواء.
و يفضل عدم محاولة إحداث قئ.
كما يفضل أن يظل المريض في الوضع جالساً و لا يستلقي.

إذا نسيب جرعة
إذا نسيت جرعة لا تتناولها وسط اليوم بل قم بأخذ الجرعة التالية في موعدها صباح اليوم التالي.

التخزين
احتفظ بالدواء في عبوته الأصلية.
احفظه في درجة حرارة الغرفة بعيداً عن الحرارة الزائدة و الرطوبة.
لا تخزنه في الحمام.






احفظه بعيداً عن متناول الأطفال




اسم الدواء أتورفاستاتين


http://www.pharmacheck.com/assets/images/boxes/atorvastatin40mg/image-1.gif (http://www.libyanyouths.com/vb/t116536.html)




اسماء أخري له :
ليبيتور- أتور- ليبونا- ليبوكول- ليبيليس.

دواعي الاستعمال :
بالإضافة إلي التنظيم الغذائي لعلاج إرتفاع الكوليسترول و الدهون الثلاثية في الدم.
كما يستخدم للوقاية من الجلطات لدي مرضي إرتفاع الكوليسرول في الدم و للتقليل من إحتمال الوفاة نتيجة اسباب متعلقة بالقلب.
كيفية الاستعمالا لجرعة في الكبار:
قرص واحد 10 مجم مرة واحدة يومياً و يمكن زيادتها حتي 80 مجم بحد أقصي علي حسب الإستجابة.

الآثار الجانبية :
صداع, تورم بالأطراف, ضعف, دوخة, هرش, ألم بالمعدة, إمساك, إنتفاخ, و قد يسب ألم بالعضلات أو المفاصل و الظهر.
الدواء يمكن أن يسبب إرتفاع في إنزيمات الكبد, ضرر للعضلات, و ألتهاب البنكرياس.
يجب إيقاف العلاج و إخطار الطبيب فوراً إذا شعرت بألم في العضلات, ضعف عام أو إرتفاع غير مبرر لدرجة الحرارة.

يجب عمل تحليل لوظائف الكبد قبل بدء العلاج و بشكل دوري أثناء استخدامه كل ثلاثة أشهر.

موانع الاستعمال:
الحساسية للدواء أو مشتقاته .
أمراض في الكبد أو أرتفاع في إنزيمات الكبد.
الحمل.
يستخدم بحذر: للمرضي الذين لديهم تاريخ مرضي بأمراض ف الكبد أو من يشربون الكحوليات بكثرة.

التفاعلات الدوائية :
الأدوية التالية يمكن أن تزيد من الأثار الجانبية للدواء بشكل خطير:
كلاريثروميسين, سيكلوسبورين, دلتيازيم, أريثروميسين, فلوفوكسامين, أريثروميسين, فلوكونازول, إتراكونازول, كيتوكونازول, ميكونازول,كلوفيبريت, فينوفيبريت, جمفيبروزيل, و النياسين, و فيراباميل لذا يجب تجنب أستعمالها.
الآثار الجانبية للدواء ليفوثيروكسين يمكن أن تزيد إذا أستعمل في نفس الوقت مع الدواء.
الدواء يمكن أن يزيد من تركيز الديجوكسين و الإثينيل أسترادايول( أقراص منع الحمل ) في الدم.
أدوية الحموضة يمكن أن تقلل من تركيز الدواء في الدم.
الطعام: عصير الجريب فروت يمكن أن يزيد من تركيز الدواء في الدم لذا يجب تجنبه.
الأعشاب: عشبة سان جون يمكن أن تقلل من تأثير الدواء.

الحمل و الرضاعة :
الدواء يمنع تماماً أثناء الحمل نظراً لخطورته علي الجنين.
الدواء لا يجب أستعماله لمن ترضع رضاعة طبيعية.

الجرعة الزائدة :
لا يوجد علاج محدد لها. فقط ضع المريض تحت الملاحظة الطبية
إذا نسيب جرعة :
قم بأخذ الجرعة المنسية فور تذكرك.
و لكن لا تقوم بأخذ الجرعة المنسية إذا كان ميعاد الجرعة التالية قد قرب.
في هذه الحالة اترك الجرعة المنسية و خذ الجرعة التالية في موعدها.
لا تقوم بمضاعفة الجرعة.

التخزين :
احتفظ بالدواء في عبوته الأصلية.
احفظه في درجة حرارة الغرفة بعيداً عن الحرارة الزائدة و الرطوبة.
لا تخزنه في الحمام.



احفظه بعيداً عن متناول الأطفال.

nosa_aic
09 - 12 - 2011, 13:49
اسم الدواء ليدوكائين







http://www.newlinemedical.com/assets/images/store/lidocaine-hci-2-150000web_large.jpg

الليدوكائين،Lidocaine ، C14H22N2O عقار ينتمي إلى عائلة أدوية المخدّر الموضعي .
عند وضعه على الجلد ينتج شعور بإزالة الألم وذلك بقمع الإشارات في نهايات العصب في الجلد.
دهان الليدوكائين الموضعي يستعمل للتخفيف من الألم والإنزعاج الناتج عن عدوى فيروس الهيربس الذي يصيب الجلد.

آلية التأثير :
الليدوكائين مخدر موضعي ذو روابط أميدية .
يعمل على تحسين الغشاء الخلوي للخلية العصبية ويمنع النبضات على طول العصب.
الليدوكائين يصرف فقط بوصفة طبّية.

قبل الاستعمال :
النقاط التالية يجب أنْ تؤخذ بالإعتبار:
الحساسية
الحمل لم يُدرس تأثيره على النساء الحوامل.
الرضاعة من الصدر تعبر كميات صغيرة من الليدوكائين إلى حليب الصدر.
من الأفضل النقاش مع الطبيب.
الأطفال الدراسات على هذا العقار أجريت فقط على المرضى البالغين، وليس هناك معلومات معيّنة تُقارن إستعمالَ كريمات الليدوكائين الموضعية لدى الأطفال مع مجموعة الأعمار الأخرى.
المُسِنّون، العديد من الأدوية لم ُتدرس بشكل محدد لهذه الفئة. لذا، لا يُعْرَف تأثير العقار عليهم. ليس هناك معلومات معيّنة تُقارن إستعمالَ دهون الليدوكائين الموضعية لدى المسنين مع مجموعةِ الأعمار الأخرى.
الأدوية الأخرى قد يتسبب بمشاكل صحية لدى أستعماله مع أدوية أخرى،
يجب إستشارة الطبيب.

الاستعمال الصحيح :
لا يجب وضع هذا العقار على الجروح المفتوحة، أو الحروق.
لا يجب وضع هذا العقار في العين، لأحتمال حدوث إشكالات حادة. عند دخولها في العين تَغْسل العين فورا بالماء وتغطى حتى يعود الإحساس فيها. يجب الإتصال أيضا مع الطبيب.
لا مشكلة من إرتداء الملابس فوق الدواء.
يستخدم الليدوكائين كمخدر موضعي في حالات زرق الأدوية عضليا وفي الجل المستخدم في الحروق الموضعية ( ليدوكائين جل )

التحذيرات :
يستعمل بحذر عندما تكون المخاطيات ملتهبة, وكذلك عندما يطبق على الأغشية المخاطية. لا يستعمل لفترة طويلة.

الآثار الجانبية:
الجرعة والإعطاء
يستعمل الجل 1-3 مرات يومياً.
يجب ألا تتجاوز الجرعة المأخوذة في كل مرة 5 - 10غ .



ادوية الجهاز العصبي المركزي


http://www.zajel.edu.ps/learn/7/science/images/l2/l2-22-10-2005-2.jpg




أدوية الجهاز نظير الودي :
منبهات كولينية = محاكيات الودي Parasympathomemtics
استرات الكولين
قلويدات Alkaloids : ( ماسكارين - اريكولين - بايلوكاربين )
مثبطات الكولين استراز Colineestrase Inhibitors
منبهات كولينية مركزية

أدوية الجهاز الودي :
منبهات الودي ( مقلدات الودي, شادات الودي ) adrenergic agonists
مثبطات الودي Adrenergic Depressants = مضادات الودي
( ضادات الودي) Adrenergic Antagonist .
حاصرات أدرينالينية ( حاجبات التأثير الأدريناليني ) Adrenergic blockers
حاصرات ألفا Alpha blockers
حاصرات بيتا Beta Blockers
حالات الودي Sympatholytics ( حاجبات العصاب الأدرينية ).
حاصرات العقد العصبية Ganglionic blockers ( حاصرات العقد التلقائية ).
حاصرات عقدية مزيلة للاستقطاب Depolarizing ganglionic blockers
حاصرات تنافسية ( حاجبات تنافسية ) Competitive Blockers

أدوية الجهاز العصبي المركزي :
منبهات الجهاز العصبي المركزي :
منبهات القشرة المخية
كزانتينات ( مشتقات الكزانتين ) Xanthine Derivatives
منبهات النخاع المستطيل Medullary stimulants .
منعشات Analeptics
منبهات النخاع الشوكي Spinal cord stimulants
ستريكنين Striknine
مثبطات الجهاز العصبي المركزي:
مخدرات عامة General Anesthetics
مخدرات سائلة
مخدرات غازية
مخدرات وريدية
مخدرات ستيروئيدية
مخدرات قاعدية
منومات Hypnotics
باربيتورات Barbiturates
منومات غير باربيتورية Nonbarbiturate Hypnotics
( ماءات الكلورال ، بارالدهيد ، ميتيلبيرون ، شاردة البروميد ، غلوتيتاميد )
مطمئنات Tranquilizers
مطمئنات كبرى (عامة ) General Tranquilizers
بعض مشتقات الفينوتيازين و الكلوروبرومازين
قلويدات الراولفيا ( أهمها الريزربين ) .
مطمئنات صغرى Minor Tranquilizers
بعض مشتقات الفينوتيازين
( برومازين ، بروميتازين )
مشتقات البروبانديول ، مشتقات البنزوديازبين ( فاليوم ، ليبيريوم )
منشطات نفسية Psychoanaleptics = مضادات الاكتئاب Antidepressants
مضادات المونوامينواكسيداز M O A I
مضادات الاكتئاب الحلقية الثلاثية و الرباعية
مسكنات الألم Analgesics
مسكنات ناركوتينية ( مخدرة ) Narcotic analgesics أهمها المورفين.
مسكنات ألم غير مخدرة ( خافضات حرارة Antipyretics )
خافضات حرارة مركزية central antipyretics = analgesics -antipyritics
خافضات حرارة محيطية peripheral antipyretics

ادوية الوظائف الحركية :
ادوية باركنسون
مضادات الكولين
مضادات التشنج Anticonvulsants :
( بعض الباربيتورات,مشتقات البيريميدون,مشتقات الهيدانتوئين,مشتقات السوكسيناميد,اسيتازولاميد )
مرخيات العضلات الهيكلية ( الإرادية ) ٍ Skeletal muscle relexants .
مرخيات عضلات هيكلية مركزية ( ميفينيزين )
مرخيات عضلات هيكيلية محيطية ( قلويدات الكورار ، فلاكسيديل ، ديكاميتونيوم )



ميتفورال

http://www.farmayala.com/Metforal.jpg




خافضات سكر الدم الفموية
ميتفورال مضغوطات 500 ملغ ، 850 ملغ
الأسم العلمي
ميتفورمين هيدروكلورايد

التركيب :
كل مضغوطة ملبسة بالفيلم تحوي 500 أو 850 ملغ ميتفورمين هيدروكلورايد

الأستطباب والاستخدام :
يستعمل المستحضر لمعالجة الداء السكري لدى البالغين ( داء السكري من النمط II ) وخاصة في حالة فرط الوزن، وإذا كانت المعالجة بالحمية لوحدها أو النشاط الرياضي غير كافيين .

الجرعة :
تحدد مقدار الجرعة اليومية من ميتفورال من قبل الطبيب المعالج وبشكل شخصي وبالنسبة لكل مريض على حده، وبشكل عام فإن الجرعة اليومية هي مضغوطة واحدة من عيار 850 صباحاً وأخرى مساء بفاصل 12 ساعة ويفضل تناولها بعد الطعام،
أو 3-4 مضغوطات من عيار 500 ملغ يومياً وعلى دفعتين إلى 1- 2 مضغوطة من كل دفعة وبفاصل 12 ساعة ويفضل تناولها أيضاً بعد الطعام،

وينصح بدء المعالجة بجرعة بدئية من مضغوطة واحدة يومياً من عيار 850 ملغ
أو 1-2 مضغوطة من عيار 500 ملغ وتُزاد تدريجياً إذا دعت الضرورة ومع ذلك فيجب عدم تجاوز جرعة 3 مضغوطات من عيار 850 أو 5 مضغوطات من عيار 500 ملغ.

يجب على المريض احترام الجرعات الموصوفة من الطبيب المعالج والحمية الغذائية مع إجراء نشاط رياضي مناسب.

التغليف :
عبوة تحوي 40 مضغوطة لعيار 500 ملغ
عبوة تحوي 20 أو 30 مضغوطة لعيار 850 ملغ

nosa_aic
09 - 12 - 2011, 13:54
ايبربروفين
http://www.abbottnederland.nl/uploads/pics/Brufen_Bruis_600_02.jpg


مضاد التهاب غير سيرويدي لمعالجة الروماتيزم, مسكن
الوصف :
يستطب ايبوبروفين من أجل تأثيراته المسكنة للألم و المضادة للالتهاب في معالجة التهاب المفاصل الرثوي ( بما فيه التهاب المفاصل الرثوي الشبابي، أو داء ستيل ) و التهاب الفقار الرثوي و الفصال العظمي و الاعتلالات المفصلية الأخرى غير الرثوية.


التركيب :
كل 5 مل من المعلق الفَمَوي تحتوي على: إيبوبروفين 100 ملغ ، 200 ملغ.

الاستطباب :
يستطب ايبوبروفين من أجل تأثيراته المسكنة للألم و المضادة للالتهاب في معالجة التهاب المفاصل الرثوي ( بما فيه التهاب المفاصل الرثوي الشبابي، أو داء ستيل ) و التهاب الفقار الرثوي و الفصال العظمي و الاعتلالات المفصلية الأخرى غير الرثوية.

في الحالات الرثوية الأخرى غير المفصلية فإن الايبوبروفين يوصف لحالات خاصة مثل تصلب الكتف و التهاب المحفظة و التهاب الجراب و التهاب الوتر و التهاب غمد الوتر و ألم أسفل الظهر ، كما يمكن استعمال ايبوبروفين في علاج إصابات الأنسجة الرخوة مثل الوثي والإجهاد.

يستطب ايبوبروفين لتأثيره المسكن للألم لمعالجة الآلام الخفيفة و المتوسطة مثل آلام عسر الطمث و آلام الأسنان و الآلام ما بعد العمليات الجراحية و للتخلص من أعراض الصداع بما في ذلك الشقيقة.

مضادات الاستطباب :
يجب عدم إعطاء ايبوبروفين للمرضى الذين لديهم قصة قرحة أو لديهم قرحة هضمية فعالة.
لا يعطى ايبوبروفين للمرضى الذين ظهر لديهم تفاعلات تحسسية و ذلك استجابة للإيبوبروفين أو الأسبيرين أو أي أدوية أخرى من مضادات الالتهاب غير الستيروئيدية.

آثار جانبية :
معظم التأثيرات غير المرغوبة كانت تأثيرات معدية معوية: غثيان، اقياء، اسهال، تخمة، ألم بطني، التهاب المعدة التقرحي.
وبتكرار أقل : التهاب المعدة، القرحة العفجية، القرحة المعدية و الانثقاب المعدي المعوي.
سجلت تفاعلات تحسسية بعد العلاج بالايبوبروفين.
سجلت حالات من الوذمة عند المعالجة بالايبوبروفين.

التأثير الدوائي :
يجب أخذ الإحتياط لدى المرضى الذين يتناولون أي من الأدوية التالية حيث ذكر وجود تداخل دوائي بين ايبوبروفين و بينها:
خافضات الضغط الشرياني، المدرات، الغليكوزيدات القلبية، الليتيوم، سيكلوسبورين، ميفيبريستون، الكورتيزونات، مضادات التخثر، المضادات الحيوية الكينولونية.

الجرعة :
البالغين: الجرعة المعتمدة من ايبوبروفين هي 1200 ملغ إلى 1800 ملغ في اليوم مقسمة إلى جرعات. عند بعض المرضى يمكن المُحافَظَة على جرعة 600 مِلغ إلى 1200 ملغ في اليوم.
في الحالات الحادة أو الشديدة من الممكن أن تساعد زيادة الجرعة في السيطرة على الحالة الحادة بشرط أن لا تزيد الجرعة اليومية عن 2400 ملغ مقسمة إلى جرعات.
الأطفال:
- لتخفيض الحرارة و لتخفيف الألم البسيط و المعتدل فان الجرعة اليومية هي 20ملغ\كغ و بجرعات مجزأة.
- الأطفال أقل من 30 كغ: لا يجوز للجرعة الاجمالية المعطاة خلال 24 ساعة أن تتجاوز 500 ملغ و لا ينصح بإعطاء الإيبوبروفِن للأطفال الذين ينقص وزنهم عن 7 كغ.
- عِند الأطفال في الاستعمالات الأخرى: يمكن زيادة الجرعة اليومية من الشراب حتى 40ملغ\كغ و بجرعات مجزأة.

تحذيرات :
-يجب عدم أخذ الدواء لأكثر من عشر أيام كمسكن للألم أو أكثر من ثلاثة أيام كخافض للحرارة ما لم يوصف من قبل الطبيب.
- انه من المهم وبشكل خاص عدم تناول ايبوبروفين خلال الأشهر الثلاث الأخيرة من الحمل ما لم يوصف من قبل الطبيب لأنه قَد يسبب مشاكل عند الجنين، أو صعوبات أثناء الولادة.

العبوات :
عبوة تحتوي على 100 مل (100 ملغ ) من المُعَلَّق.
عبوة تحتوي على 200 مل (200 ملغ ) من المُعَلَّق.



لوبيراميد



التعبئة والتركيب :
عبوة تحوي 20 كبسولة. كل كبسولة تحوي 2 ملغ لوبيراميد هيدروكلورايد.

الخواص :
لوبيراميد هيدروكلورايد مشابه مورفيني صنعي يقوم بتثبيط حركة المعي كما يقوم أيضاً بتخفيف الإفرازات الهضمية.

آلية التأثير والتأثيرات الدوائية :
يعمل لوبيراميد هيدروكلورايد عن طريق إبطاء حركة المعاء والتأثير على حركة الماء والشوارد عبر الأمعاء.

الحركة الدوائية والاستقلاب :
يتم امتصاص حوالي 40% من الجرعة ا لمأخوذة عن طريق الفم من لوبيراميد هيدروكلورايد عن طريق الجهاز الهضمي لتتعرض للاستقلاب في الكبد وتنطرح عن طريق البراز من خلال الصفراء بشكل مستقلبات مرتبطة غير فعالة. ينطرح قسم ضئيل من هذه الجرعة عن طريق البول، ويصل قسم ضئيل من الجرعة بشكل فعال إلى الدم. يبلغ عمر نصف انطراح لوبيراميد هيدروكلورايد حوالي 10 ساعات.

الاستطباب :
يستخدم لوبيراميد لضبط وتخفيف أعراض حالات الإسهال غير النوعي ولمعالجة أعراض الإسهال المزمن المترافق مع التهاب الأمعاء أيضاً. كذلك يمكن استخدامه لتديبر حالات فتح شرج صنعي في الكولون أو في المعي اللفائفي، عن طريق إنقاص حجم المفرغات.

مضادات الاستطباب :
يجب عدم استخدام الدواء عند المرضى المفرطي الحساسية تجاه المركب أو في الحالات التي يجب تجنب حدوث الإمساك فيها.

التأثيرات الجانبية :
التأثيرات الجانبية، التي يمكن أن تحدث من جراء استخدام لوبيراميد: آلام بطنية، غثيان، إمساك، جفاف الفم، دوخة، تعب جلدي.

التحذيرات :
يجب استخدام لوبيراميد بحذر عند المرضى المصابين بقصور كبدي وكذلك عند الأطفال. كما يجب عدم إعطاء لوبيراميد للمرضى المصابين بالزحار أو في حال كون الإمساك عرضاً يجب تجنبه. يجب ألا يعطى لوبيستوب إلى المرأة المرضع أو الحامل إلا عند الضرورة الملحة.

زيادة الجرعة :
ينتج عن زيادة الجرعة المسموح بها من مادة لوبيراميد هيدروكلورايد شلل المعي وتثبيط الجملة العصبية المركزية، وغالباً ما يكون الأطفال أكثر حساسية لتثبيط الجملة العصبية المركزية من البالغين.
تتم معالجة زيادة الجرعة من لوبيراميد بإجراء غسيل معدة وإعطاء الفحم المنشط عن طريق الفم، كما يجب إعطاء النالوكسون في حال ملاحظة بدء حدوث تثبيط الجملة العصبية المركزية.

الجرعة :
البالغون:
في حالات الإسهال الحاد يجب البدء بكبسولتين وإتباعهما بكبسولة واحدة عند استمرار الإسهال، وحتى 8 كبسولات يومياً. الجرعة الإعتيادية اليومية في حالات الإسهال الحاد هي 3-4 كبسولات.
أما في حالات الإسهال المزمن فيجب إعطاء 2-4 كبسولات يومياً بجرعات منفصلة، ولمدة 10 أيام. على أن لا تتجاوز الجرعة 8 كبسولات يومياً.
الأطفال:
يجب عدم ا ستخدام لوبيراميد هيدركلورايد عند الأطفال دون سن الرابعة.
4-8 سنوات: /1/ ملغ 4 مرات يومياً لمدة 3 أيام.
9-12 سنة: كبسولة واحدة من لوبيستوب 4 مرات يومياً وحتى 5 أيام.




صوديوم ديكلوفيناك

http://img.alibaba.com/photo/244085503/diclofenac_sodium_injection_finished_medicine_drug _pharmaceutical_.jpg




- صوديوم ديكلوفيناك 0.1 غ / 100 مل
- الشكل الصيدلاني: قطرة عينية عقيمة
- الفئةالعلاجية: مضاد التهاب غير ستيروئيدي

التعبئة والتركيب :
عبوة زجاجية تحوي: 5 مل.
كل 100 مل تحتوي على ديكلوفيناك صوديوم 0.1 غ.

الخواص :
فولتالينا قطرة عينية عقيمة تحوي ديكلوفيناك الصوديوم، وهو مضاد التهاب غير ستيروئيدي يملك صفات مسكنة، غير أن آلية تأثيره غير معروفة تماماً. ديكلوفيناك صوديوم مثبط للبروستاغلاندين حتى عند استعماله موضعياً. أظهرت الدراسات السريرية أن ديكلوفيناك صوديوم يثبط من تقبض الحدقة أثناء جراحة الساد وأنه يخفف من الالتهاب الذي يلي العمليات الجراحية. يصل مستوى ديكلوفيناك صوديوم في السائل الدمعي إلى 500 نانوغرام/غرام عند جرعة تساوي 3-16 قطرة. لم يكشف في البلاسما عن ديكلوفيناك صوديوم مما يدل على أن الامتصاص الجهازي الذي يلي استعمال القطرة ضئيل للغاية.

الاستطباب :
الوقاية قبل وبعد العمليات الجراحية ( الساد مثلاً ).
بعد رضوض القرنية والملتحمة غير الإنتانية.

مضادات الاستطباب :
التحسس نحو ديكلوفيناك صوديوم أو أحد مكونات المستحضر.
التحسس نحو مضادات الالتهاب غير الستيروئيدية.

التأثيرات الجانبية :
حرقة عابرة عند 5-15% من المرضى، لا تستدعي التوقف عن العلاج.

الاحتياطات :
- لا ينصح باستعمال المستحضر أثناء فترة الحمل والإرضاع ( لم يثبت أمان استعمال المستحضر ).
- لا ينصح باستعمال المستحضر عند الأطفال ( لم يثبت أمان استعمال المستحضر عند المرضى دون الـ 16 من العمر ).
- يمكن أن يحجب المستحضر أعراض الإنتان وبالتالي يجب استعماله تحت إشراف الطبيب.
- ليس هناك من احتمال حدوث تسمم حاد ( تحوي الـ 5 مل على 3% من الجرعة الموصى بها فموياً للبالغين ).
- يمكن استعماله بالمشاركة مع مضادات الالتهاب الستيروئيدية.
- عدم ارتداء العدسات اللاصقة أثناء المعالجة بالمستحضر.

الجرعة :
بحسب إرشادات الطبيب.
قطرة واحدة 4-5 مرات يومياً.

الحفظ والتخزين :
يحفظ المستحضر في الدرجة 25 – 30 مئوية.

nosa_aic
09 - 12 - 2011, 13:57
اسم الدواء فلوروكوينولونيس


التعريف :
فلووروكوينولونيس هي الادوية التي تقتل البكتيريا او تمنع نموها

الغرض :
فلووروكوينولونيس هي مضادات والادوية المستخدمة لعلاج الامراض التي تسببها الكائنات المجهريه. يصف الاطباء هذه الادوية لحالات العدوى البكتيريه في اجزاء كثيرة من الجسم. على سبيل المثال ، فهي تستخدم لعلاج العظام والاصابات المشتركة ، والالتهابات الجلديه ، التهابات المسالك البوليه ، والتهاب البروستات ، الالتهاب الشعبي والالتهاب الرئوي والسل وبعض الامراض التي تنتقل بالاتصال الجنسي) ، وبعض الامراض التي تصيب الناس

الوصف :
فلووروكوينولونيس لا تتوافر إلا بوصفة الطبيب ، وتباع على شكل حبوب وحقن . ومن أمثلة هذه الادوية موكيفلوكاكين (افيلوك) سيبروفلوكساسين (cipro) وفلوكاكين (فلوكين) ليفوفلوكاكين (ليفاكوين) لوميفلوكاكين (ماكاكوين) نورفلوكاكين (نوروكين) ينوكاكين (بينيتريك) غاتيفلوكاكين (تيكوين) ، وسبارفلوكاكين (زاغام)

جرعة :
الجرعه الموصى بها تتوقف على نوع وقوة فلووروكوينولوني
. لا تتوقف عن تعاطي المدواء بمجرد الاعراض تبدأ في التحسن. الاعراض قد تعود اذا كان العقار وقف قبل الاوان.
فلووروكوينولونيس العمل على أفضل وجه عندما تكون في مستويات ثابتة في الدم. وللمساعدة فى الحفاظ على مستويات ثابتة ، اخذ جرعة الدواء في اوقات متباعده بشكل متساو خلال النهار والليل. لا تفوت اي جرعة. للحصول على افضل النتائج ، وتأخذ هذا الدواء مع كوب كامل من المياه وعدة اكواب تشراب طوال اليوم ، كل يوم اثناء فترة العلاج. المياء سيساعد على منع بعض الآثار الجانبية. بعض فلووروكوينولونيس ينبغي ان تؤخذ على معدة فارغه ؛ آخرون يمكن ان تؤخذ مع الوجبات.

الاحتياطات :
سوء استخدام المضادات الحيويه يمكن ان تشجع سلالات مقاومه من البكتيريا لتطوير وتكاثر , ثم يصبح من الصعب ، بل من المستحيل ، ان يعالج.
وتشير الابحاث الى ان فلووروكوينولونيس قد يسبب مشاكل في نمو العظام عند الأطفال والمراهقين. الرضع والاطفال والمراهقين والحوامل والمرضعات من النساء لا ينبغي اتخاذ هذا الدواء الا اذا وجه الى ذلك الطبيب.

استدعاء طبيب فورا اذا كان اي من هذه البوادر خطيرة تحدث كردة فعل :
تورم في الوجه والحنجره
صعوبة البلع
ضيق الانفاس
سرعة نبض القلب
توخز الاصابع ، او اصابع القدم
الحك
فقدان الوعي
بعض فلووروكوينولونيس قد يضعف اوتار العضل في الكتف.
هذه الادوية تجعل بعض الناس يشعرون بنعاس ، تشويش ، دوار ، او اقل يقظه. لمن يأخذ هذه الادوية ينبغي الا يدفع ، واستخدام آلات أو أي شيء اخر يمكن ان يكون خطيرا حتى تبين لهم كيف يؤثر عليهم الدوء.
هذا الدواء قد يؤدي الى زيادة الحساسيه لضوء الشمس.
فالتعرض للشمس يمكن ان يحدث حرق الشمس الشديد او الطفح. لذلك يجب تفادي التعرض المباشر لضوء الشمس ، وخصوصا ما بين 10 و 3 بعد الظهر ؛ ارتداء القبعه.تغطي الاذرع والارجل ؛ استخدام حاجبه الاشعه الشمسيه

لا تأخذ انتي اسد التي تحتوي على الالومنيوم والكالسيوم او المغنيسيوم فى نفس الوقت مع فلووروكوينولونيس. اذا ان الانتي اسد يلزم أخذها على الاقل قبل ساعتين او ساعتين بعد اخذ نورفلوكاكين وفلوكاكين او على الاقل اربع ساعات قبل او بعد ساعتين من اخذ سيبروفلوكساسين. تتبع نفس التعليمات لاتخاذ سوكرالفاتي (كارافاتي) ، وهو دواء يستخدم لعلاج قرح المعده وغيرها تهيج في جهاز الهضمي والفم.

قبل استخدام فلوروكوينولونيس ينبغي التأكد من خلوهم من :
أمراض الكبد ,أمراض الدماغ أو النخاع الشوكي ، تصلب شرايين في المخ ، الصرع ، وغيرها من الاضطرابات .

الآثار الجانبية :
الاكثر شيوعا هي الاثار الجانبية خفيفة والاسهال والغثيان والقيء والام المعده او البطن ، والدوخة ، والخمول ، ومشاكل النوم ، والصداع.

اذا كان أي من الآثار الجانبية التالية تحدث يجب مراجعة الطبيب فورا :
الطفح الجلدى او غيرها من مشاكل جلديه مثل الحك ، والقشره ، او الاحمرار
والحمى ,هلوسه, تشنج ,توخز الاصابع ،الألم حيث تم حقن الدواء (دائم بعد الحقن) , تورم في الوجه أو الرقبه.

تفاعلات :
فلوروكوينولونيس قد تتفاعل مع بعض الادوية الاخرى. وعندما يحدث هذا ، اثار احدهما او كليهما قد تتغير او خطر الاثار الجانبية يمكن ان تكون اكبر. لمن يأخذ فلوروكوينولونيس.

ومن بين الأدوية التي قد تتفاعل مع فلوروكوينولونيس هي :
انتي اسد التي تحتوي على الالومنيوم والكالسيوم او المغنيسيوم
الادوية التي تحتوي على الحديد او الزنك ، الكافايين ,عقاقير تخفيف الدم مثل الورفرين (المنجلي) ,امينوفلين ، ثيوفيلليني

http://www.dominapharm.com/Images/tavafloxacin.jpg

تافا- فلوكساسين (أقراص ملبسة بالفيلم)
مضاد جرثومي واسع الطيف
التركيب:
كل قرص ملبس بالفيلم يحتوي على 250، أو 500ملغ ليفوفلوكساسين.
آلية التأثير:
إن مادة ليفوفلوكساسين مضاد حيوي صنعي واسع الطيف مشتق من فلوروكينولون. يُبيد تافا-فلوكساسين عدد كبير من الجراثيم سلبية وإيجابية الغرام، بسبب تدخله في اصطناع الـ DNA في هذه الجراثيم.
الاستطباب:


يستخدم تافا-فلوكساسين لمعالجة الأخماج الخفيفة إلى المتوسطة الشدة الحساسة تجاه ليفوفلوكساسين كما في الحالات التالية:

أخماج الجيوب الحادة .
أخماج القصبات .
ذات الرئة .
أخماج الجهاز البولي الشديدة والمترافقة بالتهاب الكلية والحويضة .
أخماج الأنسجة الرخوة والجلد .
الجرعة:


تحدد حسب نمط وشدة الخمج وحساسية العامل المسبب له.

أخماج الجيوب الحادة: 500 ملغ مرة واحدة يومياً لمدة 10 – 14 يوم .
أخماج القصبات: 250 - 500 ملغ مرة واحدة يومياً لمدة 7 أيام .
ذات الرئة: 500 ملغ مرة واحدة يومياً لمدة 7 – 14 يوم .
أخماج الجهاز البولي الشديدة والمترافقة بالتهاب الكلية والحويضة: 250 ملغ مرة واحدة يومياً لمدة 7 – 10 أيام .
أخماج الأنسجة الرخوة والجلد: 250 – 500 ملغ مرة أو مرتين يومياً لمدة 7 – 14 يوم .
تعدل الجرعات المذكورة أعلاه لمرضى القصور الكلوي، ولا داعي لتعديلها عند مرضى القصور الكبدي، أو الكهول.
التأثيرات الجانبية:
يمكن أن يحدث: غثيان، إسهال، ارتفاع في أنزيمات الكبد، وتمزق وتر.
أقل نسبة حدوث: حكة، تشنج قصبي، قهم، إقياء، ألم بطني، صداع، دوار، رنح، ارتفاع بيليروبين وكرياتينين الدم.
نادراً جداً: تشوش، تفاعلات ذهانية، وذمة وعائية، انخفاض ضغط، تسرع قلب، رجفة، قلق، وهيجان.
مضادات الاستطباب:
فرط حساسية تجاه ليفوفلوكساسين، أو أي من مشتقات كينولون، مرضى الصرع، المرضى الذين لديهم إصابة سابقة بالتهاب وتر العضلة عند استخدام فلوروكينولون، الأطفال والمراهقين.
التداخل الدوائي:
ينقص امتصاص المستحضر بشكل كبير عند مشاركته مع أملاح الحديد، أو مضادات الحموضة التي تحتوي على المغنزيوم أو الألمنيوم. لذلك يجب عدم تناول هذه المستحضرات إلا قبل أو بعد ساعتين من تناول الدواء. يحدث انخفاض ملاحظ في عتبة الاختلاجات (نوبة الصرع) عند مشاركة المستحضر مع التيوفيللين، مضادات الالتهاب غير الستيروئيدية، أو المستحضرات الأخرى التي تقلل عتبة التشنجات. يزداد نصف عمر سيكلوسبورين حوالي 33% عند مشاركته مع المستحضر.


تحذيرات:

يستخدم المستحضر بحذر شديد (كما في كل مشتقات كينولون ) عند المرضى المعرضين للإصابة بنوبات صرعية .
يجب إيقاف المعالجة وإعلام الطبيب عند حدوث إسهال شديد مترافق مع استخدام المستحضر .
يجب الحذر عند مشاركة المستحضر مع الأدوية ذات الإطراح الكلوي الأنبوبي (مثل بروبنسيد، سيمتدين) وخاصة لدى مرضى القصور الكلوي .
الاستخدام أثناء الحمل أو الإرضاع:
لا يستخدم المستحضر أثناء الحمل أو الإرضاع.
التعبئة:
عبوة كرتونية تحتوي مغلف يحتوي 10 أقراص ملبسة بالفيلم بتركيز 250 أو 500ملغ، مع نشرة.



اسم الدواء أموكسيسللين / كلافيولينيت
http://www.alhakea.com/home/thumbnail.php?file=________2_394533223.jpg&size=article_medium

اسماء أخري له :
أوجمنتين- هاي بايوتيك- كيورام- دلتاكلاف- ميجاموكس- ماجنا بيوتيك- ايموكسكلاف- كلافوكس.
http://www.alkhaleej.ae/uploads/gallery/2011/07/03/163705.jpg
دواعي الاستعمال :
عدوي الجهاز التنفسي السفلي, إلتهابات الإذن الوسطي, إلتهاب الجيوب الأنفية, إلتهابات الجلد , و إلتهابات الجهاز البولي. و خاصة تلك الحالات التي تعاني من مناعة من تأثير الأموكسيسللين بمفرده.

كيفية الاستعمال :
الدواء يحتوي علي مادتين و يكتب التركيز كمجموع للمادتين معاً فمثلا أوجمنتين 625 عبارة عن ( أموكسيسللين 500 + كلافيولينيت 125) تحسب الجرعة علي حسب محتوي الدواء من مادة الأموكسيسللين.
يفضل أخذه مع الطعام حتي لا يسبب متاعب بالمعدة.
و يجب إكمال كورس العلاج بالكامل كما حدده الطبيب المعالج.

الجرعة المعتادة هي:
في الكبار: 250 مجم كل ثماني ساعات أو قرص 500 مجم كل 12 ساعة.
و لعلاج الحالات الأشد من العدوي يمكن استخدام 500 مجم كل ثماني ساعات أو 875 مجم كل 12 ساعة.
الأطفال أقل من 40 كجم وزن: نفس جرعة الكبار.
الأطفال أقل من 40 كجم وزن: تحسب الجرعة علي حسب الوزن, 25-45 مجم لكل كجم من وزن الجسم في اليوم و تقسم علي جرعتين أو ثلاثة في اليوم.
أما في حالة ألتهاب الأذن الوسطي فتحسب الجرعة علي أساس 90 مجم و تعطي مقسمة علي جرعتين يومياً لمدة عشرة ايام كاملة.
الأطفال الرضع أقل من ثلاثة أشهر من العمر:
30 مجم لكل كجم من وزن الجسم في اليوم و تقسم كل 12 ساعة.
مرضي أختلال وظائف الكلي:
Clcr 10-30: يستخدم 250-500 مجم كل 12 ساعة.
Clcr <10: يستخدم 250-500 مجم كل 24 ساعة.

الآثار الجانبية :
الدواء قد يسبب التوتر, الأرق, و الدوخة.
كما قد يسبب الغثيان, القئ, الإسهال. و ألتهاب المهبل.
أيضاً نقص عدد الصفائح الدموية, و نقص كرات الدم البيضاء, كما قد يسبب حساسية في صورة طفح جلدي, هرش. و أيضاً نمو بعض الميكروبات الأخري.
في حالة حدوث أسهال يجب إبلاغ الطبيب فوراً.

موانع الاستعمال:
المرضي الذين لديهم حساسية من الدواء أو من مشتقات البنسلين عموماً
المرضي الذين أصيبوا بمتاعب سابقة في الكبد أو المرارة نتيجة استخدام الأموكسيسللين.
الأستعمال الطويل قد يسبب عدوي بكتيرية أخري.

التفاعلات الدوائية :
ألوبيورينول: يزيد من أحتمال حدوث طفح جلدي إذا استخدما معاً.
مضادات التجلط: يزيد تأثيرها عند استعمالها مع الدواء.
بروبنيسيد: يقلل من قدرة الجسم علي التخلص من الدواء و يرفع من تركيزه في الدم. تجنب استعمالهما معاً
ميثوتريكسيت: استخدام الدواء بجرعات عالية معه يتداخل في قدرة الجسم علي التخلص منه و قد يسبب زيادة سمية في الجسم. لذا يجب ملاحظة الآثار الجانبية عند استعمالهما.
أقراص منع الحمل: تقل فاعليتها في حالة استخدام الدواء لذا يجب الحرص و استخدام وسائل أخري للوقاية من الحمل.

الحمل و الرضاعة :
الدواء يمكن استعماله أثناء الحمل إذا رأي الطبيب المعالج ضرورة ذلك. الدواء يفرز في لبن الأم لذا يجب استعماله بحرص أثناء الرضاعة الطبيعة.

الجرعة الزائدة :
قد تسبب ألم بالمعدة, إسهال, دوخة, طفح جلدي, قئ و تشنجات. يتم عمل غسيل معدة بعد تناول الجرعة الزائدة بأقل من أربع ساعات لكي يكون فعال و كذلك يمكن محاولة أحداث قئ للتخلص من الدواء. ثم يتم إعطاء فحم نشط لأمتصاص الباقي منه.

إذا نسيب جرعة :
قم بأخذ الجرعة المنسية فور تذكرك.
و لكن لا تقوم بأخذ الجرعة المنسية إذا كان ميعاد الجرعة التالية قد قرب. في هذه الحالة اترك الجرعة المنسية و خذ الجرعة التالية في موعدها. لا تقوم بمضاعفة الجرعة.

التخزين :
الدواء الشراب يجب وضعه في الثلاجة بعد حله بالماء مباشرة.
و يستخدم خلال 10 أيام فقط.
احتفظ بالدواء في عبوته الأصلية.
احفظه في درجة حرارة الغرفة بعيداً عن الحرارة الزائدة و الرطوبة.
لا تخزنه في الحمام.



احفظه بعيداً عن متناول الأطفال.




ألجينات الصوديوم



التركيب :
ألجينات الصوديوم.......5.00 غ
بيكاربونات الصوديوم...2.67غ

الشكل الصيدلاني :
مزيج معلق للشرب في قارورة سعتها250 ملل
الفئة الصيدلانية والعلاجية
مضاد الارتداد- مضاد الحموضة

دواعي الاستخدام :
يوصف هذا الدواء في علاج الارتداد المعدي البلعومي الذي يسبب حرقة المعدة، صعود و ارتجاع حوامض و حرقات المعدة

احتياطات الاستخدام :
في حالة الحمية الغذائية الخالية أو قليلة الملح يجب الأخذ بعين الاعتبار محتواه من الصوديوم( 145 ملغ في كل ملعقتين صغيرتين )
اضافة الى استعمال هذا الدواء، ينصح باستخدام بعض القواعد الصحية و الغذائية:
ـ تجنب النوم فور الانتهاء من تناول الطعام
ـ عدم النوم على أرضية مستوية السطح ( يجب رفع رأس السرير لتخفيف نسبة الارتداد أثناء الليل )
ـ تجنب الأشغال التي تتطلب انحناء القسم الأعلى من الجسم نحو الأمام لمدة طويلة ( الأعمال المنزلية ،...)
ـ الحفاظ على الوجبات الأساسية دون أن تخللها و جبات خفيفة
التفاعلات بين الأدوية و التفاعلات الأخرى:
مضادات الحموضة قد تخفف من مفعول بعض الأدوية الأخرى (تخفيف الكمية الممتصة)، على سبيل الاحتياط ينصح بتفريق أوقات تناول هذا الدواء و دواء آخر ( يؤخذ عبر الفم) بساعتين إن أمكن مع :
- مضادات داء السل (ايثامبوتول، ايزونيازيد)
- المضادات الحيوية الحلقية (cyclines)
- المضادات الحيوية التي تنتمي إلى عائلة اللانكوزانيد (lincosanides)
- مضادات الهيستامين antihistaminiques H2) H2)
- أتنولول، ميتوبرولول، بروبرانولول ((aténolol, métoprolol, propranolol ))
- الكلوروكين( chloroquine) مضاد للملاريا
- ديفلونيزال (diflunisal) مضاد للحمى و مسكن للألم
- ديكوكسين (digoxine)علاج فشل القلب
- دي فوسفونات diphosphonates) )
- فلوورور الصوديوم (fluorure de sodium )
- بريدنيزولون، ديكساميتازون (prednisolone et dexaméthasone )
- الآندوميتاسين indométacine) ) مضاد للالتهاب
- كايكزالات (kayexalate) علاج لارتفاع تركيز البوتاسيوم في الدم
- كيتوكونازولkétoconazole) ) مضاد حيوي للأمراض الزهرية
- لونزوبرازولlansoprazole) )
- و أخرى مثل أملاح الحديد، سبارفلوكزاسين، البينيسيلينامين، و بعض أدوية الجهاز العصبي (neuroleptiques phénothiaziniques)
و من الأفضل أن يحترم مجال زمني بأربع ساعات بين الدواء والمضادات الحيوية التي تنتمي الى عائلة الفلوروكينولون.

حالات الحمل و الرضاعة:
بالإمكان وصف هذا الدواء خلال فترتي الحمل و الإرضاع إذا ما دعت الحاجة

كيفية استخدام هذا الدواء:
المقادير
ملعقتين صغيرتين ثلاث مرات يوميا بعد وجبات الطعام الرئيسية، وعند الاقتضاء في المساء قبل النوم
بالإمكان استعمال ضعف المقادير في حالات الارتداد أو التهاب البلعوم الحادة.

طريقة الاستخدام :
يؤخذ عبر الفم بعد رج القارورة جيدا
الأعراض الجانبية:
احتمال حصول امساك بسبب الألجينات
استخدامه لمدة طويلة قد يزيد من نسبة الكلسيوم في الدم (64.1 ملغ في كل 10ملل أي في ملعقتين صغيرتين من الدواء) مما قد يسبب قصورا كلويا.





المسكنات ... Analgesics

ما المسكن الذي تستعمله عند اصابتك بالصداع ، أو بألم أسنان ، أو بألم المفاصل وغيرها من الآلام وبخاصة المصحوبة بارتفاع درجة الحرارة ؟
وما المسكن الفعال في تخيف الألام الشديدة الحادة ، كتلك المصاحبة المسكنات أدوية تخفف الألم أوتزيله بتأثيرها المباشر في الجهاز العصبي المركزي
أو بتأثيرها المضاد الالتهابية ولمسببات الالتهاب .
وتمتاز بعض المسكنات بمفعول خافض للحرارة .

أولاً :: - - مسكنات الألم غير المخدرة .... Nonnarcotic Analgesics
وهي أدوية تسكن الألم الخفيف والمعتدل الشدة ، وتصرف في كثير من البلدان دون وصفة طبية لأنها لا تسبب الإدمان ولاتؤثر في مستوى الوعي .
ولبعض هذه المسكنات مفعول خافض للحرارة دون أن تؤثر في العوامل الحية المتسببة في ارتفاع درجة الحرارة .
وتصنف هذه الى قسمين همــــا :
المسكنات الخافضة للحرارة Analgesic-Anti pyre tics
ومن اشهر هذه المسكنات شيوعاً
السالسيلات salicylates
البارستامول paracetamol
ايبوبرفين ibuprofen
دايكلوفيناك Diclofenac

nosa_aic
09 - 12 - 2011, 14:02
الفيتامينات



الصفات العامة للفيتامينات :
1- ذات طبيعة عضويه
2- يحتاجها الجسم لكميات قليلة
3- يستطيع الإنسان إن يأخذ حاجته منها عن طريق الوجبات أو تصطنعها الجراثيم الطبيعية للأمعاء
4- حساسة الضوء وللحرارة والاكسده لذى يجب حفظها في مكان بارد وفي زجاجات غامقة اللون



فيتامين A


مصادره : الخضروات الصفراء زيت كبد الحوت - الحليب - الزبده - البيض .
وظيفته : يفيد النظر والحفاظ عليه ويفيد الجلد
نقصه : يؤدي إلى تشققات جلديه ( والعماء الليلي )




فيتامين D



مصادره : صفار البيض - زيت السمك - الحليب - الزبده
وظيفته : المساعدة على امتصاص الكالسيوم والفسفور واستخدامها في تكوين العظام
نقصه : يؤدى ألي مرض الكساح في الأطفال وتكليس العظام عند الكبار




فيتامين K
مصدره : الكبد - البندوره - السبانخ .
الوظيفة : صناعة البروثرومين ألازم لتخثر الدم
نقصه : يؤدى إلى حدوث النزيف



فيتامين BCOMPLEX



وهو يتألف من و B6 ,B2 , B1,B12
مصادره : البيض - الحليب - الكبد
وظيفته : في عملية البناء والهدم
نقصه : مرض البربري ...التهاب الأعصاب ..أمراض جلدي



فيتامين B



مصادره : الكبد - الكلى - الحليب - الجبن - البيض .
وظيفته : له دور في اصطناعه كريات الدم الحمراء
نقصه : يؤدي إلى نوع من أنواع فقر الدم



فيتامين c

مصادره : الحمضيات - الخضروات الخضراء - البطاطا .
وظيفته : يساعد على تخثر الدم
نقصه : يؤدي إلى مرض الاسكربوت



حامض الفوليك ....folic acid

مصادره : الخضراوات ذات الأوراق الخضراء الطازجة
وظيفته : له دور في صناعة كريات الدم الحمراء
نقصه : يسبب الأنيميا ذات الخلايا الكبيرة



مدارات البول

مدارات البول ادويه في قوة تأثيرها , وهي تصنف حسب إلية عملها في مجموعات أهمها الثيازايدات والحموض الكاربو كسيلية , والمدارات التناضجية , والمدارات الحافظة للبوتاسيوم .

الثيازايدات وهي مدارات تعيق أعادة امتصاص الكهارل من النبيبات البولية , فيزيد طرح الصوديوم والكلوريد وبالتالي الماء , ويصاحب ذلك زيادة في طرح البوتاسيوم الذي يجب تعويضة في أثناء العلاج .
تستعمل هذه المدارات في المعالجة الوذمه المصاحبة لهبوط القلب , وبعض أمراض الكلى والكبد والرئتين , وفي معالجة أرتفاع ضغط الدم أما مفردة أو مع الأدوية الأخرى الخافضة لضغط الدم .

ومن التأثيرات الجانبية :
للثيازايدات نقص مستوى بوتاسيوم الدم , وبخاصة في أثناء المعالجة بالجرعات العالية المتكررة , مما يؤدي إلى وهن العضالات والاضطراب دقات القلب .
كما تسبب زيادة في سكر الدم وحمض اليوريك ودهون الدم .



الحموض الكربوكسيلية : وهي مدارات تعيق امتصاص أيونات الكلوريد والماء في النبيبات البولية في موقع يختلف عن ذلك الذي تعمل فيه الثيازايدات , كما تزيد طرح أيونات البوتاسيوم , وهي تؤدي الى أدرار قوي يدوم فترة قصيرة نسبيا مسببا هبوط في الضغط , واضطرابا في التوازن الماء وكهارل الدم , وتمتاز بأنها فعالة تفشل الثيازايدات والمدارات الأخرى .

ومن أشهر هذه المجموعة :
فروسمايد : وهي مدر قوي ذو مفعول سريع ولكنة قصير , بشبة الثيازايدات في استعمالاته وتأثيرات الجانبية , ويمتاز بإمكانية زرقة وريديا في الحالات التي تستدعي سرعة الإدرار كالوذمة
الرئوية الحادة .

المدارات التناضحية : هي أدوية ترفع تركيز الراشح الكبيي الى درجة تتجاوز طاقة الننيبات على أعادة امتصاص الكهارل , فتطرح مصطحبة كمية من الماء ويزيد بذلك أدرار البول .
وفي الوقت الحاضر قل استعمال هذه المدارات في معالجة الوذمة المزمنة .
والمانيتول وهو أحد ادوية هذه المجموعة ما زال مستعملا في معالجة الوذمة الدماغية الناجمة عن ورم دماغي , وفي معالجة ارتفاع ضغط العين .

nosa_aic
09 - 12 - 2011, 14:07
صعود الطوابق بسرعه يفيد القلب


http://grenadine.g.r.pic.centerblog.net/jfuxz4y4.gif


http://imagecache.te3p.com/imgcache/9350e5b09c04ea9c49f4502fdd88abca.jpg (http://www.libyanyouths.com/vb/t63247.html)




أكدت دراسة حديثة لمعهد جمعية أمراض القلب (http://www.libyanyouths.com/vb/t63247.html)التشيكية أن الجري أثناء صعود (http://www.libyanyouths.com/vb/t63247.html)البنايات حتى الطابق العاشر يقوي عضلة القلب (http://www.libyanyouths.com/vb/t63247.html)ويحافظ على وزن وصحة الجسم ويزيد من اللياقة البدنية، لكن في المقابل حذرت من خطر ذلك على من يعانون من اضطرابات ومشاكل صحية في القلب (http://www.libyanyouths.com/vb/t63247.html)حتى وإن كانت بسيطة.
وأشارت الدراسة إلى أن الجري حتى الطابق السابع ينظم ضربات القلب ويحافظ على الوزن وقوة العضلات، في حين أن متابعة الجري دون توقف إلى الطابق العاشر يزيد من قوة عضلة القلب على أن يكون ذلك عبر اتباع قواعد أساسية.
وهذه القواعد هي: وضع جهاز يشبه ساعة اليد من أجل قياس نبضات القلب، وهي نفسها تحدد قدرة القلب (http://www.libyanyouths.com/vb/t63247.html)على مدى التحمل وتنذر في حال وجود مشاكل طارئة، فعلى سبيل المثال الأطفال حتى سن الثمانية يجب ألا يتجاوزوا المعدل وهو 214 درجة.

وتضيف الدراسة التي أجريت على أكثر من 2000 متطوع أن هذه الطريقة يمكن تعليمها للأطفال منذ الصغر، بحيث يصعدون حتى الطابق الرابع يوميا ليتم زيادة عدد الطوابق
تلقائيا مع الكبر في السن، ولا تقتصر على أي عمر محدد وهذا ما يحدده الفحص أثناء الجري.
ويمكن تعويض الجري في البنايات لمن لا يتمكن من ذالك بالجري في الأماكن التي فيها منحدرات مثل التلال والجبال.
وينصح الطبيب بيتر بيركا، رئيس المعهد وهو جراح القلب الشهير في العاصمة براغ الأصحاء بممارسة هذه الرياضة التي قال إنها ستحافظ على عمل وقوة القلب، مشيرا إلى أن مقولة القلب له عمر محدد في تحمل الجهد غير صحيح ويمكن تعليم الجسم والقلب على التحمل إلى درجات يفوق توقعها خاصة للناس الأصحاء.

المصاعد

ودعت الدراسة إلى ضرورة التخلى عن صعود الطوابق عبر المصاعد، محبذة المشي الذي قالت إنه يساعد على الأقل نشاط عمل القلب، وضربت الدراسة مثلا بتوماش تشيلكو من سلوفاكيا، الذي أشارت إلى أنه فاز العام الماضي بمسابقة جرى خلالها حتى الطابق السادس والعشرين دون أن يسجل الجهاز الذي رافقه أي جهد أو مضاعفات، وعزت ذلك إلى تعلم تشيلكو لهذه الرياضة منذ صغره.
وذكرت ذات الدراسة أن هذا الشخص كان يجب عليه الانتباه إلى الأرقام التي يحددها الجهاز وكان يراعي عدم تجاوز قدرة القلب على التحمل ، لعلمه أن هذا الأمر كان سيسبب له اعتلالا في نظام عمل القلب على المدى الطويل، وقالت إنه كان يفضل قبل البدء برياضة الجري في الطوابق إجراء فحص للكشف عن مستويات الكولسترول في الدم.
وبدوره، قال الطبيب الجراح الشهير أودرجيخ براجان للجزيرة نت إن اعتلال عضلة القلب هو عبارة عن تراجع في كمية قذف الدم الجزئي من القلب إلى الجسم في كل عملية انقباض، وأوضح أنه في حال تمت المحافظة على قدرة جيدة وقوية لعضلة القلب فإن هذه العملية ستستمر حتى مع التقدم في العمر ويبقى القلب في حالة سليمة لا يحتاج معها إلى الأدوية المتعددة التي ترفع من نشاطه بشكل اصطناعي.
ولا يرجع براجان أسباب هبوط وتراجع عضلة القلب إلى السن وإنما إلى طريقة حياة الشخص، مشيرا إلى تسجيل أقل الحالات الجراحية في القلب لدى ممارسي الرياضة خاصة متسلقي الجبال، في حين ازدادت تلك العمليات لدى الأشخاص الذين قضوا حياتهم في الوظائف التي تتطلب الجلوس وراء المكاتب وعدم ممارستهم الرياضة، حيث أظهرت النتائج لدى هؤلاء ارتفاعا في مستويات السكر والكولسترول والدهون.

دمتٌم بصحه

nosa_aic
09 - 12 - 2011, 14:12
فوائد السبانخ لمرضى السكري و القلب



http://mas2020.net/up/up/63723763455958.jpg (http://www.libyanyouths.com/vb/t120176.html)


السبانخ من الخضراوات الورقية الغنية بالعناصر المعدنية الضرورية للجسم، كالحديد، والكالسيوم، والمغنيزيوم، والكبريت، إضافة إلى فيتامين ايه . بي . سي ويحتوي السبانخ أيضاً على البيتاكاروتين، الذي يقي من الأورام السرطانية، وأمراض القلب والأوعية الدموية. إذ أثبتت الدراسات أنه يحافظ على الخلايا بصورتها السليمة ويمنع تحولها للخلايا السرطانية وذلك لاحتوائه على نسبة عالية من الحمض الأميني (هيسيتيدين).



http://t3.gstatic.com/images?q=tbn:ANd9GcSiKl9FdQg57JJh8iXFI9NyqwvThqwjO 3YVxdoQz1RmlWnUXxXX&t=1 (http://www.libyanyouths.com/vb/t120176.html)



فوائد عديدة
يعتبر السبانخ مفيدا للحفاظ على صحة وسلامة العين، إذ يمنع التدهور المرتبط بحدوث تلف في الشبكية بسبب الشيخوخة والتقدم بالعمر، ما يؤدي لضعف النظر. وهو يقي من الإمساك لكونها من الخضروات الغنية بالألياف الغذائية الضرورية للجسم. ويعد مفيدا لمرضى القلب والسكري، إذ أوضح الباحثون أن السبانخ من المصادر الجيدة لمعدن المغنيزيوم الذي يلعب دوراً مهماً في العمليات الحيوية التي تقوم بها الخلايا داخل الجسم



http://news.makcdn.com/image3165007_320_235/340X297.jpg (http://www.libyanyouths.com/vb/t120176.html)



كما يساعد في تخفيض ضغط الدم المرتفع، وتعتبر أملاحه من المواد القوية المضادة للتشنجات، كذلك أثبت فاعلية مميزة في تقليل خطر إصابة السيدات الحوامل بحالات التشنج الحملي وتسمم الحوامل بحوالي 58%، وتخفيض خطر الوفيات الناتجة عنها بنحو 45بالمئة.
وقد أظهرت البحوث الحديثة، أن عنصر المغنيزيوم يتمتع بخصائص وقائية قوية ضد مرض السكري، فيقلل خطر الإصابة به من خلال تأثيره على هرمون الأنسولين وزيادة فعاليته في تنظيم مستويات السكر في الدم. ونظراً لخصائصه العلاجية والوقائية يمكن للحامل والمرضع، والطفل، ومن يعاني من فقر الدم، والوهن العام، تناول السبانخ من أجل الاستفادة من قيمته الغذائية.



http://t3.gstatic.com/images?q=tbn:ANd9GcQCqy-b-pSvGLT6JC2a2CKetus3RAZfFFmOCxPeY1H6XzH3unPiQQ&t=1 (http://www.libyanyouths.com/vb/t120176.html)



إرشادات
ينصح كل من يعاني من أمراض الكبد والروماتيزم، والرمال والحصى في المسالك البولية بعدم تناول
السبانخ أو التقليل من الكميات المتناولة منه، لكونه يحتوي على أوكزالات الكالسيوم التي تدخل في تركيب حصى المسالك البولية.
يمكن تناول السبانخ مطبوخاً باللحم أو بغيره. أو بإضافة كمية من السبانخ إلى طبق السلطة اليومي. وبالطبع ينبغي الحرص على تنظيفه بشكل جيد قبل تناوله سواء أكان نيئاً أو مطبوخاً.

gama
09 - 12 - 2011, 14:17
رائع ....ومرجع ممتاز وقت الاحتياج اليه ............

nosa_aic
09 - 12 - 2011, 14:25
من فوائد الفلفل الحار

http://img169.imageshack.us/img169/6241/awrd57or5qh0.gif





http://www.zwjte.com/s/media/images/8b3c58d7d0.jpg (http://www.libyanyouths.com/vb/ext.php?ref=http://www.zwjte.com/s/media/images/8b3c58d7d0.jpg)


إذا كنت تشعر بالبرودة الشديدة في الشتاء وتعاني من التشقق في أصابع يديك وقدميك فما عليك سوى أكل الفلفل الحار للتغلب على هذه المشكلة.



وقالت الدكتورة سارة بروير وهي طبيبة عامة وواضعة كتاب - الدليل الأساسي إلى الفيتامينات والمواد المعدنية والعقاقير النباتية - لصحيفة - ديلي ميل - إن الفلفل الحار يحافظ على سخونة وسريان الدم في الشرايين والأوردة، ويضخ الدم إلى كافة الأعضاء التي يحتاجها الجسم



من فوائد الفلفل الحار

إن الفلفل الحار مفيد للصحة رغم حرارته .. كما أن حرارة الفلفلتختلف حسب أنواعه ومن ناحية اللون فتتعلق درجة الحرارة بلون الفلفل الحار وعموما فإن الفلفل الأحمر أحر من الفلفل الأخضر والفلفل الأخضر أحر من الفلفل البنفسجي والأصفر والأسود لأن الفلفل الحار سيصبح أحمر وأحر عند نضوجه وطعم الفلفل الحارالأصفر والبنفسجي حلو.



http://www.baghdadiabian.com/filemanager.php?action=image&id=7679 (http://www.libyanyouths.com/vb/ext.php?ref=http://www.baghdadiabian.com/filemanager.php?action=image&id=7679)



فوائد الفلفل الحار كثيره وهذه بعضها


تقوية المعدة ومساعدة الهضم :


يتحلى
الفلفل الحار بدور تحفيز للفم والمعدة والأمعاء ويزيد تحرك المعدة والأمعاء ويدفع افزار هرمونات الهضم ويحسن نكهة الأطعمة.



وأجرى بعض الخبراء الصينيين في مجال الطب والتغذية تحقيقات في مقاطعتي هونان وسيتشوان فكشفوا أن نسبة الإصابة بقرحة المعدة بين سكان المقاطعتين منخفضة أكثر مما في المناطق الأخرى فضلا عن تفضيلهم أكل الفلفل الحار وذلك لأنه مفيد لتجديد الغشاء المخاطي في المعدة وحماية وظائف خلايا المعدة والأمعاء والوقاية من الإصابة بقرحة المعدة



http://mag.rjeem.com/wp-content/uploads/2011/06/Chili.jpg (http://www.libyanyouths.com/vb/ext.php?ref=http://mag.rjeem.com/wp-content/uploads/2011/06/Chili.jpg)



تحريك الدم وانتظامه :



وتساعد الفيلفة على تنشيط حركة الدم أكثر من أي نبات آخر.. ولذلك فقد وصفت بأنها أحد أفضل النباتات الملائمة للأزمات وكونها ترفع من كفاءة عمل جهاز الدورة الدموية فإن الفليفلة الحمراء تعزز طاقة الجسم وتخفف من آثار الإجهاد الذي يتعرض له الإنسان وكشفت التجارب التي أجريت في جامعة دوسلدروف عن أن الفليفلة تزيد من قدرة المريض على التركيز.



الوقاية من حصوة المرارة :



أكل الفلفل الأخضر مفيد للوقاية من حصوة المرارة لأن الفلفل الأخضر يحتوي على فيتامينات وافرة وخاصة فيتامين سي ويحول الكولسترول إلى حمض الصفراء مما يشكل الوقاية من حصوة المرارة. ويجب على المصابين بهذا المرض أن يأكلوا دائما الفلفل


الأخضر الغني بفيتامين سي لأنه يلعب دورا نسبيا في تخفيف المرض.


تحسين وظائف القلب :



الفلفل الحار له دورا كبيرا في تحسين وظائف القلب ودفع الدورة الدموية بالإضافة إلى تخفيض الدهون في الدم وتقليل الجلطة الدموية كما يلعب دورا وقائيا من الأمراض الأوعية الدموية.



http://share.muslmah.net/up/11/1490/21322409748.jpg (http://www.libyanyouths.com/vb/ext.php?ref=http://share.muslmah.net/up/11/1490/21322409748.jpg)



كماأن الفلفل الحار يساعد على تخفيض سكر الدم وتخفيف آلام الجلد الناجمة عن مختلف الأمراض. كما وجدوا أن الفلفل الحار يمكن أن يذيب الدهون داخل الجسم بشكل فعلي ويدفع الأيض وذلك مفيد لتخفيف الوزن فهذا خبر سار للنساء.




فوائد أخرى للفلفل:



وبما أن كمية قليلة من الفليفلة يمكن أن تزيد من فعالية معظم الأعشاب الأخرى فقد تم استخدامها في معظم الخلطات العشبية لزيادة فعاليتها فعند إضافتها للثوم مثلا فإنها تزيد من فعاليته كمضاد حيوي كما أنها تقوي من تأثيره ليصبح شبيها بالبنسلين.

ومن المعروف أن الثوم والفليفلة معا يعملان على تخفيض ضغط الدم بسرعة وبشكل آمن. وتستخدم الفليفلة لتخفيف الآلام ولعلاج المشكلات التنفسية وأمراض النساء وعلاج أمراض القلب إضافة إلى علاج الغدة الدرقية. وعند إضافة القليل من الخل إلى الفليفلة فإنها تصبح مفيدة لتنظيف قصبات الإنسان.






يساعد على إذابة الجلطات الدموية ويفسح المجال لمخارج الهواء ويذيب المخاط الموجود في الرئة ويساعد على منع متاعب القصبة الهوائية والتي تظهر في صورة نزلات شعبية وهو يقلل من الألم كما أنه يهدئ من حدة الصداع عند استنشاقه كما أنه عندما يحقن به الجسم يخفف من ألم المفاصل.

الشطة كمنشط للهضم :





وجد ان


الفلفل الاحمر الحار ( الشطة ) ينشط خروج اللعاب والعصارات المعدية الهاضمة. ومن المعروف ان اللعاب يحتوي على انزيمات تساعد في هضم الكربوهيدرات بينما تحتوي الافرازات المعدية على حامض وانزيمات اخرى تقوم بهضم مختلف عناصرالطعام .


لاتخف من الشطة :



وفي احدى الدراسات اخوتي التي نشرت نتائجها في صحيفة الجمعية الطبية الامريكية قام الباحثون بواسطة كاميرات


فيديو (http://www.libyanyouths.com/vb/ext.php?ref=http://www.zwjte.com/s/category/video-youtube) خاصة بتصوير بطانة المعدة بعد تناول وجبة طعام غير حريفة وبعد تناول وجبة الطعام غنية بالشطة فاتضح أن استجابة المعدة للنوعين من المأكولات لم تختلف وصرح الباحثون بأن تناول الافراد الاصحاء لوجبات طعام حريقة مثل مخلوط بالشطة لايؤدي الى أية أضرار ببطانة المعدة أو أمعاء وبناء على ذلك فإن إضافة الشطة للطعام أو أكل الفلفل الاحمر الحار لاضرر منه على سلامة المعدة أو الامعاء على عكس مايعتقد البعض ولكن يجب ملاحظة أن الشطة تكون مؤثرة أو منشطة حتي لو أخذت بكمية قليلة أى أنه لاداعى للإفراط في تناولها .


للذين يشكون من الآلام المزمنة :



كان من الشائع في العصور القديمة تسكين الألم ( كألم المفاصل ) بدعك الجلد فوق موضع الألم بالشطة ... وهذا مانسميه طبيا بالدواء الملهب (counterirritant).... بمعنى أن فكرة هذا العلاج تعتمد على إحداث ألم سطحى خفيف يلهى المريض عما يحس به من ألم شديد عميق ...وهذه هى نفس فكرة المراهم المسكنة للآلام الروماتيزمية لكن الدراسات الحديثة أثبتت أن للشطة مفعولا حقيقيا مخففا للآلام وخاصة لبعض انواع الآلام المزمنة .. وهذا يرجع الى وجود مادة كيميائية تم استخلاصها من ثمار الفلفل الاحمر وهى مادة : كابسيسين ( capsaicin) .....



فقد اتضح أن هذه المادة كيميائية بالأعصاب الطرفية .. والتى تقوم بلإرسال الإشارات للإحساس بالألم الى المخ. وبناء على ذلك ينصح الذين يشكون من الآلام المزمنة كآلام المفاصل بدعك الجلد بكمية من الشطة لتسكين الألم . وهذا مع العلم بوجود مراهم جاهزة للاستعمال تعتمد فى مفعولها المسكن لألم على هذه المادة الموجودة بالشطة ... وهده مثل كريم زوستريكس (zostrix) وكريم اكسين (axsain) وهى متوافرة بصيدليات الدول الغربية ...



الشطة لعلاج الأمراض الجلدية (مرض القوباء ):



مرض القوباء مرض فيروسي يصيب الأعصاب السطحية الممتدة بمنطقة الصدر وتظهر الإصابة فى صورة حويصلات بها قاعدة حمراء ويصاحبها حرقان وألم شديد وهذا المرض يزول تلقائيا بعد مضى حوالى ثلاثة أسابيع منذ بدء الاصابة.. ولكنه فى بعض الحالات خاصة ضعاف البدن ولأسباب غير واضحة تماما يستمر الألم بعد زوال الإصابة أى يأخذ شكلا مزمنا.. وهذه الحالة هى مايطلق عليها الاطباء تسمية(post-herpetic neuralgia) .... وقد وجد أن مرهم (zostrix) والذى سبقت الإشارة إليه والذى يعتمد مفعوله على مادة الشطة بعد أفضل علاج لهذا الألم المزمن .



الشطة .... تحل مشكلة قدم مريض السكر :



من أبرز مضاعفات مرض السكر واكثرهاشيوعا مايسمى ( burning foot syndrome) أو ما يمكن أن نصفه باسم : حرقان القدم.. حيث يشكو مريض السكر من ألم بالقدم يتركز حول العركوب ( الرسغ ) ويظهر في صور مختلفة مثل : حرقان أو وخز او شكشكة... ويصفه المريض أحيانا بقوله : كأنى أمشي على حصى . وتعتبر هذه الشكوى الناتجة عن إلتهاب الأعصاب الطرفية من المتاعب التى لايجدى معها عادة العلاج بالعقاقير التقليدية .



وقد وجد من خلال الدراسات أن مادة كابسيسين - المادة الفعالة فى الشطة لها القدرة كذلك على تخفيف هذا الألم أو الحرقان فى عدد كبير من مرضى السكر بعد استمرار العلاج لنحو أربعة أسابيع ولاستخدام الشطة فى علاج هذه الحالة إماأن يلجأ المريض هنا لدهان القدم المؤلمة بأحد المرهمين السابقين ... ويعتبر مرهم (axsain) هو أفضلها لعلاج هذه الحالة... وإما يعتمد مباشرة على الشطة.. ولذلك على النحو التالى : يضاف 4/1 - 2/1 ملعقة صغيرة من الشطة الى فنجان زيت نباتي دافء ( مثل زيت الكافور أو زيت الزيتون) ويدلك الموضع المؤلم بهذا الخليط كما يصلح هذا العلاج لاستعمال الشطة كمسكن للآلام المزمنة بصفة عامة مثل آلام المفاصل الروماتيزمية.



لن أخفى عليكم فقد شككت فى هذه الطريقة ولكن قد قمت في تجربتها على احد أفراد الاسره ولكن الحذر هنا مطلوب والذي اقصده هو عدم وجود أي جرح في قدم المريض الذي سوف تجرى عليه تلك الطريق لأننا كما نعلم قدم مريض السكر اكثر حساسية من قدم اي مريض وعلى الرغم انني اطلعت على بعض الكتب قد تنصح في علاج الجروح النازفة برش كمية من الشطة الا انني أشكك في تلك الطريقة على الرغم من انها قد صدرة من قبل أطباء متخصصين في مجالهم ولكن فيها نوعا من الخطورة على صحةالمريض من رأي الخاص ولذا لم اطرحها هنا



من فوائده أيضا الفلفل الحار انه يخفف من حدة الزكام لأنه حار جدا .



يحتوي على مواد كيميائية منشطة للدماغ ورافعة للمزاج.

nosa_aic
09 - 12 - 2011, 14:49
رائع ....ومرجع ممتاز وقت الاحتياج اليه ............




http://r14.imgfast.net/users/1411/81/10/31/smiles/786614.gif

hafeztamer
09 - 12 - 2011, 14:54
فكرة ممتاذة حفظكم الله

nosa_aic
09 - 12 - 2011, 16:34
فكرة ممتاذة حفظكم الله



http://www.dohaup.com/thumbnails/65_700x2147483647.jpg

nosa_aic
09 - 12 - 2011, 16:42
الفرق بين ارتفاع وانخفاض السكر




http://img254.imageshack.us/img254/7296/c00280cd7c45yn7.gif



يُنظم مستوى الجلوكوز بالدم بوجود توازن بين عمل هرمون الانسولين (Insulin) من جهة وعمل الهرمونات المضادة للإنسولين (Anti-Insulin) من جهة أخرى. وهذه الهرمونات المضادة هي الجلوكاجون(Glucagon) والادرينالين (Adrenaline) والجلوكوز كورتيزول ( Glucocorticoid) وهرمون النمو (Growth Hormone) وأخيرآ الثيروكسين (Thyroxine).
حيث يؤدي عمل هرمون الانسولين الى خفض مستوى السكر في الدم، بينما يؤدي عمل الهرمونات المضادة إلى ارتفاع مستوى السكر في الدم.
ولذلك لا بد أن يكون هناك توزان بين عمل كل منهما حتى يحتفظ الدم بالتركيز الطبيعي للسكر.
عمومآ فإن ارتفاع أو انخفاض مستوى السكر بالدم هي شواهد (اعراض) غير واضحة لحدوث عملية التمثيل الغذائي الغير طبيعي للجلوكوز.

اسباب ارتفاع مستوى السكر في الدم مرضيآ:

مرض البول السكري ( Diabetes Mellitus) ، الفرق في وظيفة أي من الغدد الاتية: الدرقية، الكظرية والنخامية، وأحيانآ يرتفع السكر في بعض امراض الكبد.

اسباب انخفاض مستوى السكر في الدم مرضيآ:

فرط افراز الانسولين ، قصور في عمل الغدة فوق الكلوية والغدة النخامية، وأحيانآ في فشل الكبد.
وينخفض السكر أيضآ مع الاستعمال السيء لادوية خفض نسبة السكر ، وعند حدوث حساسية عن بعض الناس لوجبات معينة.

وينتج من ارتفاع وانخفاض مستوى السكر بالدم ما يسمى بـ "غيبوبة السكري".

غيبوية السكر:

هناك نوعان من غيبوبة السكر:

أ*- غيبوبة ارتفاع السكر( Hyperglycaemic Coma):

وهي حالة يفقد فيها الانسان وعيه نتيجة ارتفاع السكر،
واسبابها هي إهمال علاج السكر خاصة النوع الاول منه.

اما اعراض غيبوبة السكر فتشمل:

1-زياة معدل التنفس.

2-رائحة الاسيتون( الذي تشبه رائحته الكحول) بالفم.

3-النبض يكون سريعآ وضعيفآ جدآ.

4-الجلد يكون جافآ واللسان كذلك.


ومن التحاليل يتبين وجود ارتفاع شديد للسكر بالدم ووجوده أيضآ بالبول ونجد أجسام كيتونية( Ketones Bodies) (عبارة عن مركبات كحولية سامة تنتج عن تخمر السكر) في البول.
وينصح الاطباء مريض السكر تنظيم علاج السكر والالتزام بالحمية في الوجبات الغذائية اليومية لعدم تكرارمثل هذه الغيبوبة بالمستقبل.

ب*- غيبوبة انخفاض السكر ( Hypoglycaemic Coma):

تحدث دائمآ مع الاستعمال السيء للأدوية المخفضة للسكر، مع اهمال بعض الوجبات ، مما يؤدي إلى انخفاض نسبة مستوى السكر بالدم عن 60 مجم لكل 100 ملليتر في الدم، مؤديآ إلى الغيبوبة لأن المخ قد تعود على نسبة عالية من السكر.

أعراضها هي:

1-معدل التنفس طبيعي.

2-رائحة الفم طبيعية.

3-النبض سريع وقوي.

4-الجلد يكون مبتلآ نظرآ للعرق الشديد.

وفي التحاليل يتبين انخفاض مستوى السكر بالدم، وعدم وجوده في البول وتواجد اجسام كيتونية بالبول.
وينصح الاطباء في حدوث مثل هذه الغيبوبة بتناول أي مادة سكرية مثل قوالب السكر ، مع الاستعمال السليم لحقن الانسولين، واقراص علاج مرض السكر، وعدم اهمال الوجات اليومية المنظمة حتى لا تتكرر مثل هذه الغيبوبة والتي تعتبر أخطر من سابقتها لأنها قد تؤثر على خلايا المخ ( إذا إستمرت أكثر من 24 ساعة) التي تعتمد على الجلوكوز كمصدر رئيسي للطاقة.

nosa_aic
09 - 12 - 2011, 16:55
خمس خطوات لتجنب الإصابة بالقلب

http://www.adobe.com/shockwave/download/triggerpages_mmcom/images/loading.gif



http://www.aljazeera.net/mritems/images/2007/9/17/1_720643_1_59.jpg (http://www.libyanyouths.com/vb/t115300.html)


يُعد الضحك أحد العوامل المساعدة على تخفيض خطر الإصابة بأمراض القلب, وفق ما أفادت خبيرة أميركية في عرضها لخمس خطوات لتجنب الإصابة.

وأوضحت الدكتورة هولي أندرسون
أن أولى هذه الخطوات هي معرفة نسب الكولسترول والتريغليسريد وضغط الدم من الطبيب.

وتابعت أن ثانية الخطوات هي ممارسة الرياضة، مضيفة أن المشي عشرين إلى ثلاثين دقيقة أسبوعياً عدة أيام يخفض خطر الإصابة بمثل هذه الأمراض.
وشددت على أن النشاط الجسدي يخفض ضغط الدم ويحسن معدل الكولسترول، ويخفف الإجهاد ويحسن نوعية النوم والقدرات الإدراكية.

وقالت أندرسون إن الضحك مهم جداً لصحة القلب، فـ15 دقيقة فقط من الضحك تعادل ثلاثين دقيقة رياضة فيما يتعلق بصحة القلب والأوعية الدموية.

وأشارت إلى ضرورة المحافظة على حجم محيط الخصر أكثر من الوزن بشكل عام، لأن هذه المنطقة من الجسم هي المقياس الأهم المرتبط بارتفاع نسب السكري والكولسترول وضغط الدم.

ودعت الباحثة إلى النوم بشكل كاف، لأن نقص النوم يعزز ارتفاع ضغط الدم مما يسبب الإجهاد ويرفع الشهية للأكل ويبطئ حركة الأيض.

nosa_aic
10 - 12 - 2011, 08:05
الشوكولاته تمنع الاكتئاب
http://i132.photobucket.com/albums/q17/lola-4/flowers/ro72.gif





http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs1378.snc4/165035_10150109985516874_235730276873_7424711_4221 710_n.jpg (http://www.libyanyouths.com/vb/ext.php?ref=http://www.facebook.com/photo.php?pid=7430322&id=235730276873)


كشفت دراسات علمية متعددة على مدار السنين عن أن تناول مربعات قليلة ويومية من الشوكولاته من شأنها أن تحد من الا كتئاب وتقاوم التعب والإجهاد وتعمل عمل الأسبرين على ما أفادت صحيفة لوجورنال دو سنتر الفرنسية.وعزت الدراسات المتعددة هذا الأثر الإيجابي للشوكولاتة لاحتوائها على كميات من الماغنيسيوم والسكر الذي يحسن الحالة المزاجية ويمد الجسم بالطاقة.وأظهرت الدراسات أنها تمنع الإصابة بالقرحة, فقد اكتشف المختصون أن مضادات الأكسدة الموجودة فيها تعادل تلك الموجودة في الأدوية المضادة للقرحة, فضلا عن فوائدها للقلب والأوعية بعد أن أثبتت نتائج الأبحاث أن بودرة الكاكاو المستخلصة تمنع تأكسد الكوليسترول السيء والتسبب في الإصابة بتصلب الشرايين وتسبب ارتخاء الأوعية الدموية.وأوضحت الدراسات أن بعض أنواع الشوكولاته أكثر فائدة من الأنواع الأخرى, فبودرة الكاكاو التي تحتوى على ضعف كمية مضادات الأكسدة الموجودة وتشكل المادة الغامقة, هي أفضل الأنواع على الإطلاق, يليها الشوكولاته السادة, ثم الشوكولاته بالحليب في المرتبة الثالثة.وتعتبر الشوكولاته من المواد المغذية، وقيمتها الغذائية عالية، فهي تتكون من 55 بالمائة من المواد الكربوهيدراتية و30 بالمائة من المواد الدهنية و6 بالمائة من المواد البروتينية, وهى المواد الثلاث الأساسية التي يتألف منها الغذاء الضروري للجسم, إضافة إلى احتوائها على الفوسفور والكالسيوم والمغنيسيوم والحديد وفيتامينات ( أيه ) ,(بي) و ( سي).والشوكولاته غنية جدا بالوحدات الحرارية، فكل مئة غرام منها يعطى 500 وحدة حرارية، لذا تعتبر مثالية للعمال والرياضيين ورجال الفكر أيضا حيث تمنحهم نشاطا وحيوية.


دمتم بود بعيداً عن الاكتئاب

kot
10 - 12 - 2011, 08:06
http://www.hawahome.com/vb/nupload/70402_1217331523.gif (http://www.*******.com/)

nosa_aic
10 - 12 - 2011, 08:58
أخطار النوم عندما يزيد عن 9 ساعات

http://img185.imageshack.us/img185/8906/tajmeel1yh6ps2.gif (http://img185.imageshack.us/img185/8906/tajmeel1yh6ps2.gif)

قد يستغرب البعض عند قراءة عنوان هذا المقال,

فالنوم له عند الانسان اهمية خاصة لا يمكنه الاستغناء عنه ابدا.

ويرى البعض انه كلما نام اكثر كلما شعر بالراحة اكثر فهذا فهم خاطئ

يتبادر الى اذهان كثير من الناس فقد اثبتت الدراسات أن النوم الزائد

عن المعدل المحدد له يصيب صاحبه بأمراض خطيرة جدا خاصة

امراض القلب والدماغ التي قد تؤدي الى حصول الجلطات والنوبات

مما يؤدي بعد ذلك الى الوفاة لا سمح الله.

فالمعدل السليم للنوم اليومي هو ما بين 7ـ 9 فهي تعطي الانسان

نشاطا يوميا مكثفا وهذا ما يخدم الانسان في حياته العملية

فكلما زاد على المعدل اليومي للنوم كلما زاد كسلا وتقاعسا

ويرى أنه يحتاج الى النوم أكثر واكثر.

وقد اثبتت دراسات أخرى ان النوم الزائد قد يسبب اضطرابات

في الجهاز التنفسي ويضعف القدرة على الحصول على كميات كافية

من الاكسجين فتجده يستيقظ من النوم فيشعر بالتعب والارق.

وقد يتوقع البعض أن الراحة هي في مدة النوم وهذا فهم غير سليم

فالراحة لا تأتي من مدة النوم الطويلة أو القصيرة بل تأتي من عمق هذا النوم

فمتى ابتعد الانسان عن الاقراص المهدئة والمنومة وابتعد عن المنبهات

وحصل له جو معتدل ليس بالبارد ولا الحار فبذلك تحصل له الراحة

المطلوبة المستفادة من النوم ومن المنومات الخاطئة التي تحصل كثيرا

خاصة في مجتمعنا هي النومات التي تأتي بعد الاكل مباشرة

فمثل هذه النومات تتسبب في حصول السمنة وترهل الجسم

وهذا أمر يجب معرفته على كل افراد المجتمع فالبعض

لا يعطي لهذه الاسباب القدر الكافي للابتعاد عنها فيقع فيها من غير انتباه.

اما النوم الصحي فيجب أن يتحقق فيه ثلاثة شروط:

أولها الراحة الجسدية

وثانيها الراحة العاطفية

والاخيرة هي الراحة الفكرية

فمتى تمت هذه الشروط الثلاثة فانها تجذب للانسان النوم الصحي

(الملائم لجسمه فان هناك في جسم الانسان هرمون (السيروتونين

الذي يتولى مهمة تنويم جسم الانسان والعجيب في الهرمون

انه يزداد افرازه في الظلام فهو يعتمد على درجة الاضاءة المحيطة

بجسم الانسان قال تعالى( وجعلنا نومكم سباتا وجعلنا الليل لباسا

وجعلنا النهار معاشا).

فالنوم الطبيعي لا يكون الا في الليل

أما عن نوم القيلولة فمتى شعرت بالنوم في وقت الظهيرة

فنم فهي فترة للراحة تعيد للجسم نشاطه من جديد

ولا يلزم كونها ساعات بل يكفي فيها الاسترخاء لفترة قصيرة

قد تتجاوز النصف ساعة

اما الارق وعلاجه فيمكن التغلب عليه بتجنب النوم لفترات طويلة اثناء النهار

والابتعاد عن المنبهات قبل النوم بثلاث ساعات على الاقل

وتهيئة الجو المناسب للنوم فبذلك يمكنك التغلب على الارق

nosa_aic
11 - 12 - 2011, 08:37
كل شئ عن الكوليستيرول

ما هو الكوليستيرول؟؟

الكوليستيرول عبارة عن مادة شمعية بيضاء, وأجسامنا تحتاجه لبناء الخلايا ، فهو موجود في غشاء الخلايا في المخ ، الأعصاب ، العضلات ، الجلد ، الكبد ، الأمعاء والقلب . ويستخدم لإنتاج عدة هرمونات, و لإنتاج أحماض الصفراء التي تساعد على هضم الدهون. و يحتاج الجسم إلى كميات قليلة من الكوليستيرول لتغطية هذه الاستخدامات. و زيادة نسبة الكوليستيرول فى الدم تؤدى الى امراض تصلب الشرايين.

أين يتم تصنيع الكوليستيرول؟؟

يتم تصنيع الكوليستيرول فى الكبد ثم ينقل في الدم الى جميع اجزاء الجسم على هيئة مركبات عضوية تدعى البروتينات الدهنية و ذلك لأنة مركب دهنى و لا يمكنة الاندماج فى تيار الدم لذا يتم دمجة فى الكبد مع البروتين لإنتاج هذة البروتينات الدهنية, هذا ويوجد أنواع معينة من البروتينات الدهنية التي تحتوي على الكوليسترول في الدم.

ما هى صور المركبات الدهنية بالدم ؟؟ و هل كلها ضارة ؟؟

يوجد ثلاثة انواع رئيسية من الدهون فى الدم:

1-البروتينات الدهنية منخفضة الكثافة (LDL-cholesterol )

· وهي الكوليسترول الرديء أو الضار و هو يمثل الجزء الأكبر من الكوليستيرول في الدم و يكون محمولا بواسطة البروتينات الدهنية منخفضة الكثافة .

· والجدير بالذكر أن هذا النوع من البروتينات الدهنيه لا يمثل ضررا إلا بعد تعرضه للأكسده الذاتيه والتى تغيير من طبيعته مما يجعل الجهاز المناعى – ممثلا فى الخلايا الملتهمه – بالتهام هذه البروتينات الدهنيه بعد أكسدتها وبذلك تتحول الخلايا الملتهمه النوع آخر من الخلايا وهى الخلايا الرغويه والتى تترسب على جدر الأوعيه الدمويه مما يبدأ عمليه تصلب الشرايين. هذه النظريه تعطى أهميه قصوى لمضادات الأكسده لمنع حدوث تصلب الشرايين وتدهورها.

· تعتبر البروتينات الدهنية منخفضة الكثافة المصدر الأساسي لترسب الكوليسترول في الشرايين وضيقها وانسدادها . وبهذا ، فكلما ارتفع تركيزه في الدم كلما ارتفعت مخاطر الإصابة بأمراض تصلب الشرايين و امراض شرايين القلب التاجية.

2-البروتينات الدهنية عالية الكثافة (HDL-cholesterol )

وهي تمثل الكوليستيرول الجيد فهى تنقل الكوليستيرول من أجزاء الجسم المختلفة إلى الكبد ليتم التخلص منه خارج الجسم وتمنع ترسبه في جدران الشرايين. وكلما ارتفع تركيز كوليستيرول البروتينات الدهنية عالية الكثافة كلما كان ذلك أفضل.

3-الدهون الثلاثيه (Triglycerides):

و هى نوع آخر من الدهون المحمولة في تيار الدم و تتواجد بنسب قليله (هذا النوع يوجد اصلا فى الانسجه الدهنية بإجسامنا) ، و البروتينات الدهنية الغنية بالدهنيات الثلاثية تحتوي أيضا على الكوليسترول ، لذا فارتفاع تركيز الدهنيات الثلاثية ربما يكون علامة لوجود مشكلة في البروتينات الدهنية والتي تسبب تصلب الشرايين.
إذا ليست كل أنواع الكوليستيرول ضارة . ويستطيع الطبيب معرفة المستوى الكلي للكوليستيرول بواسطة اختبار دم بسيط يحدد نسبة الانواع المختلفة من الدهون فى الدم

ما هى اسباب ارتفاع نسبة الكوليستيرول فى الدم؟

مستوى الكوليسترول في الدم يتأثر بما تأكله و يتأثر أيضا بمقدرة جسمك على سرعة إنتاج الكوليستيرول وسرعة التخلص منه (http://www.libyanyouths.com/vb/t116546.html)(و لهذا السبب قد يصاب بعض الاشخاص بإرتفاع فى نسبة الكوليستيرول فى الدم مع انهم لا يكثرون من تناول الدهون فى طعامهم), و من الضرورى ذكر أن الجسم يقوم بإنتاج ما يحتاجه من الكوليستيرول اللازم للقيام بوظائفة الحيويه وبالتالي ليس ضروريا تناول كوليستيرول إضافي عن طريق الغذاء.
العوامل المساعده على والممهده لارتفاع نسب الدهون بالدم:

1- العوامل الوراثية :
تلعب الجينات دور رئيسى و مؤثر فى سرعة إنتاج جسمك للكوليستيرول الضار وسرعة التخلص منه, و ارتفاع الكوليستيرول الوراثي يؤدي عادة إلى الإصابة بتصلب الشرايين وأمراض القلب مبكرا.

2 - العادات الغذائية:
تناول الاطعمة المحتوية على الدهون المشبعه و الكوليستيرول تسبب ارتفاع مستوى الكوليستيرول الضار فى الدم مثل السمن الحيواني والزبدة والكريمة والقشدة و اللحوم الحمراء و الحمام و البط و جلد الطيور و كذلك صفار البيض والجمبري والاستاكوزة والمخ والكبد والكلاوي و منتجات الالبان كاملة الدسم بأنواعها و كذلك الحلويات العربية و الأفرنجية والشوكولاته والآيس كريم. و جدير بالذكر أن ولهذا إنقاص كمية الدهون المشبعة والكوليستيرول التي يتم تناولها يعتبر خطوة مهمة جدا لإنقاص مستوى الكوليسترول الضار في الدم.

3 - الوزن:
الزيادة في الوزن تساهم في رفع مستوى الكوليسترول الضار, وإنقاص الوزن ربما يساعد في خفض مستوى الكوليسترول الضار كما يساعد أيضا في خفض الدهون الثلاثية ورفع مستوى البروتينات الدهنية عالية الكثافة (الكوليسترول الجيد).

4 - معدل النشاط الحركي:
النشاط الحركي يخفض من مستوى الكوليسترول الضار ويرفع الكوليسترول الجيد.

5 - العمر و الجنس:
يكون مستوى الكوليستيرول الكلي قبل سن 45 عند النساء أقل من مستواه عند الرجال في نفس الفئة العمرية . وبتقدم العمر عند الرجال والنساء يرتفع مستوى الكوليستيرول لديهم إلى أن يصلوا إلى عمر 60 أو 65. بالنسبة للنساء فإن الوصول إلى سن انقطاع الطمث يؤدي إلى ارتفاع مستوى الكوليسترول الضار وخفض مستوى الكوليسترول الجيد, وبعد سن الخمسين يكون مستوى الكوليسترول الكلي أعلى في النساء منه (http://www.libyanyouths.com/vb/t116546.html)في الرجال من نفس العمر.

6 - تناول المشروبات الكحوليه :
تناول الخمور يسبب ضرر للكبد وعضلة القلب ، ويؤدي إلى الإصابة بارتفاع ضغط الدم ، ورفع مستوى الدهنيات الثلاثية مما يزيد من مخاطر الاصابة بامراض شرايين القلب.
7 - التدخين
8 - الإصابة بمرض السكر
و يجب الاشارة هنا الى ان توافر اكثر من عامل من عوامل الخطر السابق ذكرها يزيد من احتمال حدوث مضاعفات لزيادة نسبة الكوليستيرول فى الدم و من اهم هذة المضاعفات مرض تصلب الشرايين و الذى يؤثر بصوره مباشره على كفاءة وصول الدم لجميع اجهزة الجسم

ما هي أعراض ارتفاع الكوليستيرول؟

لا توجد أعراض محددة يعانى منها مريض ارتفاع نسبة الكوليستيرول بالدم و قد يستمر تراكم الكوليستيرول ببطء فى الشرايين وخلال سنوات دون حدوث اعراض تنبه المريض و تراكم البروتينات الدهنية منخفضة الكثافة على السطح الداخلي للشرايين ينتج عنه زيادة سمك الشريان فى مكان معين
( نتوء يبرز الى داخل التجويف الشريانى ) يؤدى الى فقدان مرونة الشريان وتصلبه ، مما يؤدي إلى قصور في سريان تيار الدم وبالتالي يسبب أمراض متعدده وقد لا يتم اكتشاف هذا لعدة سنوات أو يتم اكتشافه بعد الإصابة بأحد مضاعفاته.

ما هى اهم مضاعفات ارتفاع نسبة الكوليستيرول بالدم؟؟

*إن ارتفاع نسبة الكوليستيرول يتسبب مباشرة في</SPAN></B>تصلب الشرايين التى تؤثر على كافة اجهزة الجسم فتصلب الشرايين يؤدى الى ارتفاع ضغط الدم , وعلى حسب المنطقه المصابه من الجسم يكون التأثير واضحا, كمثال تصلب الشرايين التاجيه فى القلب تسبب الاصابه بالذبحه الصدريه و جلطة القلب و تصلب شراييين المخ تؤدى الى الاصابه بجلطات المخ.
وفى الحالات المتقدمة من تصلب الشرايين قد يتعرض الغشاء المبطن للشرايين للتمزق مما قد يؤدى الى انفصال اجزاء من الترسبات الدهنيه بالجدار الشريانى و سريانها مع تيار الدم مما قد يؤدى الى انسداد كامل فى شرايين اخرى (فى العين أو المخ).

مستوى الكوليسترول في الدم

مستوى الكوليسترول الكلي في الدم عبارة عن مستوى جميع أنواع الكوليسترول في الدم والجدول الآتى يوضح القيم التي يجب أن تهتم بها:
عامل الخطر مرتفعالخط الفاصلالمستوى المطلوب 240 ملجم / ديسيلتر أو أكثر200 - 239 ملجم / ديسيلترأقل من 200 ملجم / ديسيلترمستوى الكوليسترول الكلي في الدم160 ملجم / ديسيلتر أو أكثر130 - 159 ملجم / ديسيلترأقل من 130 ملجم / ديسيلترمستوى الكوليسترول الضارأقل من 35 ملجم / ديسيلتر35 - 59 ملجم / ديسيلتر60 ملجم / ديسيلتر أو أكثرمستوى الكوليسترول الجيد

*ديسيلتر = 100 ميليلتر
*هذه القيم تنطبق على البالغين من سن 20 عاما

nosa_aic
11 - 12 - 2011, 16:21
بسم الله الرحمن الرحيم


حمض الفوليك و اهميته لاجسامنا



http://www.3dchem.com/imagesofmolecules/vitaminBc.gif (http://www.libyanyouths.com/vb/t118235.html)


الجميع يعرف فائدة الفيتامينات والمعادن من أجل الصحة العامة للجسم، وتأثير نقص المتناول منها في الغذاء اليومي للانسان، وان كان نقص الكالسيوم وفيتامين دال مهم لنمو العظام، فإن حمض الفوليك لم يأخذ حقه من التنبيه لأهميته.

ما هو حمض فوليك؟

حمض الفوليك Folic acid، ويعرف كذلك بأسم فيتامين بي 9، وهو أحد مكونات فيتامين بي المركب الذائبة في الماء، ويوجد في الكثير من الأغذية وخاصة الخضروات ويسمى في هذه الحالة - الفوليت.

فائدة حمض الفوليك؟

حمض الفوليك مهم في إنتاج الأحماض النووية (آر إن أي RNA ودي إن أي DNA)، لذلك فهو ضروري لانقسام وتكاثر الجنين عند تكون الأعضاء في الأيام الأولى للحمل ومن أهمها تكون خلايا الجهاز العصبي المركزي، كما يساعد على تجديد خلايا الجهاز الهضمي، الجلد، الشعر، وأنسجة أخرى في الجسم، لذلك فهو مهم وضروري في فترات النمو السريع مثل الحمل، المراهقة، والطفولة.

حمض الفوليك والعيوب الخلقية:

لقد أثبتت الدراسات والبحوث العلمية علاقة نقص حمض الفوليك في حدوث الإصابة بالتشوهات الخلقية للجنين وخاصة الصلب المشقوق وعيوب الأنبوبة العصبية، كما العيوب الخلقية الأخرى مثل الشفة الأرنبية وشق الحنك، تشوهات القلب والكلى، حدوث متلازمة داون.

المصادر الطبيعية لحمض الفوليك:

يوجد حمض الفوليك في الكثير من الأغذية بكميات متفاوتة، ومنها:

الخضروات: السبانخ، واللفت الخضراء، الخس، والفاصوليا والبازلاء المجففة، الكرنب والقرنبيط، الفلفل الرومي.

الفواكه: البرتقال، الفراولة.

العدس والفول والبندق.

الحليب والألبان ومشتقاتها.

الكبدة (كبدة الغنم والدجاج).

منتجات الحبوب المدعمة بحمض الفوليك مثل الخبز والحلويات وغيرها

حبوب الأفطار المدعمة – كورن فلكس.


http://www.sabayagazine.com/wp-content/uploads/2010/12/Folic-acid.jpg (http://www.libyanyouths.com/vb/t118235.html)


http://www.aawsat.com/2007/06/21/images/health.424582.jpg (http://www.libyanyouths.com/vb/t118235.html)

هل هناك أعراض مرضية لمن لديهم نقص في حمض الفوليك؟

النقص البسيط في حمض الفوليك قد لا تظهر على الإنسان أعراض مرضية واضحة، ما عدا تأثيرها على حيوية وتجدد الخلايا الجسمية، ولكن تكمن المشكلة في العيوب الخلقية لدى الحوامل حيث تحدث حالات الصلب المشقوق وعيوب الأنبوبة العصبية.

أما حالات النقص الشديدة وهي حالات نادرة، فتكون بسبب مشاكل في الجهاز الهضمي التي تؤثر على امتصاص حمض الفوليك، وعادة ماتكون مصحوبة بنقص فيتامين بي 12، وهو ما يؤدي لنوع خاص من فقر الدم.

هل نحتاج حمض الفوليك بشكل يومي ؟

حمض الفوليك فيتامين ذائب في الماء، لذلك لا يتم تخزينه في الجسم، ومن ثم فإننا نحتاج لتناوله بشكل يومي، ولأنه فيتامين ذائب في الماء، فالزائد منه عادة يخرج مع البول، ومن ثم فهو لا يؤدي إلى التسمم أو أي مشاكل صحية. وفي حالات نادرة يمكن ان يخفي أعراض نقص فيتامين ب12

nosa_aic
14 - 12 - 2011, 23:31
السلام عليكم ورحمــة الله وبركـــآته

فوائد و اضرار و معلومات عن التبرع بالدم للكبار و للاطفال و للصغار .,

إن التبرع بالدم ضرورة إنسانية يحتاج اليها كثير من الناس في أي وقت من الاوقات ، وقد أفتى اغلب العلماء بجوازها ..

ماهي كمية الدم المتبرع بها سنوياً ..!

بينت بعض الدراسات في الدول الغربية ان هناك حوالي ثمانية ملايين متبرع بالدم سنوياً . وفي الولايات المتحدة الامريكية ، تم التبرع بحوالي 15 مليون وحدة من الدم سنة 2001م ..

يمكن تعريف وحدة الدم المتبرع بها بخمسائة ميلليتر من الدم الكامل ..

يمكن فصل هذه الوحدة من الدم الى مكونات عديدة منها :

• خلايا دم حمراء .
• مصل الدم .
• صفائح دموية .
• وغير ذلك من مكونات الدم .

تُنقل كل واحدة منها الى من يحتاجها من المرضى او المصابين ..

من هم الأشخاص الذين يحتاجون الى استقبال الدم ..!

إن الحاجة للتبرع بالدم [/URL]كبيرة جداً في اغلب الاحوال وعاجلة جداً في احوال كثيرة ..
بينت إحدى الدراسات في الولايات المتحدة الامريكية انه في كل عام تقريباً هناك حاجة الى حوالي 38000 وحدة من خلايا الدم الحمراء ..

الاشخاص المحتاجون لتلقي او استقبال الدم هم :

• ضحايا الحوادث المرورية والحرائق ..
• المرضى الذين يخضعون لعمليات جراحية كبرى كعمليات القلب المفتوح ، ونقل الاعضاء ، وغيرها من العمليات المصحوبة بنزف شديد ..
• الاشخاص الذين يعانون من سرطان الدم او غيره من الاورام ..
• الاشخاص المصابون بفقر الدم المنجلي او الثلاسيميا ..

من هم الاشخاص الذين يمكنهم التبرع بالدم ..!

للتبرع بالدم بعض الشروط لا بد من توافرها في المتبرع ، كأن يكون ذا صحة جيدة ، قد تجاوز السابعة عشر من عمره ، ولا يقل وزنه عن خمسين كيلوغرام ، وان يخضع لفحص طبي يبين خلوه من بعض الامراض ..

بينت الإحصائيات ان قليلاً جداً من الاشخاص الذين يمكنهم التبرع (http://www.libyanyouths.com/vb/t77458.html)بالدم يتبرعون به فعلاً ، وان اكثر المتبرعين هم من الرجال المثقفين ذوي الدخل الجيد والذين تتراوح اعمارهم ما بين الثلاثين الى الخمسين ..

يعوّض الجسم السوائل المتبَرّع بها خلال اربع وعشرين ساعة . اما بالنسبة لخلايا الدم فتأخذ وقتاً اطول ليتم تعويضها ، فالخلايا الحمراء مثلاً لا تُعوّض تماماً إلا بعد مرور ثمانية اسابيع على عملية التبرع،
ولذلك لا يُنصح بإعادة التبرع بالدم إلا بعد مرور شهرين من التبرع الاول ..

الاشخاص الذين لا يمكنهم التبرع بالدم:

هناك بعض الاشخاص لا يمكنهم التبرع بالدم (http://www.libyanyouths.com/vb/t77458.html)إما بشكل مؤقت او بصفة دائمة ، وذلك كما يلي :

أولاً : الموانع المؤقتة للتبرع بالدم :

1. الاشخاص الذين سبقت لهم الإصابة بذبحة صدرية خلال سنة من التبرع بالدم.
2. الذين أصيبوا بمرض الملاريا خلال السنوات الثلاث الماضية .
3. الاشخاص الذين زاروا منطقة موبوءة بالملاريا خلال السنة الماضية .
4. من تم نقل دم إليه او أخذ أحد مكونات الدم خلال السنة الماضية .
5. من أجريت له عملية وشم خلال السنة الماضية .
6. من تعرض لعملية جراحية في القلب خلال السنة الماضية .
7. من تعرض لمصاب بالتهاب الكبد خلال السنة الماضية .
8. الشخص المصاب بوعكة صحية او ارتفاع في درجة الحرارة يومالتبرع.
9. من تناول مضاداً حيوياً قبل يوم الى ثلاثة ايام من التبرع (http://www.libyanyouths.com/vb/t77458.html).
10. السيدات الحوامل او اللاتي تعرضن لإجهاض خلال الاسابيع الستة الماضية .

ثانياً : الموانع الدائمة للتبرع بالدم:

الاشخاص الذين سبق لهم استخدام المخدرات عن طريق الوريد .

الاشخاص الذين سبق لهم استقبال حقن مركزة لعوامل تخثرالدم .

الذين وُجد أثناء إجراء الاختبارات المعملية ان لديهم فحصاً إيجابياً لتحليل التهاب الكبد من النوعين ( ب و ج ) وتحليل ( h i v ) اي الايدز .

أين يمكن ان تتم عملية التبرع بالدم ..!

يوجد مراكز متعددة للتبرع بالدم ، في المستشفيات الكبرى ، في المختبرات ، إضافة الى حملات التبرع بالدم العديدة التي تقام في الجامعات والدوائر الحكومية والوزارات ..

فصائل الدم :

يمكن تقسيم الدم الى فصائل ثمانية حسب الاحرف ( a و b ) وحسب وجود عامل ريسوس او عدمه :
1. A+
2. A-
3. B+
4. B-
5. O+
6. O-
7. Ab+
8. Ab-

يمكن في الحالات الطارئة لأي مصاب ان يستقبل خلايا دم حمراء من فصيلة (o ) ، وبالنسبة للأشخاص من ذوي فصيلة الدم ( ab ) ، فهؤلاء يمكنهم استقبال الدم من اي فصيلة اخرى ، وبالتالي فإن الاشخاص من فصيلة دم ( o ) يسمون معطون عامون ، والاشخاص من فصيلة دم ( ab ) يسمون مستقبلون عامّون ..

التحاليل المخبرية التي تجرى على الدم المتبرع به :

- فصيلة الدم ونوعه بالنسبة لعامل ريسوس .
- البحث عن وجود اجسام مضادة التي يمكن ان تسبب مشكلة للشخص المتلقي .
- تحاليل لالتهاب الكبد من نوعيه ( ب و ج ) .
- تحاليل لمرض نقص المناعة المكتسب ( الإيدز ) .
- تحاليل لبعض الامراض التناسلية التي تنتقل عن طريق العلاقات الجنسية كالزهري .
- بالإضافة الى بعض التحاليل الاخرى .

تخزين الدم بعد التبرع (http://www.libyanyouths.com/vb/t77458.html):

يتم فصل كل وحدة من الدم بعد التبرع الى مكونات عديدة تحفظ مستقلة عن المكونات الاخرى ، وذلك كالتالي :

- خلايا الدم الحمراء : ويمكن ان تُحفظ مبردة لمدة لا تزيد على ستة اسابيع ، او تجمد لمدة تصل الى عشر سنوات . تحمل خلايا الدم الحمراء الاكسجين وتستعمل لعلاج فقر الدم الحاد .
- الصفائح الدموية : وهي ذات اهمية كبرى في التحكم بالنزيف الحاد وتستعمل لعلاج مرضى سرطان الدم وغيره من الاورام . تُحفظ الصفائح الدموية في درجة حرارة الغرفة ويمكن ان تبقى صالحة لمدة خمسة ايام .
- مصل الدم : والذي يحفظ مجمداً لمدة سنة تقريباً ، يستعمل مصل الدم لعلاج النزف الحاصل بسبب نقص بعض عوامل .
- خلايا الدم البيضاء : وتستعمل احياناً لعلاج بعض الالتهابات على الرغم من ان فعاليتها ليست أكيدة ، ولا بد من استخدامها في خلال 24ساعة من التبرع (http://www.libyanyouths.com/vb/t77458.html).
- بعض مكونات الدم كالألبومين والأميونوجلوبيولين التي تستعمل في علاج بعض الامراض .

عملية التبرع بالدم :

- يُطلب من المتبرع الإجابة على بعض الأسئلة المتعلقة بتاريخه الطبي .
- يخضع المتبرع لفحص سريري شامل ، يتضمن قياس العلامات الحيوية كالنبض والحرارة وضغط الدم .
- تُجرى بعض التحاليل المخبرية الضرورية كمستوى الخضاب ( الهيموجلوبين ) ، وبعض التحاليل للتأكد من سلامة الدم .
- يشعر المتبرع ببعض الالم أثناء إدخال الإبرة ، مماثل لألم الوخز والحقن .
- يستمر التبرع حوالي 10-15 دقيقة يكون المتبرع مستلقياً فيها على سرير مريح .
- يُنصح المتبرع بالاستمرار بالاسترخاء لمدة دقائق بعد انتهاء التبرع، وبعدها يتناول كوباً من العصير وبعض البسكويت .
- من الطبيعي الشعور بالتوتر والقلق قبل التبرع وخاصة للمتبرع للمرة الاولى ، ويمكن التخلص من هذه المشاعر بالسؤال والاستفسار عن التبرع من الطبيب المسؤول او غيره من الفريق الطبي .
- يُنصح بالإكثار من شرب السوائل خلال الساعات الاربع والعشرين بعد التبرع.
- لا بأس من التبرع بالدم (http://www.libyanyouths.com/vb/t77458.html)أثناء الدورة الشهرية .
- يُنصح بعدم إعادة التبرع [URL="http://www.libyanyouths.com/vb/t77458.html"]قبل مضي شهرين من التبرع الاول .
دمتم بصحه وعآفيه .,

nosa_aic
15 - 12 - 2011, 00:03
قرحة المعدة و الاثنى عشر اسبابها و طرق علاجها

-- القرحة :-


http://al-msjd-alaqsa.com/Subjects/4-2d.jpg (http://www.libyanyouths.com/vb/t64355.html)


المصطلح


Peptic ulcer, Gastric ulcer, Duodenal ulcer




هو تقرح في الطبقة المبطنة للمعدة وتسمى قرحة (http://www.libyanyouths.com/vb/t64355.html)المعدة أو تقرح في الطبقة المبطنة للأثنى عشر [/URL]وتسمى قرحة (http://www.libyanyouths.com/vb/t64355.html)الأثنى عشر. علما بأن الأثني عشر (http://www.libyanyouths.com/vb/t64355.html)هو أول جزء في الأمعاء الدقيقة
غالبا ما يكون التقرح في الطبقة الأولى لجدار المعدة أو الأثنى عشر (http://www.libyanyouths.com/vb/t64355.html)وتعمق التقرح إلى أبعد من ذالك قد يؤدي إلى حوث ثقب في الجدار (Perforation) وهي حالة طارئة في الطب تستدعي التدخل الجراحي ..


ومعظم أمراض المعدة والأمعاء يعود السبب فيها الى عطب في أعضاء الجهاز الهضمي وتحدث قرحة المعدة في الرجال ثلاثة أمثال ما تحدث في النساء ، والناس فوق سن الأربعين أكثر تعرضا لقرحةالمعدة (http://www.libyanyouths.com/vb/t64355.html)والاثنى عشر وتسبب التهابات بالأنسجة ..


اسبابها :-



هناك ألية لحماية جدار المعدة والأمعاء من الأحماض المفرزة ولخلل ما في هذه الآلية يحدث إلتهاب المعدة
- أشهر مسببات هذا الخلل هو وجود بكتيريا الهيليكوباكتر بايلوراي (Helicobacter pylori)
ومن الأسباب الأخرى التي تؤدي إلى القرحة .

- الوراثة .

- زيادة افراز العصارة المعدية .

- التعرض للضغوط النفسية والعصبية والاضطرابات النفسية .

- سوء العادات الغذائية .

- الشراهة في الأكل وعدم التقيد بمواعيد وجبات الطعام .

- الافراط في تعاطي المشروبات الكحولية والخمور والموستاردة .

- القلق النفسي أو الحزن المستمر أو الندم الدائم .

- نتيجة زيادة حموضة أو ضعف الجدار الداخلي للمعدة .

- الاجهاد العصبي والافراط في التدخين .

- الافراط في تناول المواد التي تهيج جدار المعدة (http://www.libyanyouths.com/vb/t64355.html)وخاصة الأغشية المبطنة له ( المادة المخاطية التي تحمي جدارالمعدة)

ويأتي على رأس هذه المواد :-

* الأقراص والكبسولات التي تحتوي على مواد حمضية مثل الأسبرين ومشتقاته

* المواد الصلبة صعبة الهضم

* المواد الحريفية الزائدة مثل الشطة و المواد الاخرى المهيجة

* شرب الشاي والقهوة على معدة فارغة

* تناول الاطعمة الساخنة جدا

* شرب المياه الغازية وبعض الاقراص الفوارة تؤذي جدار المعدة (http://www.libyanyouths.com/vb/t64355.html)
* الاجهاد العقلي .

- شرب الكحوليات .

- التدخين .

بالإضافة إلى ذلك هناك أشخاص معرضين أكثر من غيرهم للإصابة بالقرحة وهم حاملي فصيلة الدم (O) أو المصابين بمرض نادر يسمى متلازمة زولنجر إلسون (Zollinger-Ellison Syndrome) ..


الأعراض :-


- ألم في البطن، ويحدث بعد ساعتين إلى ثلاث ساعات من الأكل أو عند عدم الأكل لمدة معينة عندما تفوت إحدى الوجبات. يخف الألم عند تناول مضادات الحموضة أو الحليب .

- تقيء ولوعان .

- نقص في الوزن .

- حرقة الفؤاد او ما يعرف بالإسترجاع المريئي .

- خمول .

- وقد يحدث تقيء دم أو تلون البراز بلون أسود داكن كالقار .

وقد لا يحس المصاب بأية أعراض سوى ألم خفيف في أعلى البطن ..


التشخيص :-

- عند طريق التاريخ المرضي والفحص السريري يقوم الطبيب بتوقع القرحة وطلب بعض الفحوصات التأكيدية .

- أشعة ملونة متكررة للمعدة (Upper GI and small bowel series) حيث يقوم المريض ببلع مادة ملونة ومن ثم تؤخذ له صور أشعة متكررة .

- التنظير العلوي للجهاز الهضمي (Upper GI endoscopy) وهو الفحص المؤكد للتشخيص ويتم فيه إدخال منظار على شكل أنبوب رفيع من الفم إلى المعدة والأثنى عشر لرؤية جدار المعدة والأمعاء ولأخذ عينة إن لزم الأمر .


العلاج بالادوية :-


ويتم بالأدوية لقتل البكتيريا إن وجددت وللتقليل من إفراز الحمض ولوقاية جدار المعدة والأثنى عشر. ومن الأدوية:

- مضادات حيوية لقتل بكتيريا (Helicobacter pylori)

- مضادات إفراز الحمض مثل (cimetidine, ranitidine, or famotidine)

- مثبطات مضخات البروتون مثل (omeprazole)

- أدوية لحماية جدار المعدة مثل (sucralfate)



المضاعفات :-


- نزيف داخلي

- ثقب المعدة [URL="http://www.libyanyouths.com/vb/t64355.html"]أو الأثنى عشر


الوقاية :-

- ابتعد عن التدخين وشرب الكحوليات

- لا تستخدم مضادات الإلتهاب الغير استرودية بشكل مطول ومتكرر إلى بإذن الطبيب وتحت إشرافه

- قلل من شرب القهوة والكولا ...

nosa_aic
19 - 12 - 2011, 08:31
عادات تدمر دماغ الانسان


- 1عدم تناول وجبة الإفطار


الناس الذين لا يتناولون وجبة الإفطار سوف ينخفض معدل سكر الدم لديهم. هذا يقود إلى عدم وصول غذاء كاف لخلايا المخ مما يؤدي إلى انحلالها.


-2 الإفراط في تناول الأكل.


الأكل الزائد يسبب تصلب شرايين الدماغ , مما يؤدي إلى نقص في القوة الذهنية


-3 التدخين


يسبب التدخين انكماش خلايا المخ وربما يؤدي إلى مرض الزهايمر.


-4كثرة تناول السكريات


كثرة تناول السكريات يعوق امتصاص الدماغ للبروتينات والغذاء، مما يسبب سوء تغذية الدماغ وربما يتعارض مع نمو المخ.


-5 تلوث الهواء


الدماغ هو اكبر مستهلك للأكسجين في أجسامنا. استنشاق هواء ملوث يقلل دعم الدماغ بالأكسجين مما يقلل كفاءة الدماغ.

-6 الأرق ( قلة النوم)


النوم يساعد الدماغ على الراحة . كثرة الأرق تزيد سرعة موت خلايا الدماغ.

-7 تغطية الرأس أثناء النوم


النوم مع تغطية الرأس يزيد تركيز ثاني أكسيد الكربون ويقلل تركيز الأكسجين مما يؤدي إلى تأثيرات سلبية على الدماغ.


-8 القيام بأعمال أثناء المرض

العمل الشاق أو الدراسة أثناء المرض تقلل من فعالية الدماغ كما أنها تؤدي إلى تأثيرات سلبية عليه.


-9 قلة تحفيز الدماغ على التفكير


التفكير هو أفضل طريقة لتمرين الدماغ . قلة تحفيز الدماغ على التفكير تؤدي إلى تقلص أو تلف خلايا الدماغ.


-10 ندرة الحديث مع الآخرين

الحوار الفكري مع الآخرين يساعد على ترقية فعالية الدماغ

nosa_aic
24 - 12 - 2011, 09:55
فيتامين B7 دينامو الخلايا و علاج لمشاكل الشعر

فيتامين B7 واحد من عائلة فيتامين B)) ويعرف باسم" البيوتين" أو فيتامين H والبيوتين يعمل كمساعد إنزيم لإنزيمات الكربوكسيليز الأربعة المعتمدة على البيوتين وهو بذلك هام لإتمام عمليات التمثيل الغذائي للكربوهيدرات والدهون والأحماض الأمينية وتحويل الطعام إلى طاقة فهو ضروري لمعظم العمليات الحيوية التي تتم داخل خلايا الكائنات الحية لذلك سمي بالبيوتين .

ومن الأطعمة التي تحتوى على البيوتين (فيتامين B7)

اللحوم والكبدة وصفار البيض المطهي والفول والأسماك والجزر والخيار

أما عن أسباب نقص البيوتين (فيتامين B7) في الجسم فهي:

كثرة تناول المضادات الحيوية لفترات طويلة
نقص كفاءة البكتريا التي تقوم بإنتاج البيوتين نتيجة أمراض معوية.
وجود مادة الأفيدين (avidin) الموجودة فى بياض البيض النيئ التي ترتبط بقوة مع البيوتين فتمنع امتصاصه ولتفادي هذه المشكلة يجب طهي البيض لأنه من المعروف أن الأفيدين يتلف بالحرارة .
مرضي السكر، حيث أثبتت الدراسات أن مرضى السكر لديهم نقص شديد في نسبة البيوتين.
أعراض نقص البيوتين
تقشير الجلد و التهاب الجلد الدهني والالتهابات الفطرية وسقوط الشعر وفقدان الشهية والقيء، وآلام العضلات والنعاس والضعف العام.

فوائد البيوتين( فيتامينB7)

• تحسين حالة مرضى السكر من النوع الثاني (الغير معتمد على الحقن بالأنسولين) فقد أثبتت الأبحاث أن العلاج المزدوج بالبيوتين مع عقاقير الكروم ( عقاقير تنشط عمل الأنسولين وتمرره للخلايا) يضبط نسبة السكر في الدم أكثر بالمقارنة بالمرضى الذين تم علاجهم بالكروم منفرداً.
• علاج التهاب الأعصاب المحيطية وهي تلف الأعصاب في القدمين واليدين والساقين مع ألم وضعف في العضلات حيث يعمل البيوتين على إمداد الخلايا العصبية بالطاقة.
• يعالج مشاكل سقوط الشعر ويقوي الأظافر حيث يعمل على تغذية الشعرة ويمنع تقصفها.
• ضروري لعمليات التمثيل الغذائي.
• إنتاج الطاقة والتمتع بالحيوية والنشاط.
• علاج مساعد لكثير من الأمراض الجلدية.
• مفيد لمرضى سوء التغذية.
والجدير بالذكر أنه رغم أهمية هذا الفيتامين فقد ظل لسنوات طويلة غير متواجد في السوق المصري وكان البيوتين الموجود في مصر عبارة عن منتج مستورد يأتي مهرباً وبثمن مرتفع جداً ولكن قامت هذا العام2011 شركة مصرية وهي "شركة الصناعات الدوائية المتطورة أبك" ((APIC بتصنيع البيوتين (فيتامين B7) بصورة نقية وسيطرح في الأسواق قريباً.

nosa_aic
24 - 12 - 2011, 10:04
تناول منتجات الالبان ضرورة اثناء الرجيم

اكدت دراسة امريكية على ضرورة تناول من يقومون بعمل رجيم لمنتجات الالبان من الحليب والجبن والزبادى لانها تحمى العظام خلال عملية فقدان الوزن.
واوضحت الدراسة ان معظم الناس الذين يسعون لانقاص وزنهم يقومون بخفض استهلاكهم الغذائي بشكل عشوائي. ولا ينظرون الى كتلة العظام، والتي تصل إلى ذروتها في مرحلة الشباب وتتدهور بشكل أسرع عند اتباع نظام رجيم .
وقام الباحثون من جامعة ماكماستر بقيادة اندريا جوس باختيار 90 امرأة كن يعانين من زيادة الوزن أو البدانة ، وجعلوهن يتناولن كميات متوسطة أو عالية من منتجات الألبان إلى جانب كميات من البروتين والنشويات لمدة 16 أسبوعا. ثم رصدوا صحة عظامهن، وكذلك الكالسيوم ومستويات فيتامين (د) في جميع أنحاء الجسم .
واظهرت النتائج ان المشاركات اللاتى تناولن الوجبات قليلة السعرات الحرارية وعالية البروتين ومنتجات الألبان لم يصيبهن أي تغيير في فقدان العظام كما حدثت لهن زيادة فى مستويات فيتامين د .
ونصحت الدراسة من يسعون الى تقليل اوزانهم بتناول منتجات الألبان الغنية بالبروتين لحماية عظامهم .
كما نصحت الدراسة النساء الشابات على وجه الخصوص بضرورة استهلاك المزيد من البروتين من منتجات الألبان لخفض خطر الإصابة بأمراض مثل هشاشة العظام

nosa_aic
24 - 12 - 2011, 10:51
ما الفرق بين أنيميا الحديد وأنيميا الأمراض المزمنة؟

سألت نورعبد العزيز عن العلاج المناسب لأنيميا نقص الحديد؟ يجيب الدكتور جمال الدين فتحى، أستاذ أمراض الدم وزرع النخاع بمعهد ناصر لبحوث أمراض الدم قائلا: "إن علاج أنيميا الحديد يتم بإعطاء جرعه من عنصر الحديد فى شكل أقراص أو كبسولات أو من خلال الحقن بالوريد أو بالعضل".

ويشير د. جمال إلى أن تعويض انخفاض نسبه الحديد يتم بتناول الأقراص وهى أفضل من الحقن الذى يسبب بعض الأعراض الجانبية مثل هبوط ضغط الدم أو الحساسية وظهور الخراريج عند حقن المريض بالعضل، لكنه لفت إلى أهميه الحقن بالنسبة للمراه الحامل التى تعانى من الأنيميا والتى يصعب معها التعامل العلاجى بالأقراص والتى يصعب امتصاص الحديد منها.

ويقول إن بعض الحالات تقاوم العلاج بالحديد التعويضى "بأنواعه المختلفة" ولا تحدث أى استجابة للعلاج، مما يشير إلى وجود سبب آخر أنها ليست أنيميا حديد، لكنها نوع آخر يتشابه فى أعراضه مع أنيميا الحديد وهى الأنيميا المتعلقة أو الناتجة عن أمراض مزمنة وأوضح انه فى حاله أنيميا الأمراض المزمنة تكون مخازن الحديد ممتلئة بعكس أنيميا الحديد التى تكون فارغة.

ويوضح أن الأنيميا المتعلقة بأمراض مزمنة لها ميكانيزم مختلف حيث إن مادة "هيبسيدين" التى تفرز من الكبد فى حالة الإصابة بالأمراض المزمنة هى المسئولة عن الإصابة بهذا النوع من الأنيميا، نظرا لأنها تمنع امتصاص الحديد من الأمعاء كما تمنع إفرازه من مخازنه رغم امتلائها وهذا ما يتبين من خلال عمل ما يسمى "ملف الحديد"، ويتم إعطاء المريض هنا عقار "ارثير بوتين"، لتنشيط كرات الدم الحمراء مع ضرورة علاج الأمراض المزمنة أولا.

nosa_aic
24 - 12 - 2011, 10:55
برنامج علاجى للإقلاع عن التدخين باستخدام النيكوتين


أوضحت الدكتورة علا أسامة، أستاذ الأمراض النفسية وعلاج الإدمان بقصر العينى، أن هناك طرقا علاجية مختلفة ومتعددة للإقلاع عن التدخين منها: مضادات الاكتئاب وعلاج آخر يسمى نيكوتين ربليسمنت ثرابى، وهو فى صورة لبان أو لاصقات توضع على أجزاء بالجسم منها الكتف وأقراص للاستحلاب واسبراى بالفم أو الأنف، لافته إلى أن هذه العلاجات تحتوى على نسبه قليلة وثابتة من النيكوتين، نظرا لاحتواء السيجارة الواحدة على أربعة آلاف مادة كيماوية سامة منها النيكوتين ومادة التار المسرطنة.


وأشارت إلى أن المريض الذى يبدأ علاجه للإقلاع عن التدخين يستغرق ستة أسابيع، لافتة إلى أن الإرادة والعزيمة والمتابعة تؤدى إلى سرعة الإقلاع عن التدخين بجانب الدعم النفسى والبرنامج التحفيزى الذى يصاحب البرنامج العلاجى.

nosa_aic
24 - 12 - 2011, 14:07
الصداع المتكرر قد يدمر خلايا المخ


http://www.aljazeera.net/mritems/images/2007/10/12/1_727296_1_23.jpg (http://www.libyanyouths.com/vb/t18889.html)


ربطت دراسة ألمانية حديثة بين الإصابة المتكررة بصداع في الرأس بشكل متكرر وبين الضرر الدائم في خلايا المخ.
وإلى جانب ما يسببه الصداع من ألم نفسي وجسدي يتمثل في حالة الإرهاق والضعف العامة التي تعتري الجسد وعدم القدرة على التركيز فضلا عن شدة الألم، قد يصل الأمر إلى وضع أكثر خطورة -برأي الدراسة- تمتد آثاره أحيانا إلى فقدان "المادة الرمادية" في قشرة المخ.
وفي هذا الصدد يقول مدير المستشفى الطبي للأعصاب بجامعة آيسن غربي ألمانيا البروفيسور هانز كريستوف دينر لمجلة "برجيت وومان" الألمانية "إذا استمر صداع الرأس لفترات متقطعة تزيد عن خمسة أعوام، لن يستطيع المريض أن يتحرر من الألم مطلقا".
وأشار دينر إلى أنه لا يمكن معالجةالصداع بأي حال من الأحوال إلا عندما يتم تحديد سببه بشكل مبكر واستهداف ذلك السبب ومعالجته. وأضاف "حينها فقط يمكن منع إصابة الشخص بالمضاعفات ومنها الإصابة بضعف الذاكرة".
كما اعتبر أن تحديد سبب الصداع في حد ذاته أمر ليس بالهين, قائلا "هناك نحو 243 نوعا لصداع الرأس مدرجة بالقائمة التي أعلنتها منظمة الصحة العالمية حول أنواع الصداع المختلفة، وفيها يحتل الصداع النصفي المركز الأول".
وحذر دينر قائلا "من وصلت حالته إلى درجة متقدمة يحتاج معها إلى تناول المسكنات بصفة متكررة مثلا في عشرة أيام من الشهر، لن يجدي معه العلاج نفعا".
ونصح بنوع من "العلاج المتكامل" الذي يجمع بين الأدوية وعلاج السلوك المعرفي مثل تمارين الاسترخاء وأساليب التخلص من التوتر والقلق والممارسة الدائمة لرياضة زيادة قدرة التحمل حتى يتم تحاشي إحداث أي ضرر "بالمادة الرمادية" في المخ.
يشار إلى أن المادة الرمادية تسمى كذلك بسبب لونها الظاهر للعين المجردة، وهي تمثل قشرة المخ. وتبين تحت الملاحظة المجهرية أن هذه المادة مكونة أساسا من أجسام رخوية نجمية الشكل تشكل أجسام الخلايا العصبية، في حين أن المادة البيضاء يتكون قوامها من الألياف العصبية

nosa_aic
24 - 12 - 2011, 14:20
آلام الظهر والوقاية منها

يعاني كثير من الناس من الام الظهر، وهي من أكثر الآلام شيوعاً،

لذا فإن أسبابها تختلف من شخص لآخر،

فقد يشعر المريض بالألم بعد حادث أو سقوط أو نتيجة التهاب أو وضع خاطئ لفترة طويلة وقد يكون بسبب حمل أشياء بطريقة خاطئة.

وسنتحدث هنا عن الآلام الظهرية الناتجة بسبب الأوضاع والنشاطات الخاطئة.

فالوضع غير الصحيح يؤدي إلى زيادة الضغط على الغضروف والعضلات المحيطة بالعمود الفقري،

لأن هناك علاقة طردية بين الضغط على الغضروف والألم.

فكلما زاد الضغط على الغضروف زاد ضغط الغضروف على الأربطة الخلفية والأعصاب فيحدث ألم في الظهر ويمتد إلى الأرجل . ولهذا ينصح الأطباء مرضى الانزلاق الغضروفي بلزوم السرير فترة كافية ليقل الضغط على الغضروف وبالتالي يقل الألم.


ومما ينبغي الإشارة إليه أن أكثر من يعاني الام الظهر هم السائقون والموظفون الذين تتطلب أعمالهم الجلوس لفترات طويلة دون تغيير أوضاعهم بين فترة وأخرى.

ومما يجدر بالذكر أن الأبحاث والدراسات أثبتت أن التمارين الخاصة بآلام الظهر والمحافظة على الوضع الصحيح خلال الجلوس والقيام ومزاولة الأعمال تخفف الكثير من ألم الظهر وتغني أحياناً أخرى

الأوضاع المختلفة لفقرات الظهر:

وهناك قاعدة طبية تقول الوقاية خير من العلاج.

إذاً فلابد من الاهتمام بالظهر منذ الطفولة.

وهي مسؤولية تشمل الآباء والأمهات والمعلمين والمعلمات بإرشاد الطلاب إلى الوضع الصحيح أثناء الجلوس والقيام والمشي،

ولابد من الاهتمام بالمقاعد والطاولات بحيث تكون في وضع مناسب لعمر الطالب من حيث الارتفاع والانخفاض.



كيف نتجنب الام الظهر ؟

1-حاول إنقاص وزنك إذا كان وزنك زائداً عن المعدل الطبيعي لطولك.

2 - صحح وضع ظهرك خلال الجلوس والقيام والمشي.

3 - باعد بين قدميك أثناء الوقوف أو حمل الأشياء.

4 - ارفع إحدى رجليك على طاولة صغيرة 10 سم تقريباً ثم ضعها وارفع الرجل الأخرى.

5 - اثن الركبتين مع استقامة الظهر عند التقاط شيء من الأرض.

6 - اختر حذاءً مناسباً ليس مرتفعاً أو مدبباً من الأمام.

7 - اختر مرتبة سرير مناسبة للنوم ليست قاسية ولا لينة بل بين ذلك.

8 - بادر بأخذ قسط من الراحة عندما تشعر بألم في ظهرك.

9 - عدم الوقوف أو الجلوس لفترات طويلة.

معلومات هامة يجب معرفتها :

1 - التمارين مهمة لتقوية عضلات البطن والظهر فهي تساعد على التخلص من الآلام. ولكن قبل أن تبدأ التمارين استشر أخصائي العلاج الطبيعي فكل شخص له ما يناسبه من التمارين.

2 - تتفاوت أسباب الألم من شخص لآخر مما يحتم وضع برنامج علاجي خاص لكل شخص.

3 - ننصح بعدم ممارسة تمارين وضعت لمريض آخر.


تذكر


الأيام التي تشعر فيها بألم في ظهرك هي الأيام التي تحتاج فيها مراجعة طبيبك أولاً لمعرفة السبب ثم مراجعة أخصائي العلاج الطبيعي لوضع البرنامج المناسب للعلاج.

في حالة زيادة الألم أثناء التمارين عليك بالراحة.

nosa_aic
24 - 12 - 2011, 18:22
فقدان شهية الطعام

إن فقدان شهية الطعام لأمر عادي ويحدث كثيراً لدى فئة من الناس وفي مختلف الاعمار ويخضع لعدة عوامل قد يكون احدها سبباً كافياً لفقدان شهوة تناول الطعام أو ربما لنوع محدد من الاطعمة بصفة خاصة، حيث ان كثيرا من الناس لا يحب طعاماً معيناً اما لعقدة نفسية او ربما لعدم موافقة طعم ورائحة الاكل للشخص أو ربما لاسباب أخرى.


أسباب فقدان شهية الطعام:

- توجد عوامل كثيرة تؤدي إلى ضعف الشهية ومن أهم هذه العوامل، العامل النفسي، حيث ان القلق والتوتر والحزن تفقد الانسان قابليته للاكل. كما يعتبر ضعف الشهية عرضاً هاماً لعدة أمراض، بل ويعتبر ايضاً من احد الاسباب الرئيسية لكثير من الأمراض التي تنتج عن ضعف التغذية مثل فقر الدم والانيميا وخلاف ذلك.
والطبيب البشري أو النفسي الجيد يمكن ان يضع اصبعه على السبب الذي يؤدي إلى ضعف الشهية لدى المريض، وعندها يمكن وصف العلاج المناسب وتحديد الاساليب المناسبة لفتح الشهية للأكل.


المصادر الطبيعية لفتح الشهية وتقوية الأجسام الهزيلة:

- التمر واللبن

ينقع التمر في الحليب لمدة ست ساعات ثم يأكله المريض حيث يفتح شهوته للطعام. ولا شك ان هذين المصدرين يعتبران من اغنى المواد بالمعادن والفيتامينات والاحماض الامينية والسكريات والبروتين والمواد الدهنية حيث يعتبر من أفضل المغذيات، ويجب على الاشخاص المصابين بالسكري عدم استعمال هذه الوصفة.

- الحلبة

يعتبر مغلي الحلبة من المواد المشهية للأكل والطريقة ان توخذ ملء ملعقة من الحلبة البلدي وتوضع في ملء كوب ماء ثم يغلى على النار لمدة 1/4ساعة ثم يصفى ويشرب بعد تحليته بالعسل أو السكر قبل الوجبة الغذائية بنصف ساعة.

- الخل

يستعمل خل العنب أو التفاح وذلك باضافته إلى السلطة وتضاف ملعقة صغيرة من الخل إلى ملء كوب ماء الموجود على مائدة الطعام وتشرب على فترات خلال وجبة الغذاء حيث يساعد على فتح الشهية وعلى بلع الطعام.

- الترمس

من المعروف ان الترمس غني بالكالسيوم والفوسفور والترمس يحسن الشهية ويقوي الجسم والطريقة ان يوخذ 250جم من بذور الترمس وينقى جيداً ثم ينقع في الماء لمدة 24ساعة متتالية على ان يغير الماء كل ست ساعات ويجمع الماء جانباً، ثم يغلى بعد ذلك مع كمية جديدة من الماء لمدة ساعة على النار ثم يصفى الماء ويعاود نقعه مرة أخرى بعد ذلك لمدة 24ساعة أخرى ثم يصفى ويؤكل بعد ان يضاف عليه قليل من الملح والليمون. هذه الوصفة جيدة ايضاً للمصابين بالسكر حيث انها تخفض نسبة السكر. يمكن ان يستعمل ماء منقوع الترمس كغرغرة جيدة للاسنان وغسول جيد للشعر بالنسبة للجنسين.

- اليانسون

تحتوي ثمار اليانسون على زيوت طيارة واهم مركباته الانيثول والذي يساعد على عملية الهضم والطريقة ان يؤخذ ملء ملعقة من ثمار اليانسون وتوضع في كوب ثم يملأ بالماء المغلي ويترك لمدة 15دقيقة ثم تصفى ويشرب مرة بعد الفطور واخرى بعد العشاء وهذه الوصفة جيدة لفتح الشهية.

- البصل

من المعروف ان البصل يفتح الشهية للطعام وعليه فإنه يؤخذ حبة بصل في حجم بيضة الدجاجة وتؤكل مرة مع الغذاء واخرى مع العشاء يومياً. والبصل يغذي ويطهر الامعاء ويقوي البدن ويقتل جراثيم المعدة. ويجب تناول بقدونس طازج بعد أكل البصل لايقاف رائحة البصل المعروفة.

- الثوم

الثوم يعتبر اغنى الاعشاب بالمواد الفعالة واكثرها تأثيراً على عدة أمراض بالاضافة إلى ذلك فهو مشهي جيد ويعطي الجسم قوة لا نظير لها وهو بحق غذاء ودواء وتناول افصاص الثوم مع الطعام أو مع السلطة بواقع 3- 6افصاص في اليوم الواحد ويمكن اكله طازجاً أو مطبوخاً.

- الزعتر

يعتبر الزعتر من اشهر النباتات التي تستخدم في بلدان حوض البحر الابيض المتوسط حيث يستعمل على نطاق واسع كمشهي وايضاً يزيد من قوة التحمل ومقو لجهاز المناعة والطريقة ان يؤخذ ملء ملعقة من الزعتر وتذر فوق الطعام أو تخلط مع زيت زيتون أو زيت سمسم ويؤكل مع الخبز.


الشوفان والقمح والشعير

يؤخذ كميات متساوية من طحين الشوفان والقمح والشعير المنخول ثم تمزج معاً ويوضع وعاء على النار به ماء يوازي حجم الدقيق المخلوط وعند بداية الغليان يذر الدقيق فوق الماء ويحرك تحريكاً جيداً ويضاف الدقيق شئياً فشيئاً مع التحريك المستمر حتى تنتهي كمية الدقيق وتتكون عصيدة رخوة ثم يضاف لها قليل من عسل النحل الأصلي وتؤكل مع الوجبات أو منفصلة عنها وتعطى للأطفال بشكل أكبر لما فيها من فوائد جمة.

عرق السوس

لقد تحدثنا كثيراً عن عرق السوس وذكرنا أنه يحتوي مواد مشابهة للكورتيزون ولكنها لاتسبب الأعراض الجانبية التي يسببها الكورتيزون. ويعتبر العرق سوس من افضل العقاقير في علاج أمراض الدم وعليه فإنه مفيد لعلاج فقر الدم ولكن يجب عدم استعماله من قبل المرضى الذين يعانون من ارتفاع ضغط الدم والجرعة من مسحوق جذور العرق سوس هي ملء ملعقة صغيرة على ملء كوب ماء بارد ويحرك جيداً ويشرب مرة واحدة في اليوم.

الكرفس

الكرفس أحد النباتات المشهورة التي تستعمل مع السلطة أو يؤكل كما هو أو يعمل منه مسلوقاً والكرفس يحتوي على أهم المواد المفيدة لجسم الإنسان مثل فيتامينات أ،ب،ج وكذلك معادن الكالسيوم واليود والحديد والنحاس والمنجنيز، والماغنيسوم، والبوتاسيوم، والفوسفور، ويعتبر من فواتح الشهية المشهورة.


الحمص

بذور الحمص غنية جداً بالمواد البروتونية والأملاح المعدنية مثل البوتاسيوم والفوسفور والكبريت والكالسيوم والحديد وهو مفيد جداً ومسمن في نفس الوقت. ويتناول الشخص حفنة واحدة من الحمص في منتصف وجبة غذائية فقط خلال اليوم الواحد. ويجب عدم تناول الحمص أو الإفراط في تناوله من قبل اصحاب المعد الضعيفة حيث إنه ثقيل الهضم.

اتمنى لكم دوام الصحة والعافية

nosa_aic
24 - 12 - 2011, 22:04
حركة تلقائية تتكرر معنا يوميا تؤدى الى السرطان


حركه تلقائيةعند الكثير ..

وهي النفخ على الطعام الساخن لتبريده وهي تتكرر يومياً عند الكثير خاصة اطفالنا

والحقيقه العلمية تقول :

انه توجد في اجسامنا بكتيريا صديقه..بعكس تلك الضارة وهي تساعد الجسم على

مقاومة بعض الامراض..وهي توجد في الحلق..

لكن حين يقوم الانسان بالنفخ..تخرج هذه البكتيريا مع الهواء الخارج من جوف الانسان

ولكن بمجرد ملامستها لسطح ساخن تتحول الى بكتيريا ضارة مؤدية الى الاصابة

بالسرطان.

أجارنا الله واياكم ولأجل ما ذُكر ننصح بعدم النفخ على الطعام أو الشراب الساخن
بقصد التبريد

nosa_aic
25 - 12 - 2011, 17:59
ملعقة صغيرة من القرفة مناسبة لخفظ نسبة سكر الدم


ما يحرص عليه البعض بإضافة قليل من القرفةإلى أطباق الحلويات أو إلى المشروبات الساخنة المُحلاة، هو سلوك صحي
وذلك وفق ما تُؤكده الدراسات الطبية الحديثة والتي صدر آخرها للباحثين من السويد في عدد يونيو الحالي من المجلة الأميركية للتغذية الإكلي***ية. وهو ما يُضاف إلى جملة من الدراسات الطبية الحديثة، التي بحثت في الجدوى الإيجابية لإضافة القرفة[/URL] إلى طعام الإنسان في السعي لخفض ذلك الارتفاع الصاروخي في نسبة سكر الدم (http://www.libyanyouths.com/vb/t1186.html) عقب تناول المشروبات أو الأطعمة المحتوية على السكريات.

http://pms.panet.co.il/online/images/articles/2007/10/18-10-07/3205062833.jpg (http://www.libyanyouths.com/vb/t1186.html)

ووجد الباحثون من مستشفى مالمو الجامعي بالسويد أن إضافة كمية قليلة من القرفة، لا تتجاوز حجم ما يملأ ملعقة الشاي، إلى حلوى البودينغ المصنوعة من دقيق الأرز، قد أدى إلى خفض حدة الارتفاع في نسبة سكر الدم لدى مجموعة من الأصحاء الذين تمت تجربة الأمر عليهم.هذه النتيجة، وإن كانت متوافقة تماماً مع نتائج دراسات طبية سابقة عديدة في إثبات قدرة مكونات القرفةعلى خفض نسبة السكر الدم، إلا أن هذا الكلام العلمي الثابت لا يعني تلقائياً أن يعتمد الناس على تناول القرفة بدلاً من أدوية معالجة السكري التي يصفها الأطباء ويتابعون مفعولها، بل تعني أن إضافةالقرفةإلى وجبات الحلويات أو المشروبات المُحلاة هو من السلوكيات الغذائية الذكية التي يحرص الإنسان على ممارستها كإحدى وسائل الوقاية من ارتفاع نسبة سكر [URL="http://www.libyanyouths.com/vb/t1186.html"] (http://www.libyanyouths.com/vb/t1186.html) الدم، سواء لدى الأصحاء أو لدى مرضى السكري. وهذا يُضفي مزيداً من المصداقية والاطمئنان إلى جدوى اعتياد البعض على تناول القرفة وحرصهم على إضافتها إلى مكونات غذائهم اليومي، بنسب وكميات معتدلة. لكن من جانب آخر، لا يعني إثبات فائدة القرفة في خفض سكر الدم، أن يأخذ مُعد الحلويات راحته، كما يُقال، بإضافة أكوام السكر إلى المعجنات، ويخدع **ائنه بمجرد اهتمامه بإضافة كمية من بودرة القرفة فوقها أو ضمنها، كوسيلة صحية للحماية من تأثيرات تلك السكريات.

nosa_aic
25 - 12 - 2011, 19:50
لماذا يبدوا صوتك مختلفا عندما تسمعه


يتفاجأ الكثيرون عندما يسمعون أصواتهم بعد أن يسجلوها على المسجل،

بل قد يرفض البعض أن يصدق أن الصوت الذي يسمعه هو صوته الحقيقي .

تفسير هذه الظاهرة أنه عندما [/URL] يتحدث الإنسان تهتز الحبال الصوتية الموجودة
في الحلق

وهذا يؤدي إلى اهتزاز كل من العظام المحيطة ، البشرة ، وبعض التجاويف الهوائية .

هذه الإهتزازات تندمج مع الموجات الصوتية التي تنتقل بدورها إلى

الأذن مما يكسب الصوت عـمـق ورزانة . من ناحـية أخـرى فإن الصـوت الذي

نسمعـه من المسجل يكون خاليا من الاهتزازات الناتجة عن التجاويف الهوائية

المحيطة بالفم ، ولذلك يبدو لنا مختلفا عما نسمعه . هذا الصوت الذي نسمعه

عبر المسجل هو نفس الصوت الذي يسمعه الآخرون عندما[URL="http://www.libyanyouths.com/vb/t104508.html"] (http://www.libyanyouths.com/vb/t104508.html) نتحدث .

nosa_aic
25 - 12 - 2011, 21:04
أضرار المشروبات الغازية

- تحتوي العلبة الواحدة على ما يعادل 10 ملاعق سكر كافية لتدمير فيتامين ( ب ) والذي يؤدي نقصه إلى سوء الهضم وضعف البنية و الاضطرابات العصبية والصداع والأرق والكآبة والتشنجات العضلية .


- كما تحتوي على غاز ثاني أكسيد الكربون الذي يؤدي إلى حرمان المعدة من الخمائر اللعابية الهامة في عملية الهضم وذلك عند تناولها مع الطعام أو بعده وتؤدي إلى إلغاء دور الأنزيمات الهاضمة التي تفرزها المعدة وبالتالي إلى عرقلة عملية الهضم وعدم الاستفادة من الطعام .


- تحتوي على الكافيين الذي يؤدي إلى زيادة ضربات القلب وارتفاع ضغط الدم والسكر وزيادة الحموضة المعدية وزيادة الهرمونات في الدم مما قد يسبب التهابات وتقرحات للمعدة والاثناعشر كما يعمل على أضعاف ضغط صمام المريء السفلي والذي بدوره يؤدي إلى ارتداد الطعام والأحماض من داخل المعدة إلى المريء مسببا الألم والالتهاب .


- كما تحتوي على أحماض فسفورية تؤدي إلى هشاشة وضعف العظام وخاصة في سن المراهقة مما يجعلها أكثر عرضة للكسر .


- تحتوي على أحماض الفوسفوريك والماليك والكاربونيك التي تسبب تآكل طبقة المينا الحامية للأسنان .

- تحتوي الدايت منها على المحليات الصناعية التي تهدد المخ وتؤدي إلى فقدان الذاكرة التدريجي وإصابة الكبد بالتليف . - معدل الحموضة في المشروبات الغازية[/URL] ph مثلا بيبسي كولا أو كوكاكولا ph = 4 و3 ، هذه الدرجة من الحموضة كافية لإذابة الأسنان والعظام مع مرور الوقت . أجسادنا تتوقف عن بناء العظام بعد الثلاثين ، وتبدأ بعد ذلك بالتحلل 8 – 18% سنوياً بحسب كمية الأحماض التي نستهلكها في غذائنا . ( نسبة هذه الأحماض لا تعتمد على مذاق طعامنا ولكنها تعتمد على نسبة كل من البوتاسيوم ، الكلور ، المنغنيز ، وغيرهم إلى الأملاح الفسفورية ) .

- الكالسيوم المذاب يتراكم في العروق ، خلايا الجلد ، الأعضاء الحيوية ، مما يؤثر في وظائف الكلى ويسبب حصوة الكلية .

- المشروبات الغازية[URL="http://www.libyanyouths.com/vb/t34069.html"] (http://www.libyanyouths.com/vb/t34069.html) لا توفر للجسد أي فائدة غذائية ، بل تحتوي على المزيد من السكر والأحماض بالإضافة للمواد الحافظة والملونة .

- بعض الأشخاص يفضل تناول مشروب غازي بارد بعد وجبة الطعام . هذا التصرف يؤثر على عمل الأنزيمات الهاضمة حيث أنه يخفض درجة الحرارة فتفقد الأنزيمات الهاضمة قدرتها على العمل حيث أن درجة حرارة الجسم الطبيعية هي الدرجة المناسبة لعمل الأنزيمات ، فلا تهضم الطعام جيدا مما يؤدي إلى تكون الغازات وبعض أنواع السموم التي تنتقل مع الدم إلى خلايا الجسم وقد تؤدي في النهاية إلى العديد من الأمراض .

- إنك عندما تشرب المياه الغازية فإنك تبتلع كميات من ثاني أكسيد الكربون (( CO2 .

- قبل فترة بسيطة تمت مسابقة في جامعة دلهي في الهند " من يشرب أكبر كمية من بيبسي كولا " . الفائز شرب ثمان علب من الكوكاكولا وتوفي في نفس المكان لارتفاع نسبة غاز ثاني أكسيد الكربون في دمه مما أدى إلى عدم تمكنه من الحصول على الأكسجين اللازم ..

- وضع أحد الأشخاص سناً مكسوراً داخل زجاجة بيبسي وخلال عشرة أيام فقط كانت السن قد تحللت !!!

- الأسنان والعظام آخر ما يتحلل من جسم الإنسان بعد موته بعدة سنوات ولكن هذه المياه الغازية تذيبه خلال أيام قليلة ، فتخيل ماذا يمكن أن تفعله في باق الخلايا الطرية .



لذالك كله فقد قالوا عنها :-

- اسكب علبة كوكاكولا في المرحاض واتركها لمدة ساعة واحدة ثم اسحب السيفون ستلاحظ أن جميع البقع قد زالت وذلك أن حامض الستريك قد أزالها بفعالية قوية .


- لإزالة الصدأ عن صدام سيارتك أو عن صامولة صدئة أفرك ما تريد تنظيفه بقطعة قماش مبللة بالكوكاكولا وستقوم الكوكاكولا بالمهمة .


- لتنظيف أصابع البطارية من التآكل اسكب علبة كوكاكولا على أصابع البطارية ولاحظ فقاعات الغاز وهي تعمل بفعالية على تفتيت التآكل وإزالته .
- لإزالة بقع الدهون عن الملابس أضف مقدار علبة كوكاكولا إلى مواد الغسيل ولاحظ اختفاء بقع الزيت .

nosa_aic
26 - 12 - 2011, 07:21
دراسة تفيد ان الزبادى يقضى على الكرش

يعاني الكثير من مشكلة تراكم الدهون في منطقة البطن، وهو ما يعرف بـ«الكرش». فإذا كنت واحدا ممن يعانون من هذه المشكلة، هناك وصفة يقول البعض انها سحرية يمكن ان تساعدعلى التخفيف من حدة معاناتك، تتركز على تناول الزبادي ثلاث مرات في الأسبوع. وهذا ما أكدته دراسة حديثة بالقول إنه يستطيع فعلا المساعدة على التخلص من «الكرش»، لأنه يحتوي على بكتيريا « اللاكتوباسيلس اسيدوفيلس» التي تؤدي إلى تخمر اللبن، كما تحتوي على انزيم « اللاكتيز» الهاضم لسكر اللاكتوز الموجود في اللبن، وهو الانزيم الذي يفقده 85% من الناضجين خاصة في الشعوب العربية والأفريقية، ويتسبب نقصه في صعوبة الهضم واضطرابات الأمعاء وسوء الهضم والانتفاخ .



وفي دراسة حديثة للدكتور حامد عبد الله بالمركز القومي للبحوث في مصر أكد أن للزبادي قدرة على حرق دهون الجسم، لأنه يمكن أن يغير من قدرة الجسم على حرق الدهون مما يجعله يفقد هذه الدهون ويحتفظ بالعضلات .

وأشار الدكتور حامد عبد الله في دراسته إلى أن الأفراد الذين يتناولوناللبن الزبادي خالي الدسم بانتظام يفقدون أوزاناً أكبر من أولئك الذين يعتمدون على ريجيم السعرات القليلة فقط، حيث أكدت الدراسة التي تم إجراؤها على أكثر من 400 فرد أن من تناولوا الزبادي في إطار نظام غذائي يعتمد على تقليل تناول النشوياتوالسكريات والدهون فقدوا أكثر من 80% من الدهون الموجودة في منطقة البطن، و22% منأوزانهم، و61% من دهون الجسم إجمالياً خلال 12 أسبوعاً، وبهذا يتحقق حلم الكثيرين خاصة من السيدات اللاتي يعانين من تراكم الدهون في منطقةالبطن.

ومن المعروف أن أخطر أنواع زيادة الوزن هي تلك التي يتجمع فيها الدهن في منطقة البطن ليأخذ الجسم شكل التفاحة لأنها تؤثرعلى الشكل الجمالي للنساء بشكل خاص فضلاً عن مخاطر الإصابة بأمراض القلب والسكر، وبالتالي فإن تناول الزبادي الغني بالكالسيوم يساعد على فقد أكثر من بوصة في منطقة الوسط حيث يعتبر الباحثون أن نسبة الكالسيوم في الغذاء هي التي تحفز الجسم لحرقمزيد من الدهون وعدم تكون كميات جديدة منه، في حين أن الغذاء قليل الكالسيوم يزيدمن إنتاج أنزيمات منتجة للدهون .


ومن هنا تنصح الدكتورة لمياء السباعي أستاذ التغذية الباحثات عن الرشاقة بالإكثار من تناول الزبادي خالي الدسم والغني بالكالسيوم والذي يحتوي على 100 سعر حراري فقط لكوب زنة 180 جراما. كما تؤكد الدراسات قدرة الزبادي في تقليل الإصابة بسرطان القولون لقدرته على زيادة نشاط الجهاز المناعي فضلا عن خفض نسبة الكولسترول في الدم، كما تعمل مكونات الزبادي علىمقاومة الالتهابات الطفيلية، وأظهرت دراسات أخرى أن نوعاً من بروتين اللبن الزبادي يستطيع خفض ضغط الدم العالي، حتى أن اليابان أنتجت مركباً علاجياً يحتوي على هذا البروتين أثبت فاعليته في هذا المجال، فضلا عما يمده الزبادي للجسم من فيتامينات ضرورية للحياة كفيتامين ب1، ب2، ب3، ب5، ب6، ب12، فيتامين أ، ك .

http://sphotos.ak.fbcdn.net/hphotos-ak-snc6/hs052.snc6/168222_10150112561626874_235730276873_7473244_6200 971_n.jpg (http://www.libyanyouths.com/vb/t69330.html)

nosa_aic
26 - 12 - 2011, 08:38
كوب من الكاكاو

قآلت درآسة اجريت حديثاً في الولايآت المتحدة ان تنآول كوب من الكاكاو يوميآ يقي من الإصآبة بالأمرآض لما فيه من الموآد المضآدة للأكسدة.


وكانت دراسآت سابقة قد رجحت أن الكاكاو يحتوي على كيمآويآت يمكن أن تقي الشخص من العديد من الأمرآض وتقلل من تأثير الشيخوخة. الا ان الدرآسة الجديدة تؤكد أن الكاكاو غني بالموآد المضآدة للأكسدة أكثر من أي شرآب صحي اخر كالشآي وغيرهآ من المشروبآت.


وكآنت العديد من الدرآسآت قد ألقت الضوء على الفوآئد الصحية للشآي الاخضر مقآبل فوائد الكاكاو. فقد خلصت درآسة صينية إلى أن محتسي الشآي تقل معدلات الإصآبة بالسرطآن لديهم إلى النصف مقآرنة بمن لا يحتسيه.


وقد أجرى الدكتور تشآنج يونج لي ورفاقه بجآمعة كورنيل بنيويورك اختبآرآت لقياس معدلات الموآد المضآدة للأكسدة في الشآي والكآكآو.


وأظهرت نتيجة الاختبآرآت أن كوبآ من الكآكآو يحتوي على ضعف الموآد المضآدة للأكسدة المتوآجدة في الشآي، كمآ تزيد نسبة الموآد المضآدة للأكسدة في الكآكآو ثلاث مرآات عنهآ الشآي الأخضر، وخمس مرآت عن الشآي الأسود.


وعلى الرغم من وجود الكآكآو في العديد من المنتجآت مثل الشيكولاتة، إلا أن البآحثين يقولون إن احتسآءه هو أفضل الطرق للاستفآدة التآمة من فوآئده الصحية. وذلك لأن الشيكولاتة غنية بالدهون، حيث تحتوي الشيكولاتة التي يبلغ حجمهآ 40 جرامآ على 8 جرآمات من الدهون، مقآرنة بـ 0.3 جرام في كوب الكآكآو.

nosa_aic
26 - 12 - 2011, 18:25
الحبة السوداء تمنع تسمم الكبد والكلى


http://img.youm7.com/images/NewsPics/large/s2201014104329.jpg


أفادت دراسة حديثة أجراها مجموعة من الباحثين بالمركز القومى للبحوث، بأن زيت الحبة السوداء يعمل على تثبيط التسمم الكبدى والكلوى، جاء ذلك من خلال دراسة تأثير الحبة السوداء فى تثبيط الضرر الناتج على الكبد والكلى بعد التعرض للتسمم ببروميد البنزين فى فئران التجارب، والذى يتواجد بنسبة كبيرة فى الأطعمة الجاهزة وفى بقايا الملوثات.

فريق البحث المكون من الدكتورة منال عبد العزيز حامد والدكتور ناجى سبع والدكتورة سناء أحمد على، اعتمد التقييم على قياس معايير الأكسدة الحفزية فى الكبد، وتم أيضا تقدير إنزيمات وظائف الكبد، كما تم قياس مؤشرات وظائف الكلى ومؤشرات انتقال الأملاح عبر الخلايا، وكذلك الدهون الفوسفاتية، وتم تحليل الصورة الهيستوباثولوجية للكبد والكلى ودرجة التليف بهما.

توصل الباحثون إلى أن العلاج بزيت حبة البركة يعمل على تحسين مستوى مضادات الأكسدة وإنزيمات وظائف الكبد ووظائف الكلى، كما انخفضت نسبة التليف وحدث تحسن فى تراكيب الكبد والكلى، كما تعمل الحبة السوداء على الإسراع من آلية حماية الكبد والكلى.

الجدير بالذكر أن الحبة السوداء تساعد فى علاج الصداع ونزلات البرد وألم الأسنان، كما أن بذورها مطهرة وطاردة للبلغم وتساعد فى طرد الحصوات من الكلى والمثانة.

nosa_aic
27 - 12 - 2011, 07:53
فقر الدم

اليك الان تعريف مرض فقر الدم بشكل عام
فقرالدم هو: عبارة عن نقص في كريات الدم الحمراء التي تحتوي على مادة الهيموجلوبين الذي يعتبر الناقل المهم للأ كسجين إ لى كافة أنحاء الجسم وهذا النقص يؤدي إلى الشعور بالخمول والتعب . النقص في كريات الدم الحمراء يحدث إ ما بسبب النقص في تكوينها أو الزيادة في تكسرها.
هذه الخلا يا يتم تصنيعها في نخاع العظم الشوكي وتعيش لمدة أربعة أشهر .
لإ نتاج خلايا الدم الحمراء يحتاج الجسم إ لى الحديد و فيتامين ب 12 و حمض الفوليك.
إ ذا حدث نقص في أ حد هذه المواد أو كلها فإ ن المريض يصبح مريضا بفقر الدم .

طرق الوقاية و العلاج


1-تناول الغذاء المنوع والمفيد:

فيجب المحافظة على التغذية الملائمة و الكافية، و الغنية بالسعرات الحرارية و البروتين و الحديد، و خصوصا تناول الخضار الخضراء، و اللحوم الحمراء و الكبد، و من الأطعمة المناسبة أيضا، السمك و المأكولات البحرية و الدجـاج، و البقوليات مثل الفاصوليا، و الفول السوداني.

2-إذا كنتم تخططون تخطط للحمل فأستشيرو الطبيب عن نوعية الغذاء الضرورية التي يجب تناولها أثناء الحمل .

3-تناول الكبد واللحوم الحمراء والبيض والفواكه .

4-أكثر من الأغذية التي تحتوي على كمية وفيرة من فيتامين سي والذي يوجد في الخضروات الطازجة والليمون والبرتقال والبطاطس .

5-أكثر من الأغذية التي تحتوي على حمض الفوليك مثب الفطر والكبد والبقوليات وغيرها .

6-التفاح:

إما بأكله طازجاً بقشوره او شرب العصير الطازج المحضر منه والطريقة ان يشرب كوباً من عصير التفاح الطازج مرة في الصباح واخرى في المساء

7-الفراولة:

فهي غنية بالمعادن والفيتامينات وهي تستخدم في تنقية الدم والجسم من السموم وذلك بتناول ثمار الفراولة الطازجة وغير المفرزنة بمعدل ربع كيلو جرام يومياً.

8-الحلبة:

فهي تحتوي على مركب الدايزوجنين فهي علاوة على انها مقوية ومخفضة للسكر في الدم وجيدة لمشاكل القولون والتشققات الجلدية إلا ان فوائدها عظيمة في فقر الدم والطريقة ان يؤخذ ملء ملعقة من مسحوق الحلبة الناعم وتخلط بالعسل النقي وتؤخذ يومياً مرة قبل الغذاء بربع ساعة واخرى قبل العشاء بربع ساعة.

9-إستعمل هذه الخلطة للعلاج:

تخلط كميات متساوية من الزعتر والنعناع وازهار البابونج ثم يؤخذ ملء ملعقة من المزيج وتغمر في كوب ماء مغلي وتترك لمدة 5الى 10دقائق ثم تصفى وتشرب قبل الغداء وقبل العشاء.
10-الجرجير:

فيعتبر الجرجير من الخضار المفيدة لعلاج فقر الدم حيث يؤخذ ملء ملعقة كبيرة من عصير الجرجير الطازج 2الى 3مرات في اليوم مع الماء او الحليب الطازج، كما ان تناول حزمة كاملة من الجرجير الطازج المغسول جيداً وبالأخص في فصل الشتاء حيث انه هو فصل الجرجير تؤدي نفس الغرض والجرجير جيد لتنقية الدم.

11-الشعير مع اللبن:

حيث يؤخذ حوالي 100الى 150جراماً من دقيق الشعير ويخلط مع نصف لتر من اللبن المخيض "الرائب" ويضاف للخليط ذرات من الملح ثم يحرك جيداً ويوضع على نار هادئة ويترك على النار لمدة عشر دقائق ويحرك بين وقت وآخر وعند الانتهاء يضاف له قشدة او عسل النحل النقي كما يضاف اليه قليل من الزبيب بدون بذر ثم يؤكل مع ملاحظة أن هذه الوصفة لا تعطى للمصابين بمرض السكر.

12-الحلاوة الطحينية:

وهي متميزة لفقر الدم فهي تحتوي على زيت السمسم وعرق الحلاوة والطحينة البيضاء المغذية وهذه الوصفة مقوية ومسمنة ولكن يجب عدم استعمالها من قبل مرضى السكر.

13-الليمون:

يعتبر الليمون من المواد الغنية بفيتامين ج وهو يقوي جهاز المناعة ويؤخذ ملء كوب من عصير الليمون بعد الغداء مباشرة وآخر بعد وجبة العشاء مباشرة.

14-جلوكونات الحديد:

وهذا موجود على هيئة مستحضر يباع لدى محلات الاغذية التكميلية وهوافضل المستحضرات امتصاصاً.

15-الكلوروفيل:

وهو مسحوق اخضر مستخلص من الخضر وهو غني بالحديد وبعض الفيتامينات
الهامة ويوجد منه مستحضر في محلات الاغذية التكميلية
ويستعمل لعلاج فقر الدم

16-الجنسنج البرازيلي:

وهو جذور لنبات الجنسنج ويحتوي على مواد صابونية
وهو مقوٍى جيد ويفيد في حالات فقر الدم ويوجد منه عدة مستحضرات في الصيدليات حيث يوجد منه شراب وكبسولات واقراص والجذور نفسها كما هي.

17-حمض الفوليك:

وهو مستحضر يمنع فقر الدم ويقوي الشهية و يخفض الكوليسترول.

18-زيادة ساعات النوم و معدلات الراحة بما في ذلك النوم أثناء النهار.

19-زيادة معدلات تروية الجسم والإكثار من تناول السوائل المختلفة

20-تجنب القهوة و مركبات الكافيين و الأكلات الدسمة الثقيلة أثناء الليل

21-تجنب النشاطات المرهقة.

nosa_aic
28 - 12 - 2011, 07:06
المشي الرشيق والمنتظم يوميا يخفض الوزن


أكدت دراسة تشيكية حديثة أن أكثر الطرق الصحية والطبيعية التي تساهم في تحسين لياقة الجسم وعمل القلب والعضلات وفي الوقت نفسه تؤدي إلى تخفيض الوزن هو المشى الرشيق و المنتظم يوميا .

http://pms.panet.co.il/online/images/articles/2007/12/23-12-07/walking1.jpg (http://www.libyanyouths.com/vb/t1378.html)


واشارت إلى أن التأثير الايجابي على الجسم يمكن أن يلاحظ بعد أتباع ذلك لثلاثة اشهر . وتنبه الدراسة على أن النتيجة الايجابية تتحقق فقط في حال السير بشكل صحيح مشددة على انه يكفي السير يوميا ما بين 10 ــ 12 الف خطوة يوميا بسرعة 4 كم بالساعة الأمر الذي يعني عمليا ما بين سبعة إلى سبعة ونصف كيلومتر .

وبالنظر لكون الكثير من الناس يشددون على أن ذلك يصعب تحقيقه بالنظر لعدم امتلاك الوقت الكافي فان القائمين على الدراسة يقولون انه يمكن تخفيف ذلك إلى المشى يوميا لفترة 40 ــ 60 دقيقة على أن يتم تكملة ذلك بالتدريب مثلا في المنزل .

وتؤكد الدراسة أن المشى الرشيق و المنتظم لثلاثة اشهر يؤدي إلى تخفيض أخطار الإصابة بأمراض القلب المختلفة ويخفض قيم الشحوم في الدم كما يؤدي إلى تخفيض ضغط الدم ومستوى السكر ويصبح الجسم أكثر مقدرة على مواجهة الأمراض المختلفة ، كما أن الإنسان الذي يعود نفسه علي المشى يمكن له أن يعيش لفترة زمنية أطول لان الأمراض المختلفة يمكن أن تبتعد عن طريقه حتى وقت متأخر من العمر ولا سيما منها المشاكل الصحية المرتبطة بالحركة .

وتنصح الدراسة بالسير بسرعة متوسطة وبان تكون الخطوات انسيابية وبنفس الطول وان لا يكون العمود الفقري في وضع يعاني ولذلك فمن الضروري أن تهبط الرجل في البداية على مؤخرة القدم ثم بالتدريج على أصابع القدم كما أن من الضروري بمكان زج عضلات الأرجل في الحركة أثناء المشى كي لا تعاني الركبة.

وتنصح الدراسة أيضا بعدم نسيان التنفس الصحيح أثناء المشى مشيرة إلى أن الجهاز التنفسي يجب أن يكن في حالة منتصبة وطبيعية وأن لا يكون في وضع تشنجي .

nosa_aic
28 - 12 - 2011, 07:14
التلوث المرورى يزيد من خطر الاصابة بالسكر

أكدت دراسة نشرتها مجلة أتلانتك الامريكية ان تلوث الهواء احد الاسباب التى يمكن ان تؤدى الى مرض السكر مثل التدخين والوزن الزائد.
واشارت الدراسة الى ان الشخص الذى يعيش في منطقة بها تلوث من عوادم السيارات تزيد لديه مخاطر الاصابة بالسكر.
وتتبع الباحثون 52 ألفا من سكان المدن في الدنمارك على مدى عشر سنوات، وعلى مدى فترة البحث أصيب حوالي 2800 مشارك بالسكر، كما قاس الباحثون مستويات ثاني أكسيد النيتروجين، كعلامة للتلوث المرورى حول منازل المشاركين.
وأوضح الباحثون أن عوامل سلوكية أخرى تساعد على سرعة الإصابة بالسكر تأثرا بالتلوث المروري، منها تقدم السن، والوزن والتدخين وتناول الدهون وضغط الدم والكوليسترول، وتناول الكحول .
واضافة الى هذه العوامل وجد الباحثون ايضا ان الذين يعيشون في المناطق الاكثر تلوثا يزيد لديهم خطر الاصابة بمرض السكر، وأن الأكثر استجابة لهذا التلوث هم النساء، حيث كشفت الدراسة أن النساء غير المدخنات اللاتي تعشن في المناطق عالية التلوث يرتفع لديهن خطر الإصابة بالسكر إلى 12% .
وأجرى الدراسة فريق من جمعية السرطان الدنماركية ونشرت في دورية رعاية مرضى البول السكري .

nosa_aic
28 - 12 - 2011, 08:01
السلام عليكم ورحمة الله وبركاته

فوائد السبانخ لمرضى السكري و القلب

http://mas2020.net/up/up/63723763455958.jpg (http://www.libyanyouths.com/vb/t120176.html)


السبانخ من الخضراوات الورقية الغنية بالعناصر المعدنية الضرورية للجسم، كالحديد، والكالسيوم، والمغنيزيوم، والكبريت، إضافة إلى فيتامين ايه . بي . سي ويحتوي السبانخ أيضاً على البيتاكاروتين، الذي يقي من الأورام السرطانية، وأمراض القلب والأوعية الدموية. إذ أثبتت الدراسات أنه يحافظ على الخلايا بصورتها السليمة ويمنع تحولها للخلايا السرطانية وذلك لاحتوائه على نسبة عالية من الحمض الأميني (هيسيتيدين).



http://t3.gstatic.com/images?q=tbn:ANd9GcSiKl9FdQg57JJh8iXFI9NyqwvThqwjO 3YVxdoQz1RmlWnUXxXX&t=1 (http://www.libyanyouths.com/vb/t120176.html)



فوائد عديدة

يعتبر السبانخ مفيدا للحفاظ على صحة وسلامة العين، إذ يمنع التدهور المرتبط بحدوث تلف في الشبكية بسبب الشيخوخة والتقدم بالعمر، ما يؤدي لضعف النظر. وهو يقي من الإمساك لكونها من الخضروات الغنية بالألياف الغذائية الضرورية للجسم. ويعد مفيدا لمرضى القلب والسكري، إذ أوضح الباحثون أن السبانخ من المصادر الجيدة لمعدن المغنيزيوم الذي يلعب دوراً مهماً في العمليات الحيوية التي تقوم بها الخلايا داخل الجسم



http://news.makcdn.com/image3165007_320_235/340X297.jpg (http://www.libyanyouths.com/vb/t120176.html)



كما يساعد في تخفيض ضغط الدم المرتفع، وتعتبر أملاحه من المواد القوية المضادة للتشنجات، كذلك أثبت فاعلية مميزة في تقليل خطر إصابة السيدات الحوامل بحالات التشنج الحملي وتسمم الحوامل بحوالي 58%، وتخفيض خطر الوفيات الناتجة عنها بنحو 45بالمئة.
وقد أظهرت البحوث الحديثة، أن عنصر المغنيزيوم يتمتع بخصائص وقائية قوية ضد مرض السكري، فيقلل خطر الإصابة به من خلال تأثيره على هرمون الأنسولين وزيادة فعاليته في تنظيم مستويات السكر في الدم. ونظراً لخصائصه العلاجية والوقائية يمكن للحامل والمرضع، والطفل، ومن يعاني من فقر الدم، والوهن العام، تناول السبانخ من أجل الاستفادة من قيمته الغذائية.



http://t3.gstatic.com/images?q=tbn:ANd9GcQCqy-b-pSvGLT6JC2a2CKetus3RAZfFFmOCxPeY1H6XzH3unPiQQ&t=1 (http://www.libyanyouths.com/vb/t120176.html)



إرشادات

ينصح كل من يعاني من أمراض الكبد والروماتيزم، والرمال والحصى في المسالك البولية بعدم تناول
السبانخ أو التقليل من الكميات المتناولة منه، لكونه يحتوي على أوكزالات الكالسيوم التي تدخل في تركيب حصى المسالك البولية.
يمكن تناول السبانخ مطبوخاً باللحم أو بغيره. أو بإضافة كمية من السبانخ إلى طبق السلطة اليومي. وبالطبع ينبغي الحرص على تنظيفه بشكل جيد قبل تناوله سواء أكان نيئاً أو مطبوخاً.

اميره اميره
28 - 12 - 2011, 10:21
http://www.betek.info/fwasl/wards/images/8b9877ccac.gif

nosa_aic
28 - 12 - 2011, 19:18
http://www.betek.info/fwasl/wards/images/8b9877ccac.gif




http://sl.glitter-graphics.net/pub/954/954912n828ouknkm.gif

ahmednour
28 - 12 - 2011, 23:44
الشكر كل الشكر اختى الفاضله على هذا المجهود الرائع والمعلومات المفيدة التى افادتنى كثيرا جعله الله فى ميزان حسناتك

nosa_aic
29 - 12 - 2011, 08:34
الشكر كل الشكر اختى الفاضله على هذا المجهود الرائع والمعلومات المفيدة التى افادتنى كثيرا جعله الله فى ميزان حسناتك


الاخ الفاضل الدكتور / رامى توفيق

مرحبا بحضرتك و الشكر لله اخى الفاضل




http://www.iraqnaa.com/ico/image/006.gif
http://sl.glitter-graphics.net/pub/939/939425cdiy8p6frc.gif

nosa_aic
29 - 12 - 2011, 15:31
تقليل مرضى القلب من تناول الملح قد يضر بيهم



http://www4.0zz0.com/2011/12/28/22/199310170.jpg (http://www.libyanyouths.com/vb/t123761.html)

أوضحت دراسة كندية أن امتناع مرضى القلب [/URL] من تناول الملح قد يفاقم حالتهم، وأنه يجب الإكثار من تناوله وفق المعايير المعتدلة.

وقال الأستاذ المساعد في جامعة "ماك ماستر" بمدينة تورنتو الكندية مارتن أودونيل إنه قام بفحص بيانات عائدة لأكثر من 28 ألف شخص يعانون من أمراض القلب، أو من وجود خطر مرتفع للإصابة بها، واكتشف أن نسبة كبيرة منهم كانت في الأساس تستهلك كميات قليلة من الملح.

وشرح أودونيل بالقول إن النسبة المتوسطة لكميات الملح (http://www.libyanyouths.com/vb/t123761.html) المستهلكة لدى الأشخاص الذين قام بمراجعة بياناتهم تصل إلى 4.8 ميغلرام يومياً، واتضح لديه أن خطر الوفاة جراء مشاكل القلب يرتفع بواقع 10% لدى من يستهلكون أكثر من 7 ميلغرام يومياً.

وبينت الدراسة أيضا أن من يتناول ما بين 2 إلى 3 ميلغرام يومياً من الملح يرتفع لديهم خطر الوفاة جراء مشاكل القلب بواقع 7%، وفقا لشبكة "سي ان ان" الأمريكية أمس السبت.

ورجح أودونيل أن جسم الإنسان بحاجة إلى كميات لا بأس بها من الملح، وأن خطر نقص تلك المادة في الجسم قد يعادل خطر وجودها بشكل يفوق المعدلات المطلوبة.

ونصحت دوائر الصحة الأمريكية بتناول ما لا يزيد عن 2.3 ميلغرام من الملح (http://www.libyanyouths.com/vb/t123761.html) يومياً، كما نصحت كبار السن والأطفال والمرضى بعدم تناول أكثر من 1.5 مليغرام يومياً، في حين تشير منظمة الصحة العالمية إلى ضرورة ألا تزيد كميات الملح [URL="http://www.libyanyouths.com/vb/t123761.html"] يومياً عن 2 مليغرام.

nosa_aic
29 - 12 - 2011, 15:39
الوزن المثالى

الرجال

الطول ......................................
متوسط الوزن
155............................................... ..
53 - 58

157 .................................................
55 - 61

160 .................................................
56 - 62

162 .................................................
57 - 63

165 .................................................
58 - 65

167 .................................................
61 - 66

170 .................................................
62 - 69

172 .................................................
64 - 71

175 .................................................
66 - 72

177 .................................................
68 - 75

180 .................................................
70 - 77

183 .................................................
71 - 79

185 .................................................
73 - 81

188 .................................................
76 - 79

190 .................................................
78 - 86

:
:

النساء



الطول .....................................
متوسط الوزن

142 .................................................
43 - 48

145 .................................................
44 - 50

147 .................................................
46 - 51

150 .................................................
47 - 52

152 .................................................
48 - 54

155 .................................................
50 - 55

157 .................................................
51 - 57

160 .................................................
52 - 58

162 .................................................
54 - 61

165 .................................................
56 - 63

167 .................................................
58 - 65

170 .................................................
60 - 66

172 .................................................
62 - 68

175 .................................................
63 - 70

177 ................................................. 65 - 70

nosa_aic
29 - 12 - 2011, 16:00
لا تتناول اقراص الدواء بالشاى او البيبسى



http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs827.snc4/68764_484011051873_235730276873_6834037_3789343_n. jpg (http://www.libyanyouths.com/vb/t66331.html)


تفاعلات الأدوية من المواضيع المهمة لضمان فاعلية الدواء واجتناب الأثار الجانبية له وعدم حدوث انتكاثة للمرضى فمثلاُ ماذا يحدث اذا شربت الشاى بعد تناول الدواء وماذا يحدث اذا تناولت اكثر من دواء فى نفس الوقت هل ستؤثر هذة الأدويةعلى مفعول الأدوية الأخرى بالسلب او بالأيجاب وما تأثير شرب الحليب مثلا على بعض الأدوية مما سبق يتضح لنا خطورةهذا الموضوع وسأتناول بالتفصيل انواع هذة التفاعلات كما يلى



أولا تفاعلات الأدوية مع بعضها drug drug interaction


قد يكون الشخص مصاب بأكثر من مرض فى نفس الوقت ويتناول اكثر من دواء وهذا الأدوية بالتأكيد لها تاثير على بعضهامما ينتج عنه

ا- مضاعفة فاعلية الدواءب - تلاشى او نقص فى فاعلية الدواءج - عدم التأثر

ومثالا على ذلك

1- عندما تتناول السيدات المضاد الحيوى مع حبوب منع الحمل


الكثير من السيدات يتناولون حبوب منع الحمل بأنتظام ولكنها تصدم عندم تعلم انها حامل وتكون فى حيرة من امرهاوكيف حدث ذالك والحقيقة ان هذة السيدة قد تكون اصيبت بنزلة برد وتناولت مضاد حيوى مثل الأموكساسيللين وهذا المضاد يؤدى الى نقص امتصاص منع الحمل من الأمعاء مما ينتج عنة فى ضعف المفعول او تلاشى الفعول ومن ثم الحمل

2- تناول الأسبيرين مع مضادات تجلط الدم مثل الوارفارين او الكومادين

كما نعلم ان الأسبرين يزيد سيولة الدم وتناولة مع مضادات التجلط او التخثر سيزيد من فاعليتها



3- تناول اقراص الفحم مع ادوية القلب


اقراص الفحم مثل دواء ديسفلاتيل وهى تستخدم لعلاج الأنتفاخ لأنها لة القدرة على امتصاص الغازات تؤدى الىنقص فاعلية الأدوية لأنها ستعمل ايضا على امتصاص هذة الأدوية وعدم استفادة الجسم منها مما يؤدى الى انتكاسة مرضية

ثانيا تفاعلات الأدوية مع الغذاء والمشروبات

لوحظ ان هناك بعض الأطعمة قد تزيد او تنقص من فاعلية الأدوية مثل

1- شرب الشاى مع البنادول

فقد لوحظ ان شرب الشاى مع البنادول ان مفعول قد زاد بنسبة 40% لأحتواء الشاى على مادة الكافينلذا فقد انتجت الشركة نوع من البنادول اضافت لة الكافين واطلقت علية بنادول اكسترا


2 - شرب الشاى مع تناول اقراص الحديد

قد يكون هنا شخص مريض بالأنيميا ويستخدم اقراص الحديد كعلاج او قد تكون ايضا سيدة حامل تتناول الحديد كمقوى للدم

ومع شرب الشاى مع اقراص الحديد لوحظ ان مادة التانين التى يحتويها الشاى تقوم بترسيب الحديد وتمنع امتصاصة مما يؤدىالى تلاشى مفعولة

3- شرب الكحوليات مع تناول الأدوية

مما هو معروف ان الكحوليات اعاذانا الله منها تنشط انزيمات الكبد مما يؤدى الى سرعة تكسيرة وتخلص الجسم منةونقص فاعليتة


4- لوحظ ان الحليب بما فية من كالسيوم يتفاعل مع التيتراسيكلين ويرسب مادة صفراء على اسنان الأطفال وئؤدى الى ضعف نمو الأسنان والعظام لذا فأن التتراسيكلين ممنوع فى معالجة الأطفال

ثالثا تأثيرات الأدوية على المرض


1 - عزيزى القارىء لك ان تتخيل ماذا يحدث لشخص مصاب بربو وضيق فى التنفس عندما يتناول دواء يزيد الربو بالتأكيد سينتج عنة اختناق هذا المريض وهذا ما لوحظ عند تناول مرضى الربو لدواء اندرال وهوا دواء يستخدم لتنظيم دقات القلب والأكتئاب والصداع النصفى ان هذا الدواء يسبب ضيق فى الشعب الهوائية مما ينتج عنة زيادة فى اختناق المريض



2- مريض السكر والضغط عند تناول الكورتيزون مثا كيناكورت او سيلستون وغيرهما

فقد يصاب مريض السكر والضغط بالحساسية ويضطر ان يتناول ابرة كرتيزون فيكون لها تأثير سيىء على المريض لأن الكورتيزون بيرفع السكر والضغط

مما سبق يتضح لنا خطورة تفاعلات الأدوية ويجب على الجميع

عدم تناول اى دواء الا تحت اشراف طبي

اخبار الطبيب و الصيدلى بالأمراض المزمنة عندك قبل تناول اى دواء

على السيدات اخبار الطبيب او الصيدلى قبل تناول اى دواء بحالتها اذا كانت حامل او عندها طفل رضيع
تناول الدواء بالماء فقط وليس بالشاى او البيبسى وغيرهما
عدم شرب الشاى بعد الأكل وتناول الأدوية مباشرة

nosa_aic
29 - 12 - 2011, 16:20
لا تلبس النظارة و انت تتحدث بالهاتف الجوال... ولماذا؟

أصبح الهاتف النقال في الآونة الأخيرة إحدى سمات ثورة الاتصالات و المعلومات، حتى من الضروريات التي لا يمكن الاستغناء عنها رغم مخاطره.
غالب تلك المخاطر والتحذيرات تتحدث عن الإشعاعات وتأثيرها على الجسم و خصوصاً الرأس..
لكن العجيب أن يخرج إلينا من يحذر من خطر الهاتف النقال على مستخدمي النظارات الطبية أو الشمسية، فهم أكثر عرضة للخطر من غيرهم.
والسبب أن النظارات يحيط بها إطار خارجي من المعدن يعمل كمنظومة هوائية مع هوائي
الهاتف النقال ويصدر من هذا الإطار مجالات مغناطيسية لها تأثير مباشرعلى شبكية العين،
ويزيد من معدل امتصاصها لتلك الموجات الكهرومغناطيسية، مما يؤثر سلباً على النظر
ويورث أمراض العين المختلفة.
أما الحل فهو بكل بساطة أن تنزع النظارة اثناء المكالمات والتقليل من استخدامه إلا
عند الضرورة أو استخدم السماعة ...

nosa_aic
29 - 12 - 2011, 16:27
آلام الغضروف و علاجه

يعتبر الغضروف الوهم المرعب الذى يصيب الكثير من الناس وجراحة الغضروف هى الوهم الأكثر رعبا، ولكن الجراحة ليست

هى الحل الوحيد فلو علمنا أن الغضروف هو الجزء الذى يثبت كل فقرتين فى العمود الفقرى ببعضها البعض لعلمنا أهميته فى

تثبيت العمود الفقرى.

فهذا الغضروف المظلوم لو تحرك من مكانه وانزلق إلى مكان آخر يحدث ما يسمى بالانزلاق الغضروفى، ويكون هذا بسبب إما

ضعف العضلات الظهرية المغلفة للعمود الفقرى فى منطقة الفقرات القطنية أو العنقية، وإما بسبب حمل الأشياء الثقيلة فى

وجود ضعف هذه العضلات أو زيادة الوزن، فلو تحرك هذا الغضروف وظهر فى الأشعة أنه انزلق بدون شكوى لمريض فإن

هذا المريض فى النهاية سليم ولا يحتاج إلى علاج، أما لو انزلق هذا الغضروف وضغط على الأعصاب فإنها إما أعصاب حسية

تسبب الألم والخدلان والتنميل فى الأقدام أو الذراع وعلاجها يكون بحقن مضادات الالتهاب حول العصب ولا نلجأ إلى الجراحة

وهذا فى 90% من المرضى، أما لو ضغط الغضروف على الأعصاب الحركية فإنه يسبب شللا وضمورا فى العضلات أو عدم

التحكم فى البول وفى هذه الحالة يكون مشرط الجراح هو الحل، فلا نقول وداعاً للجراحة ولكن مهلا وليكن المشرط للمريض

الذى يحتاجه وهم يمثلون حوالى 10% فقط من المرضى.

وحقن مضادات الالتهاب حول العصب هو علاج آمن وهو العلاج الأول فى أوروبا وأمريكا ولا أعلم لماذا لا يعلم المرضى عنه

شيئا ويلجأون إلى الجراحة فى المقام الأول.

ويكون الحل فى حالات الألم والتنميل هو حقن مضادات الالتهاب حول العصب، لأن مضادات الالتهاب مهما أخذت عن طريق

الفم لا تؤتى النتيجة المرجوة بل إنها قد تؤدى إلى عدد من المضاعفات غير المستحبة، مثل التهاب جدار المعدة الداخلى

والقرحة، وهذا الحقن آمن جدا بشرط أن يقوم به استشارى متخصص وأمين ولا يقوم بهذا الحقن إلا استشارى علاج الآلام

وليس أى تخصص آخر، لأن استشارى علاج الآلام يعرف طريقه جيدا وهذا الحقن يمكن تكراره ويحسن المريض بنسبة لا تقل

عن 70% وإن ارتفعت النسبة فى معظم الأحيان إلى درجات عالية قد تصل إلى 100%? ونسبة 70% كافية لأن يقوم

المريض بالحركة العادية وممارسة نشاطه وأعماله الاعتيادية بشكل طبيعى خلال أيام قليلة ولا حاجة للجراحة خاصة وأن

الحقن حول العصب لا يكلف المريض ماديا أو صحيا فى شئ يذكر إذا ما قورن بالعمليات الجراحية

nosa_aic
30 - 12 - 2011, 08:00
الإفراط فى تناول الفيتامينات المتعددة لا يفيد الجسم

http://img.youm7.com/images/NewsPics/large/smal4201030122037.jpg

أظهرت دراسة طبية حديثة، أن الإفراط فى تناول الفيتامينات المتعددة اعتقاداً أنها تؤمن حاجة الجسم من الفيتامينات والمعادن اللازمة هى أمر غير ذى جدوى.

وأوضحت الأبحاث، التى أجراها فريق من الباحثين بجامعة "نانسيه" الفرنسية على أكثر من 8 آلاف متطوع تم تقسيمهم إلى مجموعتين تناول أفراد الأولى مجموعة من الفيتامينات المتعددة فى الوقت الذى تناول فيه أفراد الثانية عقاراً زائفاً ليتم تتبعهم لأكثر من ستة أعوام.

وأشارت المتابعة إلى أن الكثيرين قد ينفقون أموالهم هباء فى شراء كميات كبيرة من الفيتامينات المتعددة اعتقادا منهم بفاعليتها وجودتها فى وقايتهم من الأمراض، إلا أنها عديمة الجدوى، حيث من المحتمل أيضا إصابتهم بأمراض القلب والسرطان وغيرها من الأمراض مثلهم مثل الأشخاص الذين لا يتناولون الفيتامينات المتعددة.

ونبه الباحثون إلى أن الأشخاص الذين اعتادوا على تناول الفيتامينات المتعددة خاصة فيتامين "هـ" ترتفع أيضا بينهم فرص الإصابة بسرطان الجلد أحد أخطر أنواع السرطان، بالإضافة إلى أن السيدات اللاتى ينتظمن فى تناول الفيتامينات المتعددة بصورة منتظمة ترتفع بينهم مخاطر الإصابة بسرطان الثدى بنسبة 20%.

nosa_aic
30 - 12 - 2011, 08:03
الإسراف فى تناول اللحوم الحمراء يزيد خطر الإصابة بسرطان الكلى

http://img.youm7.com/images/NewsPics/large/s10201020112129.jpg

كشفت دراسة أمريكية شملت آلاف البالغين، أن الذين يفرطون فى تناول اللحوم الحمراء قد يزيد لديهم خطر الإصابة ببعض أنواع سرطان الكلى.

وخلص باحثون نشروا دراستهم فى الدورية الأمريكية للتغذية السريرية، إلى أن البالغين فى منتصف العمر الأكثر تناولاً للحوم الحمراء يكونون أكثر عرضة للإصابة بسرطان الكلى بنسبة 19% مقارنة بأولئك الذين تناولوا لحوما أقل.

وربطت الدراسة وفق "العربية.نت" وجود محتوى أكبر من المواد الكيميائية فى اللحوم المشوية بزيادة خطر الإصابة بالمرض.

وقالت الباحثة كارى دانيال التى أشرفت على الدراسة من المعهد الوطنى الأمريكى للسرطان، إن النتائج التى توصلنا إليها تدعم التوصيات الغذائية للوقاية من السرطان التى توصى بها الجمعية الأمريكية للسرطان ومنها الحد من تناول اللحوم الحمراء والمصنعة وإعداد اللحوم بأساليب طهى مثل التحميص والتسخين.

وخلصت دراسات سابقة تبحث العلاقة بين اللحوم الحمراء وسرطان الكلى إلى استنتاجات متباينة لذا استخدمت دانيال وزملاؤها بيانات من دراسة شملت ما يقرب من 500 ألف بالغ أمريكى فى سن 50 عاما أو أكثر لبحث المسألة مجددا.

وجرى مسح العادات الغذائية للمجموعة بما فى ذلك استهلاك اللحوم وأعقب ذلك تعقب أى إصابة جديدة بالسرطان لمدة متوسطها تسع سنوات.

وتناول الرجال محل الدراسة فى المتوسط أوقيتين أو ثلاث أوقيات من 57 إلى 85 غراما من اللحوم الحمراء يوميا مقارنة بتناول النساء أوقية أو أوقيتين. وكان الأشخاص الأكثر استهلاكا للحوم الحمراء حوالى أربع أوقيات 113 جراماً يومياً أكثر عرضة للإصابة بسرطان الكلى بنسبة 19% عن أولئك الذين تناولوا أقل من أوقية واحدة يوميا.

وكان ذلك بعد حساب جوانب أخرى من النظام الغذائى ونمط الحياة قد يكون له أثر على مخاطر الإصابة بالسرطان بما فى ذلك السن والجنس وتناول الفاكهة والخضراوات والتدخين وشرب الكحوليات وظروف طبية أخرى مثل ارتفاع ضغط الدم والبول السكرى.

وكان الارتباط بين تناول اللحوم الحمراء والسرطان أقوى لما يسمى بالسرطان الحليمى لكن لم يكن هناك أى أثر لخلايا سرطانات الكلى الخالصة، والأشخاص الذين يتناولون كميات أكبر من اللحوم المشوية جيدة الطهى وبالتالى تتعرض بشدة للمواد الكيميائية المسببة للسرطان التى تنتج عن عملية الطهى أكثر عرضة للإصابة بسرطان الكلى مقارنة بأولئك الذين لا يطهون اللحوم بهذه الطريقة.

ولا تثبت الدراسة أن تناول اللحوم الحمراء أو طهيها بطريقة معينة يسبب سرطان الكلى، وقال محمد الفرماوى خبير أوبئة من مركز العلوم الصحية فى فورت وورث بجامعة نورث تكساس إن بعض الذين يتناولون الكثير من اللحوم الحمراء لا يتعرضون للإصابة بسرطان الكلى بينما الذين نادراً ما يتناولون اللحوم الحمراء يصابون بالمرض.

nosa_aic
30 - 12 - 2011, 08:21
خبراء تغذية يقدمون أطعمة تقليل مستويات التوتر


حدد خبراء التغذية قائمة بأطعمة تمنح الفيتامينات الأساسية وتحسن المزاج ,‏ وهى تحتوي علي مواد طبيعية تخفف من مستويات التوتر والإجهاد في الجسم بشكل طبيعي‏,‏ وهي كما يلي‏:‏

البرتقال:

الغنى بفيتامين ب يساعد علي تخفيض الإجهاد وإعادة ضغط الدم وهرمون الكورتيزول إلي المستويات الطبيعية بعد حالة الارهاق, الى جانب تحسين جهاز المناعة.

البطاطا:

وتعمل على تخفيف التوتر, لأنها تشبع رغبتنا بالنشويات والسكريات وتحتوي علي البيتا كاروتين وفيتامينات أخري, وتساعد الألياف علي معالجة الكربوهيدرات بأسلوب بطيء وثابت وبالتالي تقلل من المزاجية.

المشمش المجفف:

لأنه غني بالماغنسيوم, الذي يقلل من مستويات الإجهاد ويرخي العضلات بشكل طبيعي أيضا

اللوز و الفستق و الجوز:

اللوز غني بفيتامينb,e, الذي يساعد علي رفع نظام المناعة, بينما يساعد الجوز والفستق علي خفض ضغط الدم.

لحم الديك الرومى:

لاحتوائه علي أحماض أمينية تعمل على إطلاق هرمون اسيروتينين,يبعث علي الارتياح.
السبانخ: أي نقص في الماغنسيوم يمكن أن يسبب الصداع الذي قد يؤدي الي داء الشقيقة الصداع والشعور بالإعياء, ويجب تناول كوب من السبانخ للحصول علي40% من حاجاتك اليومية من الماغنسيوم.

السلمون:

الحميات أو الأنظمة الغذائية الغنية بالأوميجا-3 تحمي من مرض القلب, ووجدت دراسة حديثة أن الأوميجا-3 يحافظ علي مستويات هورمونات الإجهاد والأدرينالين من بلوغ الذروة.

الافوكادو:

تساعد الدهون غير المشبعة والبوتاسيوم الموجودة في الأفوكادو علي خفض ضغط الدم. وتعد أحد أفضل الطرق لخفض ضغط الدم.( الأفوكادو يحتوي علي بوتاسيوم أكثر من الموز)

الخضراوات الخضراء:

القرنبيط, اللفت, والخضراوات الورقية مصادر قوة من الفيتامينات التي تساعد علي إعادة الطاقة والقوة لأجسامنا في أوقات الإجهاد.

nosa_aic
30 - 12 - 2011, 12:47
تحذير لمن ينامون نهارا و يستيقظون ليلا


كثير من الناس يكون برنامجهم اليومي
النوم بالنهار!!والإستيقاظ باليل!!هناك من تفرض علهم طبيعة عملهم هذا الوضع!!وهناك من يحبون هذه الطريقه في


الحياة!!ولكنهم تناسوا شيئآ هامآ يبدا بقوله تعالى((وجعلنا الليل لباسا وجعلنا النهار معاشا))فالله سبحانه وتعالى ,, وضع لنا نهجآ في الحياة إذا خالفناه يبدأ الخلل؟؟


ولقد ثبت علميآ بأنه


((توجد في الدماغ خلية صغيرة لاتنغلق إلا عند الذين ينامون ليلآ))ستتساألون كيف؟؟


سأجيبكم:في الدماغ البشري سبحان الخالق ((خلية صغيره))مسؤله عن مركز الإدراك واليقظه0


هذه الخليه عندما ننام في الليل ونطفي الأنوار


الانوار تستشعر الظلام فتنغلق تلقائيآ,,ويشعر المرء بالنوم العميق والراحه


لتوقف مركز اليقظه لديه


ولكن عندما ننام نهارا حتى في حالة إغلاق الستائر والإظلام التام فإن
هذه الخلية لاتنغلق أبدآ


((بل تبقى مفتوحه ويبقى مركزاليقظه بحالة نشطه)) فنصحو من نوم النهار
نشعر بالقلق وعدم الراحه,,

كذلك يوجد((الرفيق الودي والرفيق الاودي))ماهما؟؟


إنهم رفقاءأوجدهم الرحمن للإنسان كيف ذلك؟؟


سأخبركم::في النهار ينشط الرفيق الودي فيشعر الواحد بالنشاط والحيويه وتختفي أعراض التعب والإرهاق وآلام
المفاصل لمن يشكو منها والحرارة والحمى في حالة المرض


أما في الليل؟؟


فينشط الرفيق ((الاودي))وهنا تبدإ الاوجاع تغزو الجسد فتشتد ألم المفاصل,,وترتفع درجة الحراره والحمى ,,وتشتد وطأة الإنفلونزا


أما لوإتبع الإنسان توجيهات الخالق ونام في الليل


فلن ينشط الرفيق الاودي وسيشعر بالراحة والنشاط صباحآ برفقة الرفيق ((الودي))

nosa_aic
30 - 12 - 2011, 20:35
جين يكشف خلل دقات القلب (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/142579-%D8%AC%D9%8A%D9%86-%D9%8A%D9%83%D8%B4%D9%81-%D8%AE%D9%84%D9%84-%D8%AF%D9%82%D8%A7%D8%AA-%D8%A7%D9%84%D9%82%D9%84%D8%A8)



http://www.alwafd.org/images/news/11526965240r3uut6j.jpg





كشفت دراسة جديدة أن تغييراً فى وظيفة جين معيّن قد يتدخّل فى نمو نظام التوصيل العصبى فى القلب، وبالتالى يتسبّب بمشكلة عدم انتظام دقاته التى قد تودى للموت.
وذكر موقع "ساينس ديلي" الأميركي أن الآلية الجينية والبيولوجية التي تضبط عملية تكوين وعمل نظام التوصيل العصبي في القلب المسؤول عن تنظيم الدقات،
لم تعرف جيداً بعد لكن بحثاً جديداً أجراه الباحثون في جامعة "يوتا" على الفئران وجد أن التغيير الوظيفي لجين ' Tbx3 ' يتدخل في نمو الجهاز ويتسبب بعدم انتظام دقات القلب.
وتبيّن أن نظام التوصيل العصبي في القلب يتأثر كثيراً بمعدلات الجين المذكور، فأجنة الفئران التي لديها معدلات تقل عن المعدل الطبيعي عانت من عدم انتظام في دقات القلب وقضت قبل الولادة، ومع زيادة المعدلات بقيت الفئران حيّة.
وقالت الباحثة المسؤولة عن الدراسة آن ام مون، أن نظام التوصيل العصبي في القلب حساس جداً تجاه Tbx3"، وأضافت أن هذا الجين ضروري لنمو ونضج هذا النظام واستمرار عمله بشكل جيد

hanan desoky
30 - 12 - 2011, 20:39
المضادات الحيوية قد تساعد على الوقاية من فقدان البصر




http://www.elfagr.org/Portal_News/Big/175920111230862.jpg


كشفت دراسة طبية أن المضاد الحيوي "أزيثرومايسين" المستخدم في علاج أخطار العدوى الميكروبية والبكتيرية المسببة لفقدان البصر له نفس الفاعلية والنتائج عند استخدامه لنحو ستة أشهر وليس عام كامل. وأوضح الباحثون بجامعة"سان فرانسيسكو"الأمريكية بأن الأبحاث تسعى في الوقت الحالي للاستخلاص أقصى استفادة من المضاد الحيوي في علاج أكبر عدد من المرضى وذلك بسبب ارتفاع تكلفته. يأتي ذلك في الوقت الذي تشير فيه الإحصاءات عن إصابة أكثر من 41 مليون أمريكي بالرمد الحبيبي والذي يتسبب في فقدان البصر بين ما يقرب من ثمانية ملايين شخص حول العالم بسبب نقص العلاج الفعال والمناسب للوقاية من هذه الأسباب المرضية. كانت الأبحاث قد أجريت على عينة عشوائية من المرضى في أثيوبيا يتم علاجهم من الرمد الحبيبي بواسطة المضاد الحيوي "أزيثرومايسين" حيث يعد المرض الأكثر انتشارا بها ليتم تتبعهم لنحو 12شهرا. وأشارت المتابعة تراجع معدلات الإصابة بالمرض وحالات فقدان البصر إلى 23 في المائة في مقابل 40 في المائة قبل الاستعانة بالمضاد الحيوى.

nosa_aic
30 - 12 - 2011, 20:49
علماء امريكيون يطورون جهازا يعيد الامل لفاقدى البصر

http://www4.0zz0.com/2011/12/28/22/851681512.jpg (http://www.libyanyouths.com/vb/t123756.html)

في قفزة علمية رائدة، قد تعيد النور لأعين الكثيرين من فاقدي البصر، نجح فريق من العلماء الأمريكيين في تطوير جهاز دقيق يحاكي وظيفة قرنية العين، سيمكن في غضون السنوات العشر المقبلة الكثيرين من المكفوفين من استعادة أبصارهم، خصوصًا أولئك الذين فقدوا البصر متأثرين بإصابتهم بأمراض.

وأوضحت "شيلا نيربرج" أستاذة المخ والأعصاب بجامعة "سانت ديجو" الأمريكية بحسب وكالة "أنباء الشرق الأوسط" أن الجهاز الدقيق المطور يحاكي وظيفة الدورة الأمامية لقرنية العين، التي قد تتعرض للتلف خاصة عند الإصابة بأمراض، لتتمكن من التقاط صور وإرسالها للمخ لترجمتها.

وقد استطاع الجهاز الدقيق من خلال التجارب الأولية، التي أجريت على فئران التجارب حتى الآن، من تمكينهم من استعادة أبصارهم في الوقت الذى يأمل فيه العلماء إمكانية تجربة الجهاز الجديد على الإنسان في غضون العشر سنوات المقبلة.

كانت الأبحاث قد عكفت على دراسة آلية استخدام المخ للصور المنقولة له ونشاط الدائرة الكهربائية لتمكين المريض من استعادة الرؤية.

nosa_aic
30 - 12 - 2011, 21:12
نوبة الفواق (الزغطه)
.................................

الزغطه كناية عن تقلصات متكررة ومفاجئة وحادة وغير إرادية للحجاب الحاجز يدل عليها صوت مميز ناتج عن الانغلاق المفاجىء للأوتار الصوتية. وتتأتّى الحازوقة من فشل التوافق بين حركة الغطاء، الذي يفصل ممرات الهواء خلال عملية الابتلاع، والحجاز الحاجز. كما أن العصب الحجابي الذي يصل الحجاب الحاجز بالدماغ له علاقة أيضاً. الحازوقة عارض وليست مرضاً، النوبات القصيرة لا تشير غالباً لوجود مرض. لكن عندما تستمر الحازوقة أكثر من ثماني ساعات فإنها قد تكون دلالة على مرض خطير ومن الضروري استشارة الطبيب..


سبب النوبات القصيرة في الغالب غير معروف، أما النوبات الطويلة فقد تكون نتيجة لأسباب عديدة تشمل الاضطرابات العاطفية، واستخدام بعض العقاقير (الموصوفة أو غير الموصوفة من قبل طبيب) والادمان على الكحول، وابتلاع مواد مهيّجة. وترتبط الفواق بعدد من العلل في المعدة أو المريء أو المعي الغليظ أو المثانة أو البنكرياس، أو الرئة، أو الكبد. ويتبين من خلال توجه الماكروبيوتيك أن السبب الأساسي للنوبات القصيرة من الحازوقة هو تناول الكثير من غذاء ين كالمأكولات التي تضاف إليها التوابل الحارة، والافراط في تناول كل أصناف الطعام، و/أو الابتلاع بنحو غير سليم بسبب الأكل أو الشرب بسرعة. هذه العوامل كلها تساهم في إحداث نوبات طويلة من الفواق .

لماذا نصاب بالفواق ( الحازوقة ) ؟

لابد أنك قد سمعت ببعض العالاجات للفواق ، و ربما وجدت بعضها ناجحاً و بعضها الآخر غير ناجح ، بعضها يقول عليك بصدمة أو رعب فيتخلص المصاب من الفواق ( الحازوقة ) ، أو عليك بشي بارد يوضع في أسفل ظهر المصاب .

ولكن ما هو الفواق ؟؟

عندما تأكل أحياناً طعاماُ ساخناً تتهيج الطرق في داخل الجسم ، و ربما تكونت غازات في المعدة ضغطت على عضلة الحجاب الحاجز العضز الذي يفصل الصدر عن المعدة و يمسك الهواء الداخل إلى الرئتين و نحن نشعر و كأننا نضخ الهواء الداخل أثناء الحازوقة لذلك فالحازوقة هى محاولة للتخلص من الطعام الساخن أو الغاز المتشكل



كيف تتخلص من الفواق؟

تنشأ الفواق عادة من الإفراط في الطعام أو السرعة في الأكل أو من أكل الطعام الكثير البرودة أو الحرارة على السواء، وايضا من جراء تناول الاطعمة الحاره!! كما يتسبب فيه التأثر النفسي الشديد، ويمكن أن يكون علامة على اعتلال في المعدة إذا استمر لأكثر من يومين متواصلين مما يستدعي استشارة الطبيب.

والعلاج في الوضع الطبيعي يكون عادة بالطرق التالية:

أخذ ملعقة من الخل أو عصير الليمون.
مص قطعة من الثلج.
الغرغرة بماء ساخن.
ضم الفخذين إلى البطن لإعادة الحجاب الحاجز إلى وضعه الطبيعي.
إخراج اللسان من الفم بأقصى ما يمكن ومحاولة التنفس على هذه الحال لبضع دقائق مع أنفاس عميقة وطويلة
كتم النفس وعد الى 10 ثوان .


(http://www.libyanyouths.com/vb/t70613.html)

ahmednour
30 - 12 - 2011, 23:27
السلام عليكم ورحمة الله وبركاته
الى الاخت الفاضلة الاستاذة ايناس
تحية طيبة مباركه اليكى والى الاسرة جميعا
بداية مجهود رائع ومعلومات مفيدة اثابك الله عليها
ورجاء التحدث عن موضوغ ارتفاع ضغط الدم من حيث العلاج والاطعمة الممنوعه ولكى جزيل الشكر
رامى توفيق

nosa_aic
31 - 12 - 2011, 03:41
السلام عليكم ورحمة الله وبركاته
الى الاخت الفاضلة الاستاذة ايناس
تحية طيبة مباركه اليكى والى الاسرة جميعا
بداية مجهود رائع ومعلومات مفيدة اثابك الله عليها
ورجاء التحدث عن موضوغ ارتفاع ضغط الدم من حيث العلاج والاطعمة الممنوعه ولكى جزيل الشكر
رامى توفيق

و عليكم السلام و رحمة الله و بركاته

مرحبا بحضرتك اخى الفاضل

مع تمنياتى بالشفاء ان شاء الله


ضغط الــــــــــــــدم Blood pressure


عبارة عن قوة ضخ القلب للدم و تحريكه عبر الأوعية الدموية


http://bigteaparty.com/blog/wp-content/uploads/EF_articles/blood_pressure_2.jpg


ينقسم ضغط الدم الى قسمين :

1- الضغط الانقباضي :-

فهو الضغط الموجود على جدران الشرايين لحظة انقباض القلب خلال عملية ضخ الدم الى خارجه وهو دائما الرقم "120" ..

2- الضغط الانبساطي :-

فهو الضغط الموجود على جدران الشرايين اثناء انبساط القلب للسماح بدخول الدم اليه وهو دائما الرقم الاقل "80" ، وغالبا ما تلعب الفئة العمرية دورا مهما في تحديد الضغط الطبيعي ..

غذاء و تعليمات لمرضى ارتفاع ضغط الدم

* ما هو ضغط الدم المرتفع؟

- يشير مقياس ضغط الدم الي مقدار الضغط الذي يبذله الدم علي جدران الشرايين التي تقوم بنقله من القلب الي سائر اجزاء الجسم.


وفي بعض الحالات، لايستطيع الدم ان يمر يسهولة من خلال الشرايين نتيجة ضيقها واصابتها بالتصلب، وفي هذه الحالات سيرتفع الضغط حتي يضمن استمرارية مرور الدم من خلال هذه الشرايين المصابة، وهذا هو ما يسمي بمرض "ضغط الدم المرتفع".

* ان ضغط الدم متغير فهو يتغير وقتياً مع:

ا. الانفعال.
ب. النوم.
ج. الاكل.
د. وقت القياس خلال اليوم.
ه. المجهود الجسماني.
و. كمية الملح في الطعام.
ز. تعاطي بعض الادوية.

* حقائق علمية عن مرض "ضغط الدم المرتفع":



1.ضغط الدم المرتفع مرض شائع ولكنه في نفس الوقت مرض خطير للغاية- يطلق عليه اسم "القاتل الصامت" لان معظم المصابين به لايشعرون باية اعراض، بينما اذا لم يعالج هذا المرض وظل ضغط الدم مرتفعاً فسيؤدي هذا الي الاصابة بالازمات القلبية و السكتة الدماغية وامراض الكلي وغيرها من الامراض الناتجة عن ضمور الشرايين بالجسم.

2. لهذا يعتبر علاج ضغط الدم المرتفع وابقاء ضغط الدم مستقراً علي معدلاته الطبيعية امراً هاماً وحيوياً لمنع حدوث هذه المضاعفات الخطيرة.

3. ضغط الدم المرتفع ليس له سبب معروف في اغلبية المرضي (حوالي 90 % من المرضي).

4. تلعب العوامل الوراثية واسلوب الحياة مثل زيادة الملح في الطعام دوراً هاماً في حدوث ضغط الدم المرتفع.

5. يعتبر ضغط الدم المرتفع احد عوامل الخطورة الهامة التي تزيد من نسبة الاصابة بامراض الشرايين التاجية المغذية لعضلة القلب وكثيراً ما يكون ضغط الدم المرتفع مصاحباً بقصور الشرايين التاجية سواء كان ظاهراً ام خفياً- وفي الحالة الاخيرة كثيراً ما يكون اول صورة لمعاناة هذا المريض هي الاصابة باحتشاء عضلة القلب او حدوث السكتة القلبية.

6. من اجل ضمان نجاح علاج ضغط الدم المرتفع، يجب ايضا علاج اي امراض مصاحبة له والسالف ذكرها فمرض السكر وارتفاع نسبة الكوليسترول في الدم، كل منهما يساعد علي ارتفاع ضغط الدم.

7. اكثر من 99 % من حالات ارتفاع ضغط الدم لايمكن شفاؤها ولكن يمكن بالعلاج المستمر السيطرة علي ارتفاع ضغط الدم، بمعني اعادته لصورته الطبيعية.

8. في اغلب الاحيان يستمر

ضغط الدم المرتفع مدي الحياة، ولايوجد شفاء كامل من هذا المرض فالسيطرة علي ضغط الدم بالعلاج لاتعني الشفاء الكامل منه- لذا يحتاج المريض دائماً الي متابعة علاجية مستمرة.

9. ان ارتفاع ضغط الدم ليس نتيجة للعصبية او التوتر ولذلك فانه يستدعي العلاج بادوية خاصة وليس مجرد المهدئات.



10. ضغط الدم المرتفع ليس له اعراض في معظم الحالات، فالصداع، احمرار الوجه، الدوار، الدوخة، وطنين الاذن والاغماء كلها اعراض تحدث بنسبة متقاربة في مرضي ضغط الدم المرتفع وغير المرضي علي حد سواء ولذلك يجب الا يعتمد الشخص علي هذه الاعراض او مايشعر به لكي يعرف مستوي ضغط دمه- والطريقة الوحيدة لمعرفة ضغط الدم هي قياسه بواسطة الجهاز المعد لذلك. وفي حالة الحاجة لقياس الضغط بصفة متكررة، يمكن قياسه بجهاز القياس المتواصل لضغط الدم لمدة 24 ساعة.

* ماذا يحدث اذا ترك ضغط الدم المرتفع بدون علاج؟

ان ارتفاع ضغط الدم يقوم باتلاف شرايينك او شعورك بهذا. وكلما طالت مدة ارتفاع ضغط الدم، كلما زادت نسبة اصابة الشرايين بهذا التلف ويتسبب هذا في اتلاف القلب والكلي والمخ والاوعية الدموية وكلها مضاعفات خطيرة للغاية.
والجدير بالذكر ان الشخص الذي يعاني من ضغط الدم المرتفع يكون اكثر عرضة للاصابة بالازمات القلبية خمسة اضعاف الشخص الطبيعي.
لذا فان علاج ضغط الدم المرتفع يمنع حدوث المضاعفات ويقلل من احتمالات الوفاة المبكرة.

* تعديل اسلوب الحياة وعلاج ارتفاع ضغط الدم:

- ان تعديل اسلوب الحياة بمعني:

ا. الحد من تناول الملح في الطعام.
ب. انقاص الوزن الزائد.
ج. ممارسة الرياضة بانتظام.
د. الاقلاع عن التدخين والعادات الصحية السيئة في الاكل.
ه. الامتناع عن الكحوليات.

هي جزء هام في علاج

ضغط الدم المرتفع، وقد تؤدي في بعض الاحيان الي الاقلال من جرعات الدواء التي يحتاجها المريض للسيطرة علي ارتفاع ضغط الدم.

* نصائح وارشادات هامة يجب علي المريض اتباعها:

1. يجب الا يزيد ضغطك عن 89 / 139 مم زئبق في اي حال من الاحوال. اما اذا كنت تعاني من مرض السكر فيجب الا يزيد ضغطك عن 84 / 129 مم زئبق وفي حالات وجود زلال في البول بكميات كبيرة نتيجة مضاعفات مرض السكر يجب الا يزيد ضغطك عن 74 / 124 مم زئبق.

2. لا تاخذ نصيحة من شخص غير مؤهل او ليس مختصاً.

3. علاقتك مع طبيبك:

- يجب ان تشارك طبيبك وتساعده علي العناية بك وعلاجك.
- في بداية الامر سيكون الامر صعباً بعض الشيء عندما تغير من عاداتك اليومية لادخال البرنامج العلاجي.
- سيقوم الطبيب بالاستفادة من زيارتك لكي يتابع تطور حالتك وللتاكد من ان قلبك يعمل بطريقة فعالة.

* نظام الغذاء:

1- الاقلال من ملح الصوديوم في نظامك الغذائي.

- لذا يجب عليك مراعاة الاتي:

- الاقلال من استخدام ملح الطعام.
- الاقلال من استخدام الاغذية المحفوظة (لاحتوائها علي نسب عالية من الصوديوم كمادة حافظة).
- الابتعاد عن الوجبات الخفيفة كثيرة الملح مثل الشيبسي والبسكويت المملح والمكسرات المملحة والبسطرمة.
- تجنب تناول الوجبات السريعة "Fast Foods" لان كثيراً منها يحتوي علي نسبة عالية من الصوديوم.
- تجنب اية مصادر للملح مثل الجبن الرومي والزيتون والمخلل والاسماك المحفوظة.
- قراءة الورقة الملصوقة بالاطعمة المختلفة الموجودة بالاسواق للتاكد من نسبة الصوديوم فيها.
- الاقلال من السكر والحلويات لان ذلك يؤدي الي زيادة الوزن.
- الكربوهيدرات يسمح بتناولها بحرية خاصة الكربوهيدرات سهلة الهضم.
- الامتناع عن الاطعمة الغنية بالكوليسترول مثل: اللحم الاحمر - اللحوم السمينة مثل الضان، والمخ والكبدة والكلاوي والسجق والهامبرجر - صفار البيض - البط والاوز والحمام وجلد الطيور - المكرونة المجهزة بالبيض او اللبن او المواد الدسمة الاخري كالباشمل - ال**د والسمن والقشدة والالبان الدسمة والآيس كريم والجبن الدسم - الجمبري والاستاكوزا والاسماك عالية الدهون مثل الثعابين والقراميط.
- الاكثار من تناول زيوت الاسماك متعددة التشبع " Polyunsaturated Fish Oil" او التعود علي تناول عدد ثلاث وجبات او اكثر من الاسماك بانتظام كل اسبوع. استخدام زيت الذرة او زيت عباد الشمس او زيت الزيتون في الطعام والامتناع عن المسبكات والدهون والاكلات الدسمة والمكسرات.

2- الاكثار من تناول الاطعمة الغنية بالالياف مثل الخضراوات والفاكهة الطازجة.
3- الامتناع عن المشروبات الغازية والمشروبات ذات السكر العالي.
4- الاقلال من الشاي والكاكاو والقهوة والنسكافيه - ويمكن تناول النوعيات الخالية من الكافيين.
5- الامتناع عن المشروبات الكحولية بمختلف انواعها فالكحول يساعد علي ارتفاع ضغط الدم.
6- يلزم اعطاء وجبة تحتوي علي 50 جم من البروتين للمحافظة علي التغذية المناسبة، وفي الحالات الشديدة من ارتفاع الضغط يجب تقليل كمية البروتينات الي 20 جم يومياً كاجراء مؤقت.
7- ليس من الضروري الحد من تناول السوائل طالما كان تدفق البول طبيعياً.

* التدخين:

- يجب الامتناع عن التدخين بمختلف انواعه:
1. اذا كنت مدخنا فيجب ان تقلع فوراً عن التدخين.
2. التدخين مرتبط ارتباط مباشر بحدوث ازمات القلب والسكتة الدماغية.
3. التدخين يحد من كمية الاكسجين في

الدم ويتسبب ايضاً في تقلص الاوعية الدموية مما يقلل من كمية الدم التي تصل الي عضلة القلب.
4. التدخين يضر بالرئتين.

* زيادة الوزن - السمنة:

1. مشاكل السمنة تتلخص في الآتي:
- السمنة تساعد علي ارتفاع ضغط الدم كما انها تجعل القلب يعمل بصورة اشد.
- السمنة تساعد علي ارتفاع نسبة الكوليسترول في الدم.
- السمنة تساعد علي حدوث مرض السكر.
2. يجب الانقاص من وزن الجسم الي الوزن الطبيعي اذا ماكان المريض بديناً، وذلك باتباع النظام الغذائي الخاص بالسمنة مع مراعاة احتياجات الجسم اليومية من العناصر الغذائية الهامة.
- قلل من نسبة الدهون في نظام غذائك.
- اكثر من الخضراوات والفواكه الطازجة.
- قم بممارسة التمرينات الرياضية حسب ارشادات الطبيب.
- قم بمتابعة وزنك باستمرار.

* ممارسة التمرينات الرياضية:

1. ان القلب عبارة عن عضلة فهي تحتاج الي تمرينات منتظمة لتجعلها قوية وتعمل بكفاءة.
2. تؤثر التمرينات الرياضية بصورة ايجابية علي معدلات الكوليسترول بالدم.
3. تساعد التمرينات الرياضية علي اقلال الوزن وعلاج السمنة.
4. ان التمرينات الرياضية تساعد علي خفض

ضغط الدم ولكن لن تكون هذه التمرينات مجدية الا اذا كانت تمارس بصورة منتظمة.
5. مارس التمرينات الرياضية حوالي نصف ساعة او اكثر في اليوم لمدة ثلاثة ايام علي الاقل اسبوعياً حتي تساعد علي خفض ضغط الدم ومعدلات الكوليسترول في الدم.
6. ان افضل رياضة للقلب هي المشي بانتظام يوميا لمدة ساعة علي الاقل في جو مناسب.
7. يجب تجنب الرياضات العنيفة خاصة رفع الاثقال.
8. استشر طبيبك عن نوعية وحجم التمرينات الصحية لك.

* الدواء:

1- ان اغلب المرضي المصابون بضغط

الدم المرتفع يكونون في حاجة لاخذ دواء بصفة مستمرة.
2- الدواء جزء ضروري من العلاج، لذا يجب اخذه كما وصفه لك الطبيب المعالج، واذا لم تقم بذلك فانك تعرض صحتك للخطر.
3- يجب عليك الاستمرار في اخذ الدواء الخاص بعلاج ضغط الدم المرتفع حتي وان كنت تشعر انك معافي وحتي لو كان ضغط دمك في المعدل الطبيعي.
4- اذا توقفت عن تعاطي علاج ارتفاع ضغط الدم فان ضغط الدم سوف يرتفع فجاة مما يؤدي الي مضاعفات خطيرة.
5- لا تتوقف عن اخذ حبوب علاج ضغط الدم المرتفع او تغير من طريقة العلاج او تاخذ دواء آخر بدون استشارة طبيبك، كما يجب ملاحظة ان الادوية التي تستعمل في علاج الروماتيزم وآلام المفاصل و آلام العضلات والبرد والسعال والربو الشعبي يمكن ان تحتوي علي كيماويات ترفع ضغط الدم. واعلم جيداً ان بعض الادوية مثل مضادات الحموضة تحتوي علي نسبة عالية من الصوديوم وتؤدي الي ارتفاع ضغط الدم.
6- من المهم ان تحتفظ بقائمة تضم جميع الادوية الموصوفة لك مع جرعاتها المحددة.
7- تجنب تناول اي ادوية بدون استشارة الطبيب المعالج.
8- يجب ان تعلم الآتي بخصوص الدواء:
- وقت اخذ الدواء.
- جرعة الدواء وكم مرة تاخذه يومياً.
- الآثارالجانبية المتوقعة.
- ماذا تفعل اذا حدثت هذه الآثار الجانبية.

* دور العائلة:

1- يجب ان تعرف عائلتك انك تعاني من

ضغط الدم المرتفعوذلك لان هذا المرض قد يصاب به فرد آخر من العائلة نتيجة للعوامل الوراثية ولذلك يجب علي كل فرد في العائلة بلغ من العمر سن العشرين او اكثر، ان يقوم بمتابعة ضغط الدم.
2- سوف تساعدك العائلة علي اتباع تعليمات طبيبك المعالج.
3- سوف يذكرك افراد العائلة بمواعيد الدواء.
4- سوف يستفيد افراد العائلة اذا قاموا باتباع النظام الغذائي الموصوف لك.

* الاسترخاء والراحة النفسية من العوامل الهامة جداً في علاج ضغط الدم المرتفع:
مارس اي هواية ممتعة لمدة 20 - 30 دقيقة يوميا مثل: الرسم - سماع الموسيقي - العناية بالزرع والحديقة بالمنزل - صيد السمك - القراءة - فكل هذا يساعد علي تقليل التوتر الذهني والنفسي.

* تذكر الآتي:


1-ان ضغط الدم المرتفع يعتبر مشكلة فقط اذا ترك بدون علاج فلا تنزعج من اصابتك بهذا المرض فهو يمكن علاجه وهو لا يعوقك او يؤثر في طبيعة حياتك اليومية او نوع العمل الذي تؤديه.


2- يجب ان يصبح العلاج جزء من روتين يومك.
3- حتي اذا كنت تشعر انك معافي، يجب عليك:
- مراجعة طبيبك بصفة دورية.
- اتباع تعليمات طبيبك المعالج.
- الالتزام بالنظام الغذائي وبرنامج التمرينات الرياضبة الموصوفين لك.
- الاقلاع عن التدخين.
- اخذ الدواء الموصوف لك حسب ارشادات طبيبك المعالج.

* النظام الغذائي لمرضى ارتفاع ضغط الدم الدم:

ا- يجب تجنب الاطعمة الآتية:

1- اللحوم والاسماك والدجاج والبيض.
2- حساء (شوربة) اللحوم.
3- الفجل والبنجر والجزر والسبانخ.
4- الفطائر الحلوة.
5- التين وال**يب المجففان.
6- ماء جوز الهند.
7- التوابل والمخللات.
8- الخبز المحتوي علي الملح.
9- ملح الطعام.
10- الاطعمة المعلبة بانواعها الا اذا كانت خالية من الملح.

ب- يسمح بتناول الاطعمة الآتية:

1- الخبز والتوست (بدون ملح).
2- البليلة والكورن فليكس.
3- الارز المطهي.
4- العدس والفول والبقوليات الاخري.
5- ملعقتي( ملعقة المائدة) من اللبن او منتجاته تضافان الي الشاي او القهوة.
6- حساء (شوربة) الخضروات (فيما عدا الفجل والبنجر والجزر).
7- الخضروات المطهية (فيما عدا السبانخ و الجزر).
8- البطاطس والبطاطا.
9- دهون وزيوت الطهي او ال**د مع مراعاة ان يكون ال**د خاليا من الملح (يفضل استخدام الزيوت الآتية في الطعام: زيت عباد الشمس - زيت الذرة - زيت الزيتون).
10- السكر والمربي وعسل النحل.
11- الحلويات.
12- الفواكه الطازجة والمجففة (فيما عدا التين وال**يب).
13- المكسرات (بدون ملح).
14- السوائل والمشروبات في حدود 1500 سم3 في حالة االاوديما.

* النظام الغذائي اليومي، يمكن للنباتيين وغير النباتيين تناول الوجبات التالية:

اولاً- الافطار:

1- كوب من الشاي + ملعقة مائدة من اللبن.
2- ملعقتان (ملعقة مائدة) مهلبية او بليلة باللبن والسكر.
3- خبز او توست (بدون ملح) مع عسل نحل او مربي.
4- برتقال.

ثانياً- الساعة 11 صباحاً:

- كوب عصير برتقال

ثالثاً- الغداء:

1- ارز مع حساء طماطم.
2- بطاطس مشوية او عدس.
3- قرع مطهي (كوسة مطهية).
4- خبز او توست (بدون ملح).
5- عنب.

رابعاً- الساعة 4 بعد الظهر:

1- كوب من الشاي بالسكر + ملعقة مائدة من اللبن.
2- مكسرات او فول سوداني بدون ملح.

خامساً- العشاء:
1- ارز مع حساء ( شوربة ) خضروات بالليمون.
2- بطاطس مسلوقة او عدس.
3- فاصوليا مطهية.
4- خبز او توست (بدون ملح).
5- فاكهة مثل التفاح او البرتقال.

* ملحوظة: لا يسمح باستخدام الملح علي مائدة الطعام او اثناء الطهي او عند اعداد الخبز، ويمكن استخدام عصير الليمون او الخل لجعل الطعام مستساغاً او مقبولاً.

nosa_aic
31 - 12 - 2011, 04:12
كيف تستطيع تخفيض ضغط الدم بشكل طبيعي؟

للأسف يعاني 40 مليون من سكان مصر من ارتفاع ضغط الدم، وهذه الاحصائية تشكل مشكلة كبيرة عندما نعلم بأن ضغط الدم [/URL] هو مقياس صحة ومرونة الشرايين في الجسم، وتشير أرقام قياس ضغط الدم (http://www.libyanyouths.com/vb/t74330.html) لمدى القوة التي يضرب بها الدم جدران الاوعية الدموية أثناء عملية ضخ القلب للدم حيث يرمز الرقم العالي الى ضغط الدم (http://www.libyanyouths.com/vb/t74330.html) الانقباضي بينما في مرحلة استرخاء القلب فإن الرقم المنخفض يشكل ضغط الدم الانبساطي، والمعدل الطبيعي هو ما بين 120إلي80 ملغرام زئبقي، يبدأ تشخيص حالة ضغط دم مرتفع من مستوى 140 ملغرام زئبقي للضغط الانقباضي و90 ملغرام زئبقي للضغط الانبساطي. وللأسف ففي هذه الحالة يكون الشخص معرضاً لسكتة دماغية او نوبة قلبية أو مرض في الكلية قد يؤدي إلي تفجّرها.

يقول الدكتور جيفري دوسيك وهو مشرف على بحث العلوم السلوكية في معهد هنري بينسون لمعالجة العقل والجسم في المشفى العام لمدينة ماساشوستس: إن المعالجة بالدواء قد تنجح في تخفيف ضغط الدم (http://www.libyanyouths.com/vb/t74330.html) ولكن للأدوية الخافضة للضغط تأثيرات جانبية كالشعور بالدوار أو الصداع، التعب، ضيق صدر، سعال، خلل وظيفي جنسي.

إن أفضل بديل هو بالتمرّن الرياضي لثلاثين دقيقة أو أكثر لمعظم أيام الاسبوع وإتباع حمية المفاهيم الغذائية لوقف ارتفاع ضغط الدم وهذه الحمية تعنى التقليل من تناول الملح وتفضيل تناول الخضراوات الغنية بالبوتاسيوم والفواكه ومشتقات الحليب الغنية بالكالسيوم والمنخفضة الدسم، أن ممارسة التمارين الرياضية وإتباع النصائح التالية يمكنك تخفيض ضغط الدم من 8-10 ملغرام زئبقي للضغط الانقباضي و6-10 ملغرام لضغط الدم (http://www.libyanyouths.com/vb/t74330.html) الانبساطي مقارنة مع معايير التداوي بالأدوية.

1. تناول الاحماض الدهنية الاوميغا 3

الفائدة: تزيد من مرونة جدران الاوعية الدموية وتخفّف من تجلُط الصفيحات الدموية.

الطريقة: تناول السمك الدهني كسمك الرنجة والسلمون والإسقمري والسردين مرتين أسبوعياً بالإضافة للجوز وزيت الكانولا (تجنب تناول الاسماك الغنية بالزئبق كسمك ملك الاسقمري، سمك القرش،سمك السيف، شريحة لحم التونة، والتايلفيش).

نسبة تحسّن ضغط الدم: 1-3 ملغرام لضغط الدم الانقباضي، و2 لضغط الدم الانبساطي.

2. التأمُل

الفائدة: التحكم بالتوتر، والتحفيز على إفراز أكسيد النيتريك والذي يساعد على استرخاء الاوعية الدموية.

الطريقة: الصلاة والمشي خارجاً وتخفيف التوتر.

نسبة تحسّن ضغط الدم: 9 لضغط الدم (http://www.libyanyouths.com/vb/t74330.html) الانقباضي و1.5 لضغط الدم الانبساطي.

3. تناول الألياف

الفائدة: تساعد في تنظيم الانسولين وتخفّف من مقاومة الانسولين (يمكن لمستويات عالية أن تساهم في ارتفاع ضغط[URL="http://www.libyanyouths.com/vb/t74330.html"] (http://www.libyanyouths.com/vb/t74330.html) الدم)، كما انها تساعد في إنقاص الوزن.

الطريقة: تناول المزيد من الفواكه والخضراوات والحبوب.

نسبة تحسّن ضغط الدم: 3 لضغط الدم (http://www.libyanyouths.com/vb/t74330.html) الانقباضي و2.6 لضغط الدم الانبساطي.

4. المساجات

الفائدة: تخفّف الاستجابة للتوتر

الطريقة: مساجات لمنطقة الظهر لعشر دقائق ولثلاث مرات في الاسبوع.

نسبة تحسّن ضغط الدم: 2 لضغط الدم (http://www.libyanyouths.com/vb/t74330.html) الانقباضي و 1.5 لضغط الدم الانبساطي.

نتمنى للجميع الصحة والعافية ووقانا الله شر الامراض جميعا

kot
31 - 12 - 2011, 18:11
http://files2.fatakat.com/2010/12/12934626871545.gif (http://forum.ma3hd.net/ma3hd11/arab369437/)


http://4.bp.blogspot.com/-w2AkqtBdgrc/Tt379xnEKCI/AAAAAAAAB7o/kiygH_toB98/s200/newyearwallpapersnewyea.jpg (http://forum.ma3hd.net/ma3hd11/arab369437/)

تمر الايام والشهور بسرعة لتدق الساعة الثانية عشر لميلاد عام ميلادى جديد 2012
كل سنة وانتم طيبين

http://2.bp.blogspot.com/_NjdBzKI5nYs/SRqMvVnQOMI/AAAAAAAAA9w/52zORuqZZsk/s400/animated%20happy%20new%20year%20greeting%20card.gi f (http://forum.ma3hd.net/ma3hd11/arab369437/)

نودع عام 2011 بما فيه من آلام واحزان وصراعات

ونتمنى ان يكون العام الجديد عام فرح وسعادة للجميع

http://3.bp.blogspot.com/-zSoFFSpXJZc/TmTLNio_waI/AAAAAAAAAPI/ISjmuKQuFoA/s400/Happy%20New%20Year%202012%20picture%20HD.jpg (http://forum.ma3hd.net/ma3hd11/arab369437/)



http://1.bp.blogspot.com/-Xu5pMBxDDuo/TmTLv3GusxI/AAAAAAAAAPk/HX6O8FhL-kM/s1600/happy%20new%20year%202012%20images%20large.jpg (http://forum.ma3hd.net/ma3hd11/arab369437/)

http://forum.ma3hd.net/images/statusicon/wol_error.gifنقره على هذا الشريط لعرض الصورة بالمقاس الحقيقيhttp://blog.fendeq.com/wp-content/uploads/2011/12/Happy-New-Year-2012-22222.jpg (http://forum.ma3hd.net/ma3hd11/arab369437/)

جعلها الله سنه سعيدة علينا جميعا
ونقدم تهنئة خاصة للمسيحين بعيدهم
وكل عام وانتم جميعا بخير

http://elmilion.com/wp-content/uploads/2011/11/New_Year_wallpapers_2012_New_Year1-400x300.jpg (http://forum.ma3hd.net/ma3hd11/arab369437/)

http://i40.servimg.com/u/f40/16/70/08/19/avakar13.jpg (http://forum.ma3hd.net/ma3hd11/arab369437/)






اختنا المنورة دائما....نوسه
كل عام وانتي والاسرة بكل الخير
وان شاء الله قريبا
نري الباب مثبت من جماله
kot

hanan desoky
31 - 12 - 2011, 18:37
http://up.esgmarkets.com/uploads/images/esgm-318f465c54.jpg (http://up.esgmarkets.com/)

http://4.bp.blogspot.com/-w2AkqtBdgrc/Tt379xnEKCI/AAAAAAAAB7o/kiygH_toB98/s200/newyearwallpapersnewyea.jpg

nosa_aic
31 - 12 - 2011, 19:35
الاخت الفاضلة الاستاذة/ حنان

الاخ الفاضل الحاج / اسماعيل

عام سعيد على الجميع ان شاء الله


http://image.yaymicro.com/rz_512x512/0/8cd/christmas-cards-2012-8cd13e.jpg (http://www.bayt4.com/vb)



http://c.universalscraps.com/files/fr/bonne.annee/bonne_annee_027.gif

nosa_aic
31 - 12 - 2011, 22:35
لماذا نبكى عند الضحك الشديد و عند تقطيع البصل


http://pms.panet.co.il/online/images/articles/2007/12/13-12-07/o_wa.jpg (http://www.libyanyouths.com/vb/t1001.html)




اولا عند الضحك الشديد


السبب في ذلك هو أن الإنسان عندما يضحك شديداً تقوم العضلات بعصر الغدد التي تخزن الدموع فينشأ ضغط على السائل فيخرج من الغدد ويتدفق .

ثانيا عند تقطيع البصل

وهناك حالة أخرى يحدث فيها البكاء وهي عند تقطيع البصل ، وذلك لأن البصل يطلق مادة طيارة


فتحاول العين حماية نفسها من هياج وإثارة هذه المادة بإسالة الدموع التي تغسل المادة الطيارة . ونفس الشيء أيضاً يحدث مع الدخان فيحدث البكاء تلقائياً لحماية وتطهير العين.

nosa_aic
31 - 12 - 2011, 22:48
الزيتون يخفض الكوليسترول و يحمى قلب الانسان


ذكرت دراسة أن الزيتون الذي يتصدر معظم موائد الشعوب الشرق أوسطيةتخفيض [/URL] كوليسترول الدم و يحمى (http://www.libyanyouths.com/vb/t5431.html) القلب بسبب احتوائه علي مواد مضادة للاكسدة.

http://pms.panet.co.il/online/images/articles/2008/04/03-04-08/olive300and100_1.jpg (http://www.libyanyouths.com/vb/t5431.html)

وأضافت ان فوائد الزيتون وزيت الزيتون معروفة منذ قرون، مشيرة إلى أن مشتقات هذه المادة الغذائية التي عرفها الانسان منذ قرون طويلة تستخدم الآن في صناعة الاصباغ.

واضافت الدراسة ان فوائد الزيتون وزيت الزيتون معروفة منذ قرون، مشيرة إلى أن مشتقات هذه المادة الغذائية التي عرفها الانسان منذ قرون طويلة تستخدم الآن في صناعة الاصباغ والكريمات وحتى المشروبات. إلى ذلك قالت الاختصاصية في التغذية بريجيت إيسبيت من مؤسسة التغذية البريطانية لصحيفة الدايلي مايل نعلم منذ وقت طويل أن زيت الزيتون مفيد للقلب، مضيفة أنه مصدر ممتاز ضد الاكسدة التي تحمي القلب. وأضافت ان الدراسة التي أجريت على الزيتون [URL="http://www.libyanyouths.com/vb/t5431.html"] (http://www.libyanyouths.com/vb/t5431.html) وزيت الزيتون أخيراً أظهرت أن بإمكانه حماية الانسان من مرض السرطان.

nosa_aic
01 - 01 - 2012, 19:45
هل تهز رجلك أثناء الجلوس ؟ إذاً قلبك في خطر

كثيرون منا يحلو لهم هز ارجلهم اثناء الجلوس , سواء كتصرف عصبي يدل على التوتر , او كعادة , وبكل الاحوال هناك خطر على القلب.

دراسة امريكية كشفت عن ان الاشخاص الذين يحركون أرجلهم وتهتز سيقانهم بطريقة عصبية اثناء لجلوس أكثر عرضة للاصابة بامراض القلب وشرايين المخ خاصة إذا زاد معدل الاهتزاز على 16 مرةفي الشهر.


ويعلق رئيس طب الحالات الحرجة بمعهد القلب على هذه الدراسة موضحا "ان هؤلاء الاشخاص غالبا ما يكون نومهم غير مستقر , ويتحركون اكثر من 300 مرة في الليلة الواحدة اذا تم إجراء رسم نوم لهم , لذلك فهم اكثر عرضة لتسارع نبض القلب , وارتفاع ضغط الدم.

nosa_aic
01 - 01 - 2012, 20:33
علاج فقر الدم و النحافة بالاعشاب الطبيعية


فقر الدم وضعف الجسم

النحافة هي نقص الوزن عن المعدل الطبيعي قليلاً أو كثيراً فإذا كان الشخص متمتعاً بصحة جيدة وحيوية ونشاط فلا خوف عليه وقد قال أحد الأطباء الإنجليز المشهورين عن الطفل النحيف انه إذا كان نشيطاً ومتحركاً وحيوياً فإنه لا خوف عليه وهؤلاء الفئة من الناس هم الذين يعمرون بالرغم من أن أكلهم قليل وتعتبر ظاهرة النحافة عند هؤلاء الناس ظاهرة طبيعية أما إذا كان خاملاً بليداً مريضاً فإنه في مثل هذه الحالة لابد من عرضه على طبيب لأنه لابد من وجود سبب مرضي أدى إلى حدوث النحافة

ولمعرفة فيما إذا كان الشخص نحيفاً وبالأخص بالنسبة لليافعين والشباب والبالغين وكبار السن فإن هناك قاعدة بسيطة وسهلة وهذا الوزن يخص أي شخص يزيد طوله عن 120سم والقاعدة هنا أن نطرح ما مقداره 100سم من الطول فيكون المقدار الباقي هو الوزن الصحيح المناسب للشخص ويكون محسوباً بالكيلوجرام فلو كان شخص طوله 170سم فإن وزنه سيكون 170- 100= 70كيلوجراماً ومن نقص عن ذلك الوزن مثلاً فيكون نحيفاً و النحافةتنشأ اساساً من سوء التغذية إلا ان الوراثة تلعب دوراً هاماً وكبيراً والحقيقة ان هناك من هو نحيف لأنه ينحدر من أسرة كل أفرادها من النحفاء ويجب أن نعرف أن سوء التغذية لا يعني قلة الكمية التي يتناولها الشخص من الطعام، لكن المقصود بسوء التغذية أن الشخص لا يتناول أطعمة متنوعة تحتوي على مقادير مناسبة من الفيتامينات والأملاح والبروتينات والنشويات

والانفعالات النفسية والقلق والهموم لها دور في ضعف الشهية كما أن النحافة قد يكون مصدرها اسهال مستمر لدى الشخص نتيجة وجود الطفيليات والديدان المعوية والتي لا تجدي معها التغذية السوية ولا الأدوية وعليه فلابد من اجراء الفحوصات المعملية والاكلينيكية حتى يتم التأكد من عدم وجود هذه المواد داخل الأمعاء

كما أن النحافة قد تكون نتيجة للاكتئاب الذي يسببه ادمان الخمور وبعض المخدرات، أو عرضاً لبعض الأمراض التي تفسد عمليات الجسم الكيميائية كما أن اضطرابات الجسم والغدة الدرقية والغدد الصماء وأمراض المعدة والامعاء لها دور في نشوء النحافة كما أن هناك أمراضاً خطيرة تسبب نقصاً كبيراً في الوزن مثل السرطان والسل والايدز


أعراض النحافة :

ومن أعراضها الوجه الشاحب - جفاف الجلد - سقوط الشعر - الهالات السوداء حول العين - الصداع والدوخة أو سوء التغذية أو مشاكل هرمونية أو بعض الأمراض العضوية والنفسية فلا يمكن للشخص المتوتر والقلق والعصبي من زيادة وزنه مهما تناول الطعام إلا إذا تغلب على المشاكل النفسية وتخلص من التوتر والعصبية وإعطاء جسده حقاً من الراحة والاستجمام فالراحة الجسدية والنفسية هي أساس في البداية لعلاج النحافة


الطفل النحيف :

نسمع كثير من الأمهات يشكون من ضعف الشهية عند أطفالهن ووجوههم الشاحبة ومظهرهم النحيف والحقيقة هي أن الأطفال في مراحل النمو يزداد طول الطفل أسرع من ازدياد وزنه ولأنهم كثيري الحركة واللعب فتقل رغبتهم في تناول الطعام لانشغالهم باللعب فتكون النتيجة هي النحافة ولمعرفة الوزن الطبيعي لطفلك ما عليكي إلا أن تحسبي عمره بالسنوات * 2+ 8الناتج هو الوزن الطبيعي فإذا كان الناتج "وزنه" أقل من 20% من الوزن الطبيعي فيعد الطفل نحيفا جدا فإن كان الطفل سليما لا يشكو من أي مشاكل صحية فسوء التغذية هو السبب لنحافته فعليك إعطاء الطفل الأغذية الغنية بالطاقة والسعرات الحرارية من الكربوهيدرات والدهون والبروتينات للمحافظة على نموه العقلي والجسدي وذلك لتعويض المفقود من الجسم من طاقة ناتجة عن كثرة الحركة، ومن المحتمل أن يكون الطفل له شهية جيدة ولكن وزنه لا يزيد فعليك أن تتأكدي من خلو جسده من الديدان مثل الاسكاريس والدودة الشريطية وغيرها فهي تقلل من شهية الطفل وتتطفل على غذائه


والنحافة عند الأطفال تكون وقتية ومع الاهتمام بالتغذية السليمة سوف يزيد الوزن وتختفي النحافة

وانصح جميع الأمهات بالتالي:


- عدم الضغط على الأطفال من أجل تناول الطعام فقد يسبب الضغط مفعولاً عكسياً بحيث يكرره الطفل الطعام، بل قومي بالحديث معه وترغيبه وعرض نوع واحد فقط وليس أكثر من نوع فبهذا سوف ترهقين نفسك فالطفل ان لم تكن له شهية للطعام سوف لا يأكل حتى لو أحضرتي له 7أنواع فأكثر

- المواظبة على ساعات النوم لراحته ونموه

- اعطاء الطفل كميات من البروتينات للمحافظة على نموه وخاصة الألبان والبيض واللحوم والبقوليات

- اعطاؤه الكثير من المواد النشوية لمده بالطاقة اللازمة من أجل حركته الزائدة

- اعطاؤه الفيتامينات الضرورية بعد استشارة الاخصائي
وخاصة فيتامين ب المركب الفاتح للشهية الموجود في الخميرة - الكبدة - اللحوم - الموز - عصر الطماطم ويفضل المصادر الطبيعية عن الدواء

- احتفظي في مطبخك بالاغذية المفيدة له مثل حبوب الافطار والمكسرات والفواكه المجففة لتكون له بديل عن الشيبسي والشوكولاته عند الاحساس بالجوع ويمكن اعطاؤه قطعة من الشوكولاته بعد تناول وجبة خفيفة كساندويتش جبنة

- عودي طفلك على صحن الخضروات والفواكه الطازجة في ساعة معينة كل يوم وقت المغرب حتى يرث العادات الغذائية الصحيحة

- عدم تقديم لطفلك أنواع الحلوى الملونة والمنكهة والمشروبات الغازية وعدم تواجدها في منزلك هي الخطوة الأولى وباقناعه بضررها مرارا ومرارا سوف يخزن عقله الباطن هذ ويقل ميله لها إلا بالمناسبات
وتذكري عزيزتي الأم انت القدوة فعاداتك الغذائية هي التي تورث لطفلك


الأدوية العشبية والمشتقات الحيوانية والنحافة:

تتدخل الأعشاب والمشتقات الحيوانية في زيادة وزن النحفاء لاسيما إذا لم يكونوا مصابين ببعض الأعراض التي ذكرناها مسبقاً وأهم الأعشاب والمشتقات الحيوانية التي تزيد من وزن النحفاء ما يلي:

- الحلبة FENUGREEK

لقد تحدثنا في أعداد سابقة عن الحلبة وعن وصفها ومحتوياتها الكيميائية والحلبة تستخدم على عدة أشكال حسب الآتي:

1- يغلى كأس من الماء ثم يضاف إليه ما مقداره 3جرامات من مسحوق الحلبة ويترك يغلي لمدة دقيقة واحدة ثم يصفى ويحلى بالعسل ويشرب بمعدل ثلاث مرات في اليوم ويستمر الشخص في الاستعمال حتى يحصل على الوزن المطلوب كما يفيد أكل الحلبة الخضراء كثيراً في زيادة الوزن

2- يؤخذ وزن معين من بذور الحلبة وتوضع في كمية من الماء وتغلى على النار أربع أو خمس مرات وكل مرة بماء جديد ثم بعد ذلك تهرس البذور جيداً ويضاف إليها مثل وزنها من دقيق الحنطة الناعم ثم يضاف عليها حليب بقري ويحرك حتى تكون مثل الشوربة ثم يضاف عليها عسل نحل بقدر كاف ويحرك قليلاً ثم ينزل من على النار ويستعمل حيث يزيد الوزن ويستمر الشخص على ذلك حتى يصل إلى الوزن المطلوب

3- يؤخذ 300جرام من بذور الحلبة المطحونة + كيلوجرام من العسل الأسود + كيلوجرام من زيت الزيتون + 600 جرام من دقيق القمح + 25جراماً من المغات + كمية كافية من بعض المكسرات المقشرة ومن السمسم، والطريقة ان يحمى الزيت تماماً ثم يضاف إليه الدقيق مع التحريك المستمر حتى يحمر لونه وبعد ذلك تضاف المكسرات والسمسم مع الاستمرار في التحريك حتى يحمر لون المكسرات والسمسم ثم تضاف الحلبة والمغات مع التحريك المستمر لمدة عدة دقائق حتى تحصل على مزيج غامق اللون بشكل عجينة متماسكة ثم يضاف إليها العسل ويحرك حتى يمتزج مع العجينة تماماً توضع في برطمان ويؤكل منها يومياً ما مقداره أربع ملاعق أكل مرة واحدة في اليوم، ويستمر على ذلك حتى الوصول إلى الوزن المطلوب مع ملاحظة عدم استخدام مريض السكر لهذه الوصفة

كما يوجد خلطة أخرى مكونة من كيلو حلبة وكيلو دقيق قمح أبيض وكيلو زيت زيتون أو سمن بري ونصف كيلو عسل وبعض المكسرات بحيث يعمل منها عجينة على نار هادئة ويؤكل منها يوياً ملعقتا أكل كبيرة

- التين واليانسون FIG and Anise

يؤخذ ما مقداره 4حبات تين مجفف وملء ملعقة صغيرة من مسحوق اليانسون ويوضع في وعاء به قدر كوب من الماء ثم يوضع على نار هادئة حتى يدفأ الماء ثم يبعد من على النار ويترك ينقع حتى يكون التين طرياً ثم يؤكل التين وجميع المحتويات الموجودة بالوعاء ويكون ذلك يومياً قبل الإفطار ويستمر عليه لمدة أربعين يوماً ملاحظة يجب على مريض السكر عدم استخدام هذه الوصفة

طرقة أخرى :

التين المستعمل هو التين الجاف حيث تؤخذ حبتان إلى أربع حبات فقط وتنقع في حليب أو ماء دافئ حتى تكون طرية ويضاف لها ملعقة صغيرة من مسحوق اليانسون ثم تشرب على الريق يومياً وتعتبر بمثابة الفطور ويستمر الشخص النحيف في استعمال هذه الطريقة لمدة لا تقل عن أربعين يوماً والطريقة المثلى هي نقع ثلاث حبات من التين في ملء كوب ماء دافئ أو حليب دافئ ثم يضاف اليه ملء ملعقة يانسون غير مطحون ويغطى وينتظر حتى ينتفخ التين ويكون ليناً ثم تؤكل حبات التين ويشرب كل ما في الكوب من ماء ومن يانسون وذلك مرة على الريق يومياً ولا يؤكل بعد ذلك أي شيء لمدة ساعتين ولا يستعمل اطلاقاً في المساء

أشياء مسمنة للجسم بدون أضرار جانبية:

يعتبر التين الجاف بمعدل حبتين يومياً ترطب في كوب حليب دافئ حتى تكون طرية ثم يضاف لها ملعقة صغيرة من مجروش اليانسون ويشرب ويؤكل التين على الريق يومياً ولمدة أربعين يوماً كما ان الحلبة من المواد التي تزيد الوزن وذلك بأخذ ملء ملعقة كبيرة يومياً وذلك من مسحوق الحلبة البلدي، كما ان خليطا متساويا من 100جرام محلب + 100جرام سكر نبات + 12حبة لوز حلو تخلط سحقاً ثم توزع على 24جزءا ويؤخذ كل جزء مرتين في اليوم


- حب العزيز CYPERUS

ويسمى أيضاً حب الزلم وهو عبارة عن درنات تشبه البندق الصغير وطعمها مقبول يؤخذ حب العزيز ويدق ثم ينقع في الماء ليلة كاملة بعد ذلك يهرس ويصفى ويشرب ماؤه بعد أن يحلى بالعسل ويداوم الشخص على شربه اثني عشر يوماً والجرعة منه ثلاث ملاعق كبيرة لكل مرة

- السمسم SESAME

تعتبر بذور السمسم من المسمنات الجيدة حيث تؤكل منه يومياً ما مقداره ملء كوب وقد أكد ابن سينا على تميز السمسم في زيادة الوزن

- فول الصويا SOY BEAN

يعتبر فول الصويا غني بمواد استروجنية وبروتين وهو يزيد الوزن حيث يؤكل ما مقداره ملء كوب من الفول يومياً حيث يسلق سلقاً جيداً ويؤكل

- البطاطس المحمرة Potato

تعطى البطاطس سعرات حرارية عالية تقدر بأربعمائة إلى خمسمائة سعراً حرارياً لكل نصف كيلو من البطاطس وهذا يشكل ما يحتاجه الشخص من السعرات الحرارية في اليوم تقريباً ولذلك تعتبر البطاطس المحمرة من المسمنات الجيدة

- الكزبرة CORIANDER

نظراً لأن الكزبرة تحتوي على الحديد والتي تؤدي بدورها إلي زيادة عدد كريات الدم[/URL] الحمراء في الجسم النحيف وكذلك يحسن هيموجلوبين الدم (http://www.libyanyouths.com/vb/t73688.html) ويجب ان يتناول الشخص بذور الكزبرة على هيئة مسحوق حيث يؤخذ ملء ملعقة كبيرة من المسحوق ويسف بعد كل وجبة غذائية أو يمكن وضع هذه الكمية مع السلطة وأكلها جميعاً والمدة الزمنية لاستخدام الكزبرة شهر كامل

- خوخ PEACH

يؤخذ 50جراماً من ثمار الخوخ المجفف ويضاف إلى لتر ماء ويترك على النار حتى يغلي لمدة 5دقائق ثم يبرد ويؤكد بمعدل مرة واحدة في اليوم

- الموز + الحليب كامل الدسم

يؤخذ حبتين موز وتقشر ثم توضع في الخلاطة ويضاف لها كوباً ونصف الكوب حليب كامل الدسم ويخلط بالخلاطة ثم يشرب كاملاً وذلك بمعدل مرة واحدة في اليوم

- العنب الأسود + الدردار

يؤخذ ما مقداره حفنة اليد ويوضع في وعاء ثم يضاف له قبضة اليد من الدردار ويصب فوقه نصف لتر ماء ويترك لينقع لمدة نصف ساعة ثم يهرس بعد ذلك ويشرب كاملاً وذلك بمعدل مرة واحدة في اليوم

- حشيشة الدينار HOPS

يؤخذ 30جراماً من مسحوق حشيشة الدينار ثم يمزج مع ثلاث ملاعق عسل نقي وتؤكل بمعدل مرتين في اليوم

- المغات + السمسم + المحلب + اللوز الحلو + الجوز + جوزة الطيب + حمص

يؤخذ كميات متساوية من المغات والسمسم واللوز الحلو والجوز والحمص حوالي 50جراماً ويضاف إلى ذلك 10جرامات محلب وحبة واحدة جوزة الطيب وتسحق جميعاً ثم يضاف لها نصف كوب حليب كامل الدسم وملعقتين عسل ويشرب مرة واحدة في اليوم

- العسل الأبيض + دقيق الذرة

العسل الأبيض هو عسل ربيعي ويسمى مجرى يؤخذ مقدار ملء كوب دقيق الذرة (حبش أبيض) ويخلط مع نصف كوب دقيق أبيض عادي ثم يخلط بالماء بعد أن يضاف قليل من الملح ويمزج حتى يكون مادة سائلة تشبه الشربة ثم يصب المزيج في وعاء الكيك ويوضع في الفرن لمدة عشر دقائق ثم تخرج الفطيرة من الفرن وتحرك من اناء الكيك ثم يوضع فوقها ثلاث ملاعق كبيرة من العسل الأبيض وتؤكل وتعتبر وجبة كاملة وتؤخذ مرة واحدة في اليوم

ملاحظة: يجب ان يدهن وعاء الكيك بالزيت قبل صب خلطة الدقيق فيه وذلك من أجل سهولة نزع الفطيرة

أما العسل فنعم انه يزود الوزن خاصة اذا اخذت يومياً نصف كوب عسل فهو يزيد الوزن ويمكن استخدام اي من الوصفتين التي كتبت عنهما وهما التين الجاف او الحلبة مع دقيق القمح وقد اعطيت طريقة التحضير لتلك الوصفتين وهي جيدة للهزال والله يعطيك العافية

- المكسرات المحمرة:

يؤخذ كميات متساوية حوالي ملء ملعقتين من كل من اللوز الجبلي + الجوز + السمسم + البندق + حمص + فول سوداني مقشر + أبوفروة ثم تحمص فوق النار لمدة 5دقائق ثم تبرد وتقسم إلى جزءين جزء يؤكل في الصباح وآخر قبل النوم مع لبن زبادي

نصائح هامة:

1- يجب أكل الفواكه مباشرة بعد وجبة الطعام

2- الإكثار من عصائر الفاكهة الطازجة مثل العنب والمنقة والموز وعصير الكوكتيل

3- شرب حليب كامل الدسم بمعدل ثلاثة أكواب في اليوم

4- تناول أسماك الجمبري والكابوريا والبلطي والأسماك المعلبة مثل الساردين والتونة

5- أكل حلاوة طحينية على الافطار

6- أكل ما لا يقل عن 11حبة تمر يومياً

مع ملاحظة حظر استعمال الوصفات التي فيها عسل أو سكر أو تمر أو مواد دهنية أو موز أو عنب للأشخاص المصابين بداء سكري

يستخدم العسل الأصلي وهو المنتج في المناطق الجبلية التي يوجد بها تنوع نباتي وعشبي كبير ويضاف إلى العسل نسبة من حبة البركة وكمية من الرشاد ويؤخذ منه ملعقة صغيرة صباحا ومساء ولمدة لا تقل عن أربعين يوما

المكسرات تنفع لمن يعانون من النحافة

الدراست الحديثة عن التغذية تشير إلى أهمية المكسرات ، ليش كأغذية وحسب بل كعناصر شفائية فمحتواها من المعادن يفوق كافة ما تحتويه أية فاكهة مثل الفسفور المفيد لإغذاء المخ والعظام، والكبريت والبوتاسيوم ، فالبندق مثلا عنصر غذائي هام لتنشيط العمل الوظيفي لمخ العظام في الجسم وعنصر شافي بالنسبة للأطفال المصابين بفقر الدم الحاد ، المكسرات جميعها لا تحتوي على نسب عالية من فيتامين C ، كما أنه فقيرة بفيتامين A، لكنها غنية بفيتامين B وبالأخص الأحماض الدهنية المفيدة لتغذية الخلايا

فائدة نصف كيلو من الجوز تعادل 20 كيلو من لحم البقر أو الخراف وتعادل 3 كيلو من لحم الدجاج الخالي من الدهن وحوالي 2 كيلو من البيض هذا من حيث الزلال في المكسرات من النوع الكامل القيمة وهي تتساوى مع اللحوم من حيث إمداد الجسم به بل هو أفيد للأسباب التالية:

المكسرات لا تكون أحماض البول ( البواليك) في الجسم والتي تسببها اللحوم ( حمض البوليك سبب لكثر من الأمراض) مثل أمراض المفاصل المختلفة
المكسرات تكاد تكون خالية من الجراثيم الضارة الموجودة باللحوم وخاصة بالصيف" إذا حفظت جيدا"
زلال المكسرات خالي من الطفيليات " كالدودة الوحيدة"
المكسرات تؤكل نيئة ولا تفقد شيئا من عناصرها بسبب الطبخ مثلا
الدهون الموجودة بالمكسرات غير مشبعة لذلك فضررها قليل جدا نسبة للحوم
الحمية على المكسرات والفواكه الطازجة نافعة في علاج كثي من الأمراض كأمراض الكلي والكبد وأمراض الدورة الدموية
هناك عيب واحد بالمكسرات أنها لا تلائم البدنيين (أي القالبين للسمنة)
تقول الدراسات التي قامت بها إحدى جامعات كاليفورنيا أن الجوز يساعد في تخفيض نسبة الكلسترول الضار في الدم (LDL) خلال شهر من تناوله يوميا بنسب معتدلة بسبب احتوائه على نسبة علية من الدهون الغير مشبعة

- أنا شابة نحيفة وأريد زيادة الوزن فماذا أفعل؟ النحافة هي نقص الوزن عن المعدل الطبيعي فإذا كان الشخص النحيف متمتعاً بالصحة والحيوية والنشاط فلا خوف عليه أما علاج (http://www.libyanyouths.com/vb/t73688.html) النحافة فيأتي بالغذاء الغني بالطاقة الحرارية والبروتين إذ هي تزويد الجسم بغذاء يمده بسعرات تزيد على حاجته اليومية ومقادير وافية من البروتين لتساعد بناء الأنسجة الجديدة، ويمكن لمن يرغب في زيادة وزنه اتباع ما يلي:1 معالجة الأمراض إن وجدت 2 النوم الكافي لمدة 10 14ساعة يومياً 3 تناول طعام مغذ ومفيد دون افراط 4 الابتعاد عن كل ما يسبب الاضطرابات النفسية 5 الاقلال من التدخين أو الامتناع عنه 6 تناول المقبلات قبل كل وجبة 7 ممارسة الرياضة الخفيفة 8 الاستمتاع بالهواء الطلق 9 الاكثار من السمسم والتمور والسكريات والفواكه

أسباب فقدان شهية الطعام:

توجد عوامل كثيرة تؤدي إلى ضعف الشهية ومن أهم هذه العوامل، العامل النفسي، حيث أن القلق والتوتر والحزن تفقد الانسان قابليته للاكل

كما يعتبر ضعف الشهية عرضاً هاماً لعدة أمراض، بل ويعتبر ايضاً من احد الاسباب الرئيسية لكثير من الأمراض التي تنتج عن ضعف التغذية مثل فقر الدم والانيميا وخلاف ذلك

والطبيب البشري أو النفسي الجيد يمكن ان يضع اصبعه على السبب الذي يؤدي إلى ضعف الشهية لدى المريض، وعندها يمكن وصف العلاج المناسب وتحديد الاساليب المناسبة لفتح الشهية للأكل

وصفة خاصة بفتح الشهية والسمنة

ـ الوصفة تتكون من الحبة السوداء بمقدار 50 جراما, حلبة بلدي 500 جرام, جنسنج 100 جرام ـ قصب الذريره 100 جرام

تسحق المكونات سحقا ناعما وتحفظ في علبة قاتمة مضادة للضوء ويحكم غطاؤها جيدا ويؤخذ من هذه الخلطة ملعقة صغيرة قبل الأكل مرة في الصباح وأخرى في المساء

التمر واللبن مصادر طبيعية تفتح الشهية وتغذي الأجسام الهزيلة

إن فقدان شهية الطعام لأمر عادي ويحدث كثيراً لدى فئة من الناس وفي مختلف الاعمار ويخضع لعدة عوامل قد يكون احدها سبباً كافياً لفقدان شهوة تناول الطعام أو ربما لنوع محدد من الاطعمة بصفة خاصة، حيث ان كثيرا من الناس لا يحب طعاماً معيناً اما لعقدة نفسية او ربما لعدم موافقة طعم ورائحة الاكل للشخص أو ربما لاسباب أخرى

المصادر الطبيعية (http://www.libyanyouths.com/vb/t73688.html) لفتح الشهية وتقوية الأجسام الهزيلة:

- التمر واللبن Dates And Milk

ينقع التمر في الحليب لمدة ست ساعات ثم يأكله المريض حيث يفتح شهوته للطعام ولا شك ان هذين المصدرين يعتبران من اغنى المواد بالمعادن والفيتامينات والاحماض الامينية والسكريات والبروتين والمواد الدهنية حيث يعتبر من أفضل المغذيات، ويجب على الاشخاص المصابين بالسكري عدم استعمال هذه الوصفة

- الحلبة Fenugreek

يعتبر مغلي الحلبة من المواد المشهية للأكل والطريقة ان توخذ ملء ملعقة من الحلبة البلدي وتوضع في ملء كوب ماء ثم يغلى على النار لمدة 1/4ساعة ثم يصفى ويشرب بعد تحليته بالعسل أو السكر قبل الوجبة الغذائية بنصف ساعة
لقد قيل عن الحلبة "لو عرف الناس بما فيها من فوائد لاشتروها بوزنها ذهباً" والقمح هو الغذاء لجميع البشر منذ بزوغ التاريخ وهاتان المادتان مع الحليب والعسل والسمن البلدي تعتبر من الوصفات الجيدة للتسمين وخاصة للنحفاء والطريقة أن يؤخذ 1/2كيلو من بذور الحلبة ثم توضع في وعاء ويضاف ما يغطيها من الماء وعند الغليان يزاح الماء ويبدل بماء جديد ويترك حتى يغلي ثم يزاح وتكرر العملية أربع مرات ثم بعد ذلك تهرس بذور الحلبة ويضاف لها حليب وتوضع فوق النار وتحرك ثم يضاف لها 1/2كيلو دقيق قمح ويضاف قليلاً قليلاً مع التحرك على النار حتى انتهاء الكمية وتتكون عصيدة رخوة ثم يزاح من على النار ويضاف ملء ملعقة كبيرة سمن بلدي ويمزج مع العصيدة جيداً ثم يضاف ملء كوب صغير عسل طبيعي ويحرك جيداً حتى الامتزاج ثم توضع هذه الخلطة في وعاء زجاجي ويحكم إغلاقه ويوضع في الثلاجة ويؤخذ منه يومياً ملعقة كبيرة حتى تنتهي

- الخل Vinegar

يستعمل خل العنب أو التفاح وذلك باضافته إلى السلطة وتضاف ملعقة صغيرة من الخل إلى ملء كوب ماء الموجود على مائدة الطعام وتشرب على فترات خلال وجبة الغذاء حيث يساعد على فتح الشهية وعلى بلع الطعام

- ام الالف ورقة Achelia

ام الاف ورقة تعرف ايضاً بالاخيليا ام الالف ورقة وكذلك بأسم حشيشة النجارين والطريقة ان يؤخذ ملء ملعقة صغيرة من مسحوق العشبة الجافة أو من مفروم العشبة الطازجة وتوضع في كوب زجاجي ويضاف لها ماء مغلي، ثم يغطى الكوب ويترك لمدة 15دقيقة وبعدها يصفى ويشرب مرة في الصباح بعد الفطور وآخر بعد العشاء مباشرة

- الترمس Termis

من المعروف ان الترمس غني بالكالسيوم والفوسفور والترمس يحسن الشهية ويقوي الجسم والطريقة ان يوخذ 250جم من بذور الترمس وينقى جيداً ثم ينقع في الماء لمدة 24ساعة متتالية على ان يغير الماء كل ست ساعات ويجمع الماء جانباً، ثم يغلى بعد ذلك مع كمية جديدة من الماء لمدة ساعة على النار ثم يصفى الماء ويعاود نقعه مرة أخرى بعد ذلك لمدة 24ساعة أخرى ثم يصفى ويؤكل بعد ان يضاف عليه قليل من الملح والليمون هذه الوصفة جيدة ايضاً للمصابين بالسكر حيث انها تخفض نسبة السكر يمكن ان يستعمل ماء منقوع الترمس كغرغرة جيدة للاسنان وغسول جيد للشعر بالنسبة للجنسين

- اليانسون Anise

تحتوي ثمار اليانسون على زيوت طيارة واهم مركباته الانيثول والذي يساعد على عملية الهضم والطريقة ان يؤخذ ملء ملعقة من ثمار اليانسون وتوضع في كوب ثم يملأ بالماء المغلي ويترك لمدة 15دقيقة ثم تصفى ويشرب مرة بعد الفطور واخرى بعد العشاء وهذه الوصفة جيدة لفتح الشهية ، وصفه : يوضع التين والينسون مع قليل من الماء فى إناء ويترك قليلا على نار هادئة ويداوم النحيف على الإفطار من هذا الخليط لمدة أربعين يوماً

الوصفة الثانية: يوضع 150 جراماً من الحلبة فى كمية من الماء وتغلى على النار أربع أو خمس مرات وكل مرة بماء جديد ثم تسحق ناعماً ويضاف إليها مثل وزنها من الدقيق الناعم ويضاف إليه اللبن البقرى حتى يتكون شراب ناضج ثم يضاف إليها عسل النحل ويحرك قليلاً على النار ويشرب ساخناً

- البصل Onion

من المعروف ان البصل يفتح الشهية للطعام وعليه فإنه يؤخذ حبة بصل في حجم بيضة الدجاجة وتؤكل مرة مع الغذاء واخرى مع العشاء يومياً والبصل يغذي ويطهر الامعاء ويقوي البدن ويقتل جراثيم المعدة ويجب تناول بقدونس طازج بعد أكل البصل لايقاف رائحة البصل المعروفة

- الثوم Garlic

الثوم يعتبر اغنى الاعشاب بالمواد الفعالة واكثرها تأثيراً على عدة أمراض بالاضافة إلى ذلك فهو مشهي جيد ويعطي الجسم قوة لا نظير لها وهو بحق غذاء ودواء وتناول افصاص الثوم مع الطعام أو مع السلطة بواقع 3- 6افصاص في اليوم الواحد ويمكن اكله طازجاً أو مطبوخاً

- الزيزفون Tilia

ويعرف الزيزفون ايضاً بالتيليو ويعتبر الزيزفون من الاعشاب الفاتحة للشهية والمقوية للجسم حيث يؤخذ ملء ملعقة شاي في كوب ثم يملأ بالماء المغلي ثم يغطى لمدة 15دقيقة ويصفى ويشرب قبل تناول الوجبات طوال اليوم

- السذاب Ruta

يعتبر السذاب احد النباتات العطرية الفاتحة للشهية حيث تؤخذ عدة أوراق طازجة من السذاب الذي يزرع في اي مكان وينمو بشكل عفوي في المناطق الجنوبية من المملكة وتؤكل طازجة مع الخبز

- الزعتر Thymus

يعتبر الزعتر من اشهر النباتات التي تستخدم في بلدان حوض البحر الابيض المتوسط حيث يستعمل على نطاق واسع كمشهي وايضاً يزيد من قوة التحمل ومقو لجهاز المناعة والطريقة ان يؤخذ ملء ملعقة من الزعتر وتذر فوق الطعام أو تخلط مع زيت زيتون أو زيت سمسم ويؤكل مع الخبز

الشوفان والقمح والشعير Barly,Wheat,Oats

يؤخذ كميات متساوية من طحين الشوفان والقمح والشعير المنخول ثم تمزج معاً ويوضع وعاء على النار به ماء يوازي حجم الدقيق المخلوط وعند بداية الغليان يذر الدقيق فوق الماء ويحرك تحريكاً جيداً ويضاف الدقيق شئياً فشيئاً مع التحريك المستمر حتى تنتهي كمية الدقيق وتتكون عصيدة رخوة ثم يضاف لها قليل من عسل النحل الأصلي وتؤكل مع الوجبات أو منفصلة عنها وتعطى للأطفال بشكل أكبر لما فيها من فوائد جمة

عرق السوس Liquirice

لقد تحدثنا كثيراً عن عرق السوس وذكرنا أنه يحتوي مواد مشابهة للكورتيزون ولكنها لاتسبب الأعراض الجانبية التي يسببها الكورتيزون ويعتبر العرق سوس من افضل العقاقير في علاج أمراض الدم وعليه فإنه مفيد لعلاج فقر الدم (http://www.libyanyouths.com/vb/t73688.html) ولكن يجب عدم استعماله من قبل المرضى الذين يعانون من ارتفاع ضغط الدم[URL="http://www.libyanyouths.com/vb/t73688.html"] والجرعة من مسحوق جذور العرق سوس هي ملء ملعقة صغيرة على ملء كوب ماء بارد ويحرك جيداً ويشرب مرة واحدة في اليوم

ثمار الكبابة الصيني Cubaba

الكبابة الصينية تشبه في شكلها الفلفل الأسود إلا أنه يوجد بها بروز صغير في طرفها من ناحية السرة وتحتوي الكبابة الصيني على زيوت طيارة وقلويدات وتعتبر من أفضل المشهيات، حيث يؤخذ ملء ملعقة شاي من مسحوقها بعد كل وجبة كما أنها مهضمة ومهدئة

الكرفس Apium

الكرفس أحد النباتات المشهورة التي تستعمل مع السلطة أو يؤكل كما هو أو يعمل منه مسلوقاً والكرفس يحتوي على أهم المواد المفيدة لجسم الإنسان مثل فيتامينات أ،ب،ج وكذلك معادن الكالسيوم واليود والحديد والنحاس والمنجنيز، والماغنيسوم، والبوتاسيوم، والفوسفور، ويعتبر من فواتح الشهية المشهورة

الكمون Cumin

يعتبر الكمون من أشهر التوابل ومن أشهر المشهيات وأفضل طريقة لاستعمال الكمون كمشه هو ذر مسحوق الكمون على شرائح الطعام مع قليل من الخل

الشاكوريا الخضراء Chicory

من المعروف أن للشاكوريا الخضراء الطازجة تأثيراً لفتح الشهية ومعروف أن فقراء الفلاحين يعتمدون عليها كغذاء رئيسي مع الجبن وخاصة الجبن القديم المعروف "بالمش" ويمكن أكل أي كمية منها فهي مهضمة وفاتحة للشهية

أوراق الجوز Willow

تستخدم أوراق الجوز الطازجة كمشهية حيث تؤخذ قبضة اليد وتوضع في كوب ثم يضاف عليها ماء مغلي حتى يمتلئ الكوب ثم يقلب جيداً ويترك لمدة 15دقيقة ثم يصفى ويشرب على جرعات صغيرة بواقع 1/3الكوب مع كل وجبة غذائية

القرنبيط Cauli Flower

القرنبيط والذي يعرف أيضاً باسم القنبيط عبارة عن نبات شتوي ولايؤكل عادة مطبوخاً ويعتبر القرنبيط حسب الأبحاث من أكثر الخضروات تقوية للجسم نظراً لاحتوائه على الفوسفور ويجب عدم تناوله مع الفول السوادني لكي لايحدث انتفاخات او غازات في المعدة

القرفة CINNAMON

القرفة أو مايعرف بالدارسين من الاعشاب المشهورة كتوابل وهي تحتوي على زيوت طيارة واهم مركب فيها هو السنمالدهيد الذي يعزى إليه التأثير والقرفة مشهية جيدة حين يؤخذ مامقداره ملء ملعقة صغيرة من مسحوق القشرة ويضاف إلى وعاء به ملء كوب من الماء ثم يوضع على النار ويترك حتى يغلي ويحرك جيداً ثم يفرغ في كوب زجاجي ويمكن تحليله بملعقة عسل نحل ويشرب

الفجل Radish

ويفضل النوع الأحمر حيث تزاح الأوراق ويؤكل مع الوجبة مامقداره 4إلى 5فصوص ويجب أن يكون صغيراً وطازجاً وحذار من استعمال الفجل الهش من الداخل فهو عديم الفائدة ويعتبر الفجل من المواد التي تؤثر كمشهية للأكل ويحتوي على كميات كبيرة من الفيتامينات والأملاح المعدنية مثل الكالسيوم واليود والكبريت والحديد والمنجنيز يجب عدم استعمال الفجل من قبل الأشخاص الذين يعانون من ضعف في الجهاز الهضمي وكذلك مرضى الكبد

القسط الشامي Bryone

يستعمل جذور نبات القسط الشامي على نطاق واسع لفتح الشهية

أبو فروة Sweet Chestnut

يعرف أبو فروة بالكستنة وشاه بلوط وأبو فروة غني بالأملاح المعدنية مثل الكالسيوم والحديد والمنجنيز والفوسفور والكبريت وهو مفيد جداً في بناء الجسم يؤكل أبو فروة نيئاً أو مشوياً على الفحم أو داخل الفرن ويمنع تناوله من قبل المصابين بأمراض عسر الهضم والكبد والسكر ويعتبر أبو فروة من المنشطات الجنسية

المرامية -القصيعن Sauge

يستعمل القصيعن في بلدان حوض البحر الأبيض المتوسط كمادة مشهية للأكل حيث يؤخذ مامقداره قبضة اليد من النبات وتوضع في وعاء كبير نسبياً ثم يصب عليه ما مقداره 1/2لتر ماء مغلي ويغطى لمدة مابين 10- 15دقيقة ثم يصفى ويشرب منه فنجان بعد كل وجبة غذائية وخصوصاً عند الذهاب إلى النوم

المفتقة Muffattigha

وهذه الوصفة تستخدم للنحفاء الذين يرغبون في السمنة وهي تتكون من الحلبة البلدي والحبة الخضراء وحبة البركة وعسل النخل النقي وتعرف لدى عطاري مصر بمربى (خرزة البقر) أو مربى الخرزة والطريقة أن تؤخذ أجزاء متساوية من الحلبة والحبة الخضراء وتسحق جيداً ثم يضاف لها ملء ملعقة صغيرة من حبة البركة وتخلط بالعسل الطبيعي حتى تكون على هيئة عجينة رخوة ويؤخذ منها يومياً ملعقة في الصباح وأخرى في المساء مع حفظها في الثلاجة

ازهار حشيشة الدينار HOPS

تستخدم ازهار حشيشة الدينار في بلاد الشام كفاتحة للشهية حيث يؤخذ ملء ملعقة كبيرة من مسحوق العشبة وتنقع في ملء كوب ماء لمدة 12ساعة ويتناول منه الشخص ملء فنجان قبل تناول الوجبات، يحضر منقوع اليوم التالي قبل موعده بمدة اثنتي عشرة ساعة، وهكذا

الحمص cicer

بذور الحمص غنية جداً بالمواد البروتونية والأملاح المعدنية مثل البوتاسيوم والفوسفور والكبريت والكالسيوم والحديد وهو مفيد جداً ومسمن في نفس الوقت ويتناول الشخص حفنة واحدة من الحمص في منتصف وجبة غذائية فقط خلال اليوم الواحد ويجب عدم تناول الحمص أو الإفراط في تناوله من قبل اصحاب المعد الضعيفة حيث إنه ثقيل الهضم

الخردل Mustard

إن استعمال بذور الخردل المسحوقة باعتدال مع الطعام يفتح الشهية ويتناول الشخص الخردل بمعدل خمس حبات فقط قبل وجبة الغذاء ويمكن طحنها ورشها فوق الأرز أو الخضار أو السلطة يجب عدم استخدام الخردل من قبل المصابين بعسر الهضم وأمراض الكبد والقلب والروماتزم مهما كانت الأسباب

ahmednour
02 - 01 - 2012, 00:03
فعلا باب رائع ومفيد جعله الله فى ميزان حسناتك
وشكرا لكى على الرد
رامى توفيق

nosa_aic
02 - 01 - 2012, 11:55
فعلا باب رائع ومفيد جعله الله فى ميزان حسناتك
وشكرا لكى على الرد
رامى توفيق

الشكر لله اخى الفاضل

مع تمنياتى لحضرتك و لكل مريض بالشفاء التام ان شاء الله

nosa_aic
02 - 01 - 2012, 20:04
عصير البرتقال يقى من حصوات الكلى


أفادت دراسة [/URL] أمريكية حديثة أن شرب كوب من عصير البرتقال يوميا يساعد على الوقاية من حصوات الكلى بشكل أفضل من أي نوع من العصائر الحمضية الأخرى.


[URL="http://www.libyanyouths.com/vb/t1005.html"]http://pms.panet.co.il/online/images/articles/2007/12/08-12-07/009_2_1.jpg (http://www.libyanyouths.com/vb/t1005.html)

وتتكون حصوات الكلى المؤلمة عندما يتركز البول مما يؤدي إلى تجمع الأملاح المعدنية والمواد الكيميائية الأخرى بعضها مع بعض مكونة بلورات. وبمرور الوقت تتراكم هذه البلورات مكونة حصوة. وقد ثبت أن زيادة أملاح السترات التي توجد في عصائر الفواكه الحمضية تمنع تكون مثل هذه الحصوات.

وقام فريق البحث في المركز الطبي بجامعة تكساس بمقارنة عصير البرتقال بعصير الليمون، حيث تبين لهم أن عصير البرتقال رفع مستويات أملاح السترات في البول وقلل تراكم البلورات بصورة أفضل من عصير الليمون.

nosa_aic
02 - 01 - 2012, 20:36
اسباب التهاب اللوزتين و طرق العلاج الملائمة


التهاب اللوزتين [/URL] هو مرض ناتج في الغالب عن بكتيريا من فصيلة ستريبتوكوكوس . وفي بعض الحالات يمكن ان يتعلق الامر بمرض فيروسي.



بالرغم من ان المرض يبدو بسيطاً، وتقريباً الجميع قد اصيب به، فإن الامر يمكن ان يكون خطيراً جداً، وخاصة اذا لم يتم علاج المرض.

ما هي أعراض المرض؟

- ألم في الرقبة، وخاصة اثناء البلع، السعال، الاحمرار، الم وتورم اللوزتين. كذلك يمكن ان يظهر صداع والم في الحلق، حمى، ورجفة، بالاضافة الى انسداد الانف، انتفاخ العقد اللمفاوية

من المعرض للاصابة بهذا المرض ؟

- في الغالب يصيب الاطفال، ويصيب ايضا الكبار. اولئك الذين عانوا من التهاب اللوزتين في الصغر، فان عظامهم تصبح ضعيفة في الكبر، وكذلك المفاصل والقلب. وهذا الامر ناتج عن ان البكتيريا المسببة لهذا المرض تستقر في المفاصل او عضلة القلب. ويمكن ان تظهر المتاعب والاعراض بعد مرور 20 عاماً، وتكون مزعجة جداً.

الوقاية والعلاج

تكمن الوقاية في رفع نسبة المناعة. العلاج التقليدي عبارة عن المضادات الحيوية. في الحالات المتكررة لالتهاب [URL="http://www.libyanyouths.com/vb/t2635.html"] (http://www.libyanyouths.com/vb/t2635.html) اللوزتين المزمن، فان الحل يكون باجراء عملية جراحية.

nosa_aic
03 - 01 - 2012, 07:24
الفيتامينات تحافظ على أدمغة المسنين (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/143435-%D8%A7%D9%84%D9%81%D9%8A%D8%AA%D8%A7%D9%85%D9%8A%D 9%86%D8%A7%D8%AA-%D8%AA%D8%AD%D8%A7%D9%81%D8%B8-%D8%B9%D9%84%D9%89-%D8%A3%D8%AF%D9%85%D8%BA%D8%A9-%D8%A7%D9%84%D9%85%D8%B3%D9%86%D9%8A%D9%86)


http://www.alwafd.org/images/news/924936988l8nwknjm.jpg



وجدت دراسة جديدة أن المعدلات العالية لبعض الفيتامينات والمغذيات عند المسنين تجعلهم أفضل في الاختبارات المتعلقة بالتفكير وتحافظ على دماغهم من التقلص.
وذكر موقع أميركي أن الباحثين بجامعة "اوريغون هلث اند ساينس" وجدوا أن المسنين الذين لديهم معدلات عالية من الحمض الدهني "أوميغا3" والفيتامينات "ب" و"ج" و"د" و"هـ" ، في دمهم يسجلون أداءً أفضل بالنسبة لقدرات التفكير، ويميلون ليكون لديهم أدمغة أكبر حجماً.
وتبيّن أن المسنين الذين ترتفع لديهم معدلات الدهون التقابلية وهي نوع شائع من الدهون غير المشبعة، في دمهم يكون أداؤهم أسوأ باختبارات التفكير مقارنة بمن تنخفض لديهم هذه الدهون، كما أنهم يعانون من تقلص أكبر بحجم الدماغ وتتحد مع بعضها لحماية صحة الدماغ.
وقال الباحث المسؤول عن الدراسة جين بومان أن الفيتامينات للأشخاص الذين لديهم معدلات عالية، تبدو بأنها تعمل معاً إلى مستوى معيّن، مضيفا أن المعدلات العالية من الفيتامينات المذكورة مرتبطة بوظيفة إدراكية أفضل وحجم دماغ أكبر.
وقاس الباحثون معدلات أكثر من 30 مادة مغذية في الدم لدى 104 أشخاص في عمر معدله 87 عاماً جميعهم مثقفين وغير مدخنين، ولديهم قليل من الأمراض المزمنة ولا يعانون من أية مشكلات بالذاكرة والتفكير. وأخضع الباحثون الأشخاص لصور دماغية لقياس حجم الدماغ، وتبيّن بعض الضمور
والتقلص فيه لدى التقدم بالسن.
ووجد العلماء أن بعض المغذيات تؤثر على مختلف نواحي التفكير وبتناول هذه المغذيات فإن أداء من يتناولونها أفضل في اختبارات الانتباه ومهارات الإبصار والإدراك العام، كما لديهم
أدمغة أكبر.

nosa_aic
03 - 01 - 2012, 07:32
***السـقوط الوهـــمي***



http://im18.gulfup.com/2011-11-07/132070929511.jpg (http://www.libyanyouths.com/vb/t124585.html)





من منا لم يجرب الشعور بالسقوط من مكان مرتفع عند بدء الدخول في النوم واستيقظ بعد ذلك على وقع اهتزاز جسمه ليجد نفسه يرقد في فراشه ولا يوجد شئ حوله...

الكثيرين قد مر بهذه التجربة وقد تسأل في نفسه ؟
ماذا حدث لي خلال النوم وهل كنت أحلم أم أن هناك أمراً غير طبيعي حدث في جسمي وسبب لي ذلك الإحساس ...

ما تفســـــيره؟

هذه ظاهرة معروفة لدى المختصين في طب النوم وتعرفـ باهتزازات بداية النوم
"""""hypnic jerk """"
وهي عباره عن حركات لاإرادية تحدث عند الانتقال من اليقظة إلى النوم ويشعر خلالها الشخص بأنه يسقط وأيضا يصاحبها حركة مفاجئة في الجسم قد يشعر بها الشخص المصاحب له في السرير...

:: :: ::

وهذه الحركة لا تحدث في مرحلة الأحلام ولكن تحدث عند الانتقال من الاستيقاظ إلي المرحلة الأولى من النوم وهي المرحلة الانتقالية التي يمر بها النائم قبل التقدم إلى مراحل النوم المتقدمة أي أنها تحدث بين ...... (((( النوم واليقظة )))

وهذه الاهتزازات التي تصاحب الشعور بالسقوط تؤدي ألي الاستيقاظ من النوم والشعور بلحظات من الفزع والخوف وبعدها يدرك الشخص انه ربما كان يحلم .... وعاده لايجد الشخص صعوبه في الرجوع للنوم مره أخري....

ولايعرفـ السبب الحقيقي لهذا الظاهرة ! ولكن توجد عدة نظريات و منها أن هذه الظاهرة ناتجة عن الارتخاء الطبيعي لعضلات الجسم ... أي أثناء الدخول في النوم تتراجع درجه حراره الجسم ويبدأ القلب بالتباطئ ويترك الدماغ الواعي السيطره تدريجيا علي العضلات .... وهذا الإجماع العام لمحركات الجسم الأساسيه تجعل العضلات الكبيره تتقلص وفي أثناء ذلك يقوم الدماغ بإختراع "" حلم صغير"" تشعر فيه وكأنك تسقط مثلا من علي منحدر عالي ...

:: :: ::

وتزداد الظاهرة عند الأشخاص المنهكين أوالذين حرموا من النوم لساعات طويلة .،أي الأشخاص المنهكين الذين يحاولون مقاومة النوم . والبقاء يقظين لأوقات طويله ل 24 ساعه وفوق...
وكذلك تزداد عند النوم في أوضاع غيرمناسبة مثل النوم جالسا أو بصوره غير مريحه ومن المحتمل حدوتها مره إلي مرتين في الليله ولكن أغلبها تحدث علي فترات متباعده....

إن هذه الظاهرة تصيب جميع الفئات العمرية بلا استثناء وتعتبر ظاهرة حميدة وعاديه ولاتحتاج لأي علاج ولاخوف منها وبالنسبه للأشخاص الذين يعانون من تكار المشكله فعليهم تفادي ما قد يكون وراء هذه الظاهره وهو بتجنب الإجـــهاد والٍســـهر

nosa_aic
03 - 01 - 2012, 07:53
خل التفاح للتخسيس

من أفضل الطرق للتخسيس وهي طريقة سهله وليس لها أي مضاعفات ، كما أنها مضمونه بس تحتاج صبر شوي .
* ملعقة كبيرة من خل التفاح قبل كل وجبة *هذه الطريقة ممتازة خصوصا للكرش فهي تؤثر فيه أكثر من بقية أجزاء البدن ، جربوا لمدة شهر ثم اصعدوا الميزان ولا تنسوا تدعوا لي .
بس المهم يكون خل التفاح يكون طازج .

- إن إضافة ملعقة طعام من خل التفاح الطبيعي في كأس ماء مرات معتدلة وشربه في أول اليوم «بعد الاستيقاظ» من النوم - إذا لم تكن تعاني من الحموضة أو القرحة - سوف يساهم بشكل جيد في حرق الدهون وهذه الطريقة يجب ان تكون مصاحبة لبرنامج وحمية غذائية وتمارين رياضية فخل التفاح لن يقدم فوائد كثيرة لتخفيف الوزن إلاّ إذا تم إدخال الطرق الأخرى معه ويجب الحرص على عدم شرب الخل مباشرة بل يجب خلطه بالماء كما ان خل التفاح له فوائد كثيرة تفيد الجسم ويمكن خلطه مع السلطة وعموماً لا يوجد مشاكل للاستمرار عليه إذا تم ذلك بالطريقة السابقة.

عرف الخل قديماً كمادة شافية لكثير من الأمراض مثل تسكين آلام الأسنان وكعلاج لبعض الأمراض المستعصية مثل الكوليسترول والصداع المزمن وغيرها من الأمراض الأخرى فهو يقضي على كثير من الميكروبات الضارة. ويخلص الجسم من بعض الدهون الضارة.
ويرى خبراء التغذية أن الناس قديماً كانوا يقومون بإعطاء الطيور قليلاً من خل الطعام قبل ذبحها، لتطهير أجسامها من المواد الدهنية الزائدة، وهذا ما دفع البعض إلى تناول خل الطعام بكميات كبيرة أملاً في التخلص من نسبة كبيرة من دهون أجسامهم.
وأشار الخبراء إلى أنه إذا كان خل التفاح يقلل من نسبة الدهون بالجسم فهو يساعد الجسم في التعامل مع الدهون بصورة اكثر كفاءة لكونه يحول الدهون المعقدة الى دهون بسيطة يسهل تفكيكها وهضمها. وهو أيضا يزيل الخمول ويوفر حالة من النشاط الجسماني. وهناك العشرات من الفوائد الأخرى للخل.
ويذكر أن الإفراط في تناوله يؤدي إلى كثير من المشكلات الصحية مثل: التهابات المعدة، والكبد، وتغيير حموضة الدم.
وأضاف العلماء أنه يمكن تناول كمية قليلة من خل الطعام تقدر بملعقة أو اثنتين يومياً، توضع على السلطة الخضراء للعمل على تقليل الدهون في الجسم بدون أضرار صحية وينصح دائما بأخذ الخل بكميات صغيرة وضمن الوجبات الغذائية وليس على معدة خاوية. للخل استخدامات اخرى

ويستخدم الخل في علاج الكثير من الأمراض منها:

* خفض الوزن:

يستخدم خل التفاح لخفض الوزن باستخدام ملعقة أكل خل في كوب ماء دافئ ويشرب المحلول بعد الوجبة مع تناول ثمرة الكريب فروت للمساعدة على إذابة الدهون.

* لآلام الحلق:

يستعمل خل التفاح لعمل غرغرة بنسبة ملعقة صغيرة من الخل في كوب ماء، ويؤخذ كل ساعة وبعد التحسن كل ساعتين.

* دوالي الساق:

يصب قليل من الخل في اليد وتدلك به الاوردة المتمددة في الساق، مرة صباحا وأخرى في المساء، مع شرب ملعقتين صغيرتين من الخل في كوب من الماء، مرة صباحا واخرى مساء، وبعد شهر يبدأ التحسن.

* الكوليسترول:

يعطي الخل لمن يعاني من الارتفاع في نسبة الكوليسترول، لانه يخفض نسبة الكوليسترول في الدم. وتوضع ملعقة طعام من خل التفاح في كوب ماء دافئ ويشرب.

* في حالة القيء والاسهال:

يشرب لمدة 3 4 ايام، وذلك بمقدار ملعقة طعام خل لكل كوب ماء.

* للسعال:

يجهز مزيج مكون من خل التفاح والعسل والجلسرين. فإذا كان السعال شديدا يؤخذ كل ساعتين. ويعطى الاطفال ربع ملعقة صغيرة كل ثلاث ساعات.

* للصداع المزمن:

يوضع مزيج متساو من الخل والماء في إناء فوق النار إلى ان يغلي ويستنشق البخار المتصاعد سبع مرات، ويمكن وضعه كمادة سميكة على الجبهة مبللة بمزيج ثلثه من الخل والباقي من الماء.

* للحروق:

يدهن مكان الحرق بخل التفاح فهذا يمنع ظهور الفقاعات.
يمكن شراء خل التفاح من محلات العطارة الكبيرة والمعروفة لضمان جودته

nosa_aic
04 - 01 - 2012, 08:20
الأشخاص الذين يستيقظون باكرا هم أكثر صحة ورشاقة



أجرى باحثون بريطانيون دراسة علمية حديثة أثبتت أن الاشخاص الذين يستيقظون في ساعة مبكرة بالنهار بشكل يومي يحظون بصحة أفضل ويتمتعون بأجسام رشيقة ونحيفة عن غيرهم من الذين يبدأون يومهم في ساعة متأخرة.
وقال الباحثون في جامعة "روهامبتون" البريطانية أن الاستيقاظ في ساعة مبكرة يجعل الانسان اكثر صحة وسعادة حيث التمتع بجسد رشيق وممشوق طوال الوقت مما يجعل الاقدام على أداء مهام العمل أمرا ممتعا. أضاف الباحثون أن الاشخاص الذين يقضون ساعات طويلة في السهر أمام جهاز التلفزيون غالبا ما يضيعون وجبة الافطار والتي تعد أهم الركائز للحصول علىصحة جيدة وجسم مثالي.

nosa_aic
04 - 01 - 2012, 08:47
لماذا تصدر المعدة اصواتا ؟

غالباً ما تكون قرقرة المعدة عبارة عن صوت يصدر في البطن. وهي أمر طبيعي الحدوث وليس مؤشراً على اضطرابات هضمية. إن ذلك إشارة من المعدة تدل أنها هضمت الغذاء أو تريد هضمه.
غالباً ما تصدر المعدة الخاوية هذا الصوت لأن عضلات جدار المعدة تتقلص دافعة الهواء الموجود في المعدة نحو الأمعاء، تماماً مثل آلة القربة الموسيقية؛ أي أن المعدة تدفع محتوياتها إلى خارجها. كما أن الماء والهواء والغذاء يُضغط عبر فتحة ضيقة إلى الأمعاء، ما يسبب صوت القرقرة. وكلما طال الوقت الذي تكون فيه المعدة خاوية كلما ازدادت تقلصات العضلات. تقوم أعصاب جدار المعدة بنقل إشارات إلى الدماغ الذي يُفسر على أنه شعور بالجوع. يظن العلماء أن هذا نوع من تنقية الجسم الذاتية لإبعاد الجراثيم الناتجة عن بقايا الطعام القديم.

آلية الجوع والرغبة في الأكل عملية معقدة تشترك في أجزاء منها عدة هرمونات ومناطق معينة في الدماغ. فحينما لا يأكل الإنسان لفترة طويلة نسبية فإن مركز الأكل في جزء من الدماغ ينشط ويرسل إشارات الى المعدة والأمعاء. ومن ثم يحصل إفراز للعصارات الهاضمة وتنشيط حركة الأمعاء كتهيئة لاستقبال الطعام أو على أمل ذلك ومن هنا يلاحظ البعض قرقرة البطن عند ذكر الأكل أو شم رائحته أو رؤيته.
قرقرة البطن في حال عدم وجود أعراض أخرى كالغازات أو الإسهال أو الإمساك أو ألم البطن لا أهمية طبية لها. لكنها قد تكون أحد الأعراض المصاحبة لأمراض الجهاز الهضمي والكبد كالقولون العصبي أو التهابات القولون المزمنة أو نتيجة الالتصاق بين أجزاء الأمعاء وغيرها.
وتلعب بعض أنواع الغذاء المؤثرة على حركة الأمعاء دوراً في زيادة أو نقص قرقرة
البطن، فالمشروبات المحتوية على الكافيين كالقهوة والكولا تزيد من حركة الأمعاء والبابونج والنعناع تقلل منها.

كيف تقاوم اصوات المعدة وتقلل من إصدارها ؟

أولاً يجب ألا تملأ بطنك بالطعام ويفضل تناول عدة وجبات محدودة بدلاً من ثلاث وجبات
ثقيلة . كما ينبغي أن تمتنع عن العادات التي تؤدي لبلع كميات كبيرة من الهواء .

( 1 ) امضغ طعامك على مهل :

كلما تأنيت في مضغ الطعام وتذوقه مع غلق الفم أثناء ذلك قلت فرصة بلع الهواء ، وقلت
بالتالي القرقرة .

( 2 ) تجنب المشروبات الساخنة جداً :

تجنب المشروبات كالحساء الساخن تضطرك " لشفط " الهواء وبلعه أثناء تناولها
لمحاولة تبريدها

( 3 ) تجنب الأغذية المحملة بالهواء :

ونقصد بذلك الأغذية المضروبة في الخلاط أو المخفوقه .

( 4 ) لا تبالغ في القيام بالتجشؤ والتثاؤب :

التجشؤ والتثاؤب كلاهما يؤدي لبلع كمية من الهواء .. ولكن لا شك أن المبالغة
في القيام ب" التجشؤ " كما يعتاد البعض على ذلك يؤدي لبلع أكبر كمية أكبر من الهواء .
والتجشؤ في حد ذاته عمل إيجابي لأنه يقلل الانتفاخ بدفع جزء من الغازات للخارج ولكن المبالغة في القيام به تؤدي لنتيجة عكسية .

( 5 ) تناول ثمرة موز قبل حضور الإجتماع :

قرقرة البطن قد تمثل أحياناً مشكلة على جانب كبير من الإحراج كأثناء حضور
اجتماع أو الالتقاء بشخصيات بارزة أو إدارة حوار هام ، وفي مثل هذه الحالات
ننصح بتناول ثمرة موز قبل الموقف أو الاجتماع المرتقب لتقليل أصوات البطن.

أصوات "القرقرة" التي يسمعها أحدنا في معدته لا تزال تحير الباحثين، وثمة من اختصر الموضوع وقال بأن في البطن عصافير، وأنها تزقزق حينما تشكو إلينا المعدة من جوعها، والأصوات هذه، وإن كانت تُسبب إحراجاً للبعض، أو يعتبرها البعض منبهاً لضرورة الأكل، إلا أنه من النادر جداً، ان يرى الاطباء أي أهمية صحية أو مرضية لها. ومعرفتنا بأن المصدر الأساسي لصدور هدير هذه الأصوات هو حركة الغازات في قنوات الجهاز الهضمي، لم تُعطنا إجابات مقنعة حول السؤال: لماذا نجدها مختلفة في درجات حدة أصوات ها، وفي وتيرة تكرار سماعنا لها، وفي أماكن ظهورها، وفي معاناة الناس منها في أوقات دون أخرى؟ وفي غير ذلك.


لذا تظل هناك جوانب مثيرة للتساؤلات حول كيف، ومن أين تدخل الغازات إلى الجهاز الهضمي؟ ولما ومن أي الطرق تخرج منه؟ وما معنى وجودها في الأجزاء المختلفة من الجهاز الهضمي؟.. وهل لها علاقة بالأمراض أو مظاهرها؟ وهل يتسبب وجودها أو كتم إخراجها بأضرار صحية؟.. وغيرها من التساؤلات التي تُؤكد شيئاً واحداً، وهو أن علاقة الغازات بالجهاز الهضمي أوسع من مجرد التسبب بسماعنا أصوات مرورها وتنقلها.

nosa_aic
04 - 01 - 2012, 08:59
الأكتئاب وأنواعه


http://up.arab-x.com/Jan11/cLp96946.jpg (http://www.libyanyouths.com/vb/t71080.html)


يعتبر الاكتئاب من الأمراض المصاحبة لتقدم الحضارة وتسارع الحياة المصاحب لها، فهو معلم من معالمها، يصاب به الجميع رجالا ونساء، ولا يستثني أحدا، وقد أظهرت تقارير منظمة الصحة العالمية في دراساتها حول مرض الاكتئاب في العالم أن هنالك على الأقل أكثر من100 مليون شخص حول العالم يعانون من اضطرابات المزاج والاكتئاب.

وهو مرض شائع فى جميع المجتمعات وخاصة الصناعية منها، وأن نسبة الإصابة به هي 20:1 من كل شخص في المجتمع إلا أنه يصيب النساء بنسبة أعلى من الرجال تصل إلى 1:2.

وللإطلاع على أهم الجوانب في هذا الموضوع نبدأ بتعريف الاكتئاب:

تعريف الاكتئاب

الاكتئاب مرض نفسي مزمن وشامل، يؤثر على جسم الإنسان ومزاجه وأفكاره، ويعتبر من المشاكل الصحية الرئيسية في المجتمعات الحديثة، وأحيانا لا يتناسب مع أي مؤثر خارجي يتعرض له المريض.

ومن أهم أعراض هذا المرض شعور المريض بالحزن الشديد، والفراغ والملل والوحدة وعدم القيمة، وكثيرا ما تنتاب الأشخاص المصابون بالاكتئاب حالات من الزهد وعدم الشعور بمتعة الحياة، ويصاحبه تعكر في المزاج، لكن هذه المشاعر لا تعيق الإنسان عن المضي في حياته الطبيعية، لكنه يصعبها فقط ويجعلها تبدو أقل قيمة.

أسباب الاكتئاب

هناك عوامل مباشرة تسبب الاكتئاب، وهناك عوامل تحفز حدوثه لدى المصاب، فتتداخل العوامل مع بعضها مؤدية للإصابة، ومن أهم هذه الأسباب والعوامل:

• اختلال التركيب الكيميائي في مخ المريض:

أي تختل نسب النواقل العصبية ( النورإبينيفرين، والسيراتونين، والجابا )، ومن الطبيعي أن تختلف نسب النواقل العصبية في مخ الإنسان الطبيعي من وقت لآخر، فهي تختلف في وقت الحزن والكرب عنها في وقت الخوف، أو وقت الفرح والسرور، لكن هذه الاختلافات تعتبر طارئة وغير دائمة، أما مريض الاكتئاب فإنه يعاني من اختلالات وتذبذبات دائمة في نسب النواقل العصبية الموجودة في المخ.

• الظروف البيئية والاجتماعية المحيطة بالمريض:

مثل حالات وفاة الأعزاء أو الشعور بالوحدة أو المعاناة من أمراض مزمنة..، فهذه تعتبر مجرد محفزات لحدوث حالة الاكتئاب لدى المريض وليست مسببات أساسية للمرض، بدليل أنه بعد زوال هذه العوامل تزول حالة الاكتئاب لدى المريض.

• العامل الوراثي:

وجد أن نسبة حدوث مرض الاكتئاب تزداد عند التوائم المتطابقة( التوائم التي تنتج من تلقيح حيوان منوي واحد لبويضة واحدة ) بحيث تصل هذه النسبة إلى حوالي 70% وكذلك تبلغ نسبة الإصابة بين الأقارب من الدرجة الأولى حوالي 20% .

• العوامل الهرمونية وأمراض الغدد الصماء:

قد تساهم في حدوث مرض الاكتئاب وخاصة تلك الاضطرابات التي تصيب الغدة النخامية.


ولمرض الاكتئاب أنواع عدة أهمها:

أولا: الاكتئاب الشديد:

يصيب هذا النوع جميع الأعمار، إلا أن الإصابة به تزداد عند الأشخاص ما بين عمر 25-44 سنة، كما أنه قد يحدث بشكل كبير عند كبار السن في مرحلة الشيخوخة وخاصة هؤلاء الذين يعيشون في مراكز العناية بالمسنين.

وتتميز أعراض هذا النوع بأنها تزداد في فترة الصباح وتقل تدريجيا أثناء اليوم، والنوبات الشديدة من الاكتئاب من الممكن أن تحدث مرة أو مرتين أو عدة مرات فى حياة المريض،

وتتلخص أعراض هذا الاكتئاب بما يلي:

• تعكر المزاج.
• عدم القدرة على الاستمتاع بمباهج الحياة.
• فقدان الشهية وخسارة الوزن.
• الأرق أو النوم الزائد.
• الشعور بالضيق.
• الشعور بالتعب والإرهاق بشكل دائم.
• الشعور بالذنب.
• انكسار النفس وهبوط الروح المعنوية.
• تدني القدرة على التفكير والتركيز.
• تكرر فكرة الموت والانتحار عند المريض.
• محاولة الانتحار.

ويعتبر الشخص مصابا بالاكتئاب إذا توفرت خمسة أعراض أو أكثر من الأعراض السابقة الذكر.


ثانيا:الاكتئاب ثنائي القطب:

نوع من أنواع الاكتئاب الذي يتميز بحالات من الاكتئاب والانشراح (الهوس)، التي تصيب المريض بشكل دوري، ولوحظ أن العامل الوراثي يساهم في حدوث ما نسبته 80-90% من حالات هذا المرض.

وقد تم تفسير حدوث حالات الاكتئاب والانشراح لدى المريض بشكل متتابع بتذبذب النواقل العصبية وخاصة النورإبينيفرين في جهاز المريض العصبي، وقد يكون التغير أو التقلب في مزاج مريض الاكتئاب ثنائي القطب سريعا وحادا، ولكنه في الغالب يكون بصورة متدرجة .

بالإضافة إلى العوامل الوراثية المذكورة وتأثيرها، هنالك عوامل أخرى قد تساهم في الإصابة بهذا الاضطراب مثل الاضطرابات الهرمونية في الغدد الصماء، خاصة الغدة النخامية واضطرابات الغدة الدرقية، وكذلك الإصابات الدماغية خاصة حوادث الطرق وإصابات الرأس.

وقد ذكرنا الأعراض التي يمر بها المريض خلال فترات الاكتئاب، أما أعراض فترات الانشراح والهوس فتتمثل فيما يلي:
1. شعور المريض بالعظمة والثقة الزائدة بالنفس.
2. الأرق وتدني القدرةعلى النوم.
3. التحدث بتكبر وتعال.
4. تشوش وتشتت الأفكار.
5. الحركة الزائدة.
6. التورط ببعض النشاطات الخطرة.

nosa_aic
04 - 01 - 2012, 19:57
رغم ان مكونات الدم لدى جميع البشر هي نفسها الا انه تختلف تحت المجهر من شخص الى اخر. في مطلع القرن العشرين العالم الاسترالي المعروف باسم ((كارل لاندستينر) صنف الدم تبعا لما هو مختلف فيه و على هذا الانجاز استحق جائزة نوبل.
وهو اول من أكتشف فصائل الدم
http://www.univie.ac.at/archiv/tour/img/LANDSTEINER_7CM.jpg
صورة العالم كارل لاندستينر

توجد فصائل أربع للدم وان كثير من الناس تخفى عليهم أسرار فصائل الدم و ثقافتهم لا تتجاوز معرفتهم أنّ هناك
فصائل أربع للدم
استطاع الطبيب النمساوي بعد دراسة عينات عديدة لدماء البشر إلى إكتشاف نوعين من البروتينات المعروفة علمياً بـ (( الأنتيجينـــــات )) رمز لأحدهما بـ (( A )) و للآخــر بـ (( B )) ...

فإذا اجتمع الأنتيجينان A و B في الدم كانت الفصيلة ... AB ..

و إذا خلا منهما الدم كانت الفصيلة ... O ..

إذا ظهر في الدم أنتيجين A وحده كانت الفصيلة ... A ..

إذا ظهر أنتيجين B وحده في الدم كانت الفصيلة ... B ...

@ دم AB ] يستقبل جميع الفصائل و لا يعطي إلا فصيلة AB ..

@ دم A يستقبل من O و A و يعطي AB و A ..

@ دم B يستقبل من B و O و يعطي AB و B ..

@ دم O يستقبل O فقط و يعطي جميع الفصائل ...


http://www.nlm.nih.gov/medlineplus/ency/images/ency/fullsize/9125.jpg

حالة نقل الدم:الصورة التالية توضح قابلية كل فصيلة دم ..
http://www.transweb.org/journey/recip_journey/kidney/kidney_blue/kb_images/kb_14.gif
أما (( الســــالب )) و (( الموجب )) فتخص مادة بروتينية إضافية إن ظهرت في الدم تكون الفصيلة موجبة و إذا لم تظهر تكون الفصيلة ســـالبة و الفصائل الموجبة أكثر انتشاراً لأنها توّرث كصفة سائدة و من هنا تكون الفصائل السالبة نادرة ...

بعامل الريسس ( Rh ) .


تغير مفهوم فصائل الدم بعد اكتشاف عامل ريسس و أصبحت عملية نقل الدم لا تتطلب معرفة فصائل الدم الرئيسية فحسب

بل تتطلب أيضا معرفة نوع الدم من حيث كونه موجبا أو سالبا بالنسبة لعامل ريسس .

ومن البديهي أنه يمكن تجنب حدوث مضاعفات نتيجة نقل الدم اذا كان كل من المعطي و المستقبل موجبا بالنسبة

لعامل ريسس أو كان الاثنان سالبين بالنسبة لهذا العامل .

كما يمكن نقل دم انسان سالب الريسس الى انسان موجب الريسس بدون الخوف من حدوث أية مضاعفات .

وهناك أهمية خاصة لعامل ريسس اذا كان دم الزوج موجب الريسس , ودم الزوجة سالب الريسس وحدث حمل

فان الجنين قد يحمل عامل ريسس .

الكلام مطول ولكن أحببت أن أعرفكم بعامل الريسس , فلو كان دم الزوجة موجب B+ و دم زوجك B+ فليس هناك أية مشاكل

بالنسبة للحمل باذن الله .

المشكلة لو كانت فصيلة دم الزوجة بالسالب , ولو أنها لا تعتبر مشكلة بالنسبة للطفل الاول
ولكن بعد الولادة يتم حقن الزوجة بمصل خوفا من أن يتكون في جسمها أجسام مضادة خصوصا

لوحصل انتقال لكرات الدم الحمراء من دم الجنين الى الأم لأن الأجسام المضادة تسبب الاجهاض في الحمل الثاني

لأنها تعتبر الجنين دخيل خصوصا لو كان دمه موجب مثل الأب أما لو كان سالب مثل الأم فلن يحدث اجهاض

http://www.mybloodyourblood.org/images/hs_images/b_bloodtypes_01.jpg


1. إذا الأم Rh سلبية والأب Rh إيجابي، جنينهم قد يكون Rh إيجابي أو Rhسلبي
2. إذا الجنين Rh إيجابي، يمكن أن يكون هناك مشكلة إذ يخلط الدم حامل Rhالجنيني مع Rh دم الأم السلبي
3. إذا لم يعالج دم الأم سيجعل الأجسام المضادة التي تهاجم الدمّ حامل Rhالجنين4. هذه الأجسام المضادة يمكن أن تسبب مشاكل صحية للجنين. تتضمن مشاكل في الدم أو الموت

و نظــام الجهاز المناعي في الجسم عجيبٌ فريد فهو يكوّن أجساماً مضادة لأي بروتين غريب يصل للدم و هذا ما يفسّر لنا عدم إمكانية نقل دم A لآخر دمه B أو العكس ..
كما أنّ مثلا .. O السالبة تعطي O الموجبة لكن العكس غير صحيح فلا يمكن لـ O الموجبة أن تمنح الـO السالبة لوجود تلك المادة البروتينية الإضافية فيستنكرها جهاز المناعة فتتكون أجسام مضادة لها فيحدث ما يشبه الحرب بين جهاز المناعة و تلك الجسيمات ...
إذاّ الفصائل السالبة تعطي الموجبة و ليس العكس مع بقاء آلية النقل كما ذكرت سابقا ...

أضــــف لمعلـــــوماتك ..
===================
http://r22.imgfast.net/users/2211/19/58/40/smiles/189455.gif
@ O كريمة و AB بخيلة ...... لماذا ..؟!!
حاول أن تستنتج السبب .....!!!

@ O السالبة لا تقبل إلا نوع واحد من الدم ( فصيلة واحدة فقط تناسبها )...!!
ما هي هذه الفصيلة ..؟!!!

@ إذا تزوج رجل بامرأة و كانت فصيلة أحدهما O و الآخر AB فأبناؤهما ستكون فصائل دمهم إما A أو B و من المستحيل أن يكون أحد الأبناء مشابها لأحد أبويه في فصيلة الدم أي لن يكون في الأبناء من يحمل فصيلة دم AB أو O ...

@ إذا كان الزوجان كلاهما AB فأبناؤهما AB .. و إن كان كلاهما O فالأبناء كلهم O بإذن الله ...

@ إذا كان الأبوان كلاهما A فالأبناء A أو O .. و إن كانا B فالأبناء B أو O .. بإذن الله ...

@ إذا كان أحد الأبوين AB فلا يمكن أن يكون أحد الأطفال O .. و العكس ..إذا كان أحدهما O فلا يمكن أن يكون أحدهما AB ..


فصيلة الدم نسبة نوع فصيلة الدم لدى البشر
http://r22.imgfast.net/users/2211/19/58/40/smiles/189455.gif

O + 40 %

O - 7 %

A + 34 %

A - 6 %

B + 8 %

B - 1 %

Ab + 3 %

Ab - 1 %
http://fc04.deviantart.com/fs46/i/2009/206/6/e/blood_TYPE_by_CHIN2OFF.jpg

- هــل تكشف فصيلة دمك عن شخصيتك ؟
http://r22.imgfast.net/users/2211/19/58/40/smiles/189455.gif
طبقًا لمعهد يابانيّ يبحث في نوعية فصائل الدّم أكدت الأبحاث أن

السمات الشّخصيّة التي تبدو على الأشخاص تتلاءم مع فصائل دمهم .

- لننظر كيف ذلك :


( الـفـصـيـلـة )


O - تريد أن تكون زعيمًا, وعندما ترى شيئ ما وتريد الحصول عليه

تواصل النّضال حتّى تناله .

أنت رائد, مخلص, عاطفيّ وواثق ؛ ومن عيوبك الغرور والغيرة وتميل

لتكون تنافسيّا جدًّا ....


( الـفـصـيـلـة )

A - تحب التناسق والتنظيم وتميل للسلام ؛ تتعامل بشكل جيد مع

الآخرين وحساس وصبور وحنون ؛ ومن عيوبك العناد وصعوبة الإسترخاء .


( الـفـصـيـلـة )


B - تحب الإستقلال - مستقيم و تحبّ عمل الأشياء بطرقتك الخاصة -

مبدع و مرن وتتأقلم بسهولة مع أيّ وضع ؛ لكنّ إصرارك على أن

تكون مستقلا ً أحيانا ً يمكن أن يتجاوز الحد و يصبح ضعفا ً ..


( الـفـصـيـلـة )


Ab - قوي و متماسك أنت بوجهٍ عام جيد و محبوب و دائما ً يطمئن

لك من حولك ... تتعامل بطبيعتك وبصدق ٍ وعادل ؛ ومن عيوبك أنك

متحفـِظ غير حاذق وتجد صعوبة فى إتخاذ القرارت .

nosa_aic
04 - 01 - 2012, 20:28
كيف تعرف بان احد الفيتامينات ناقص لديك؟ هذه هي احدى الطرق ..


اليك بعض الاعراض التي تمكن من معرفة اي من الفيتامينات الناقصة لديك، وعندما تعرف ما هو الفيتامين الذي ينقصك ، لك مجموعة من الغذاء ، الفواكة والخضروات التي تستطيع استبدال هذة النواقص بالفيتامين المناسب ... ما عليك الا ان تطبق ذلك




إذا كنت تعاني من:



* الالتهابات المتكررة وخصوصا في الجزء العلوي من الجهاز التنفسي.


* ظهور تقرحات في الفم .


* العشى الليلي.

* جفاف وتقشر الجلد
فأنه يوجد لديك نقص في فيتامين (( A ))وهو :

1- زيت كبد الحوت - الجبن - اللبن - القشدة
2- النباتات الخضراء و الملونة مثل السبانخ - الجزر - الخس - الكرنب - الطماطم - البقول - الخوخ - عصير البرتقال
...............


أذا كنت تعاني من :



* الاجهاد المتواصل.


* عدم القدرة على التركيز.

* تشقق الشفاه
* التحسس من الضوء .
* القلق المستمر.
* الارق
فأنه يوجد لديك نقص في فيتامين ((B )) وهو :



الخميرة -الكبد -اللحوم - صفارالبيض الخضروات -الفواكه -الفول السوداني -السبانخ -الكرنب -الجزر ..
.............


أذا كنت تعاني من :


* الاصابة المتكررة بالبرد .


* نزيف اللثة.

* عدم التئام الجروح بسهولة .
فأنه يوجد لديك[/URL] نقص في فيتامين (( c )) وهو :



الكبد - والطحال والموالح بكثرة و(عصير اليمون-البرتقل -اليوسفي) و الفرولة- الجوافة -الفجل -التفاح- الكرنب -البقدونس -الطماطم.

..................



أذا كنت تعاني من :



* آلام المفاصل آلام الظهر.


* تساقط الشعر.

فأنه يوجد لديك [URL="http://www.libyanyouths.com/vb/t54643.html"] (http://www.libyanyouths.com/vb/t54643.html) نقص في فيتامين (( D )) وهو :



زيت كبد الحوت -والقشدة -اللبن -صفارالبيض -وفي اشعة الشمس ...

.................



أذا كنت تعاني من :


* الشعور بالتعب عند اقل جهد .


* بطىء التأم الجروح.

فأنه يوجد لديك نقص في فيتامين (( E )) وهو :


الخضار الورقية كالخس والجرجير والبقدونس والسبانخ وزيت بذرة القطن وزيت الصويا وزيت الذرة وبادرات القمح.

nosa_aic
04 - 01 - 2012, 21:59
اسباب تنميل اليدين


قد تتعدد أسباب تنميل اليد، ومنها:


أولا: قد يكون ذلك بسبب ضعف عام في الأعصاب، وهذا ينتج عن نقص في فيتامين "ب" ؛ لذا فإن التنميل قد يختفي بتناول أقراص أو حقن فيتامين "ب"، حيث إنه مسئول عن تكوين كريات الدم الحمراء؛ لذلك فهو الممول الرئيسي للأوعية الدموية، كما أنه يساعد في بناء نخاع العظم؛ لذلك تظهر أهميته في حالات هشاشة العظام واضطراب الأعصاب.

وحاجة الجسم اليومية لهذا الفيتامين حوالي 5 ميكروجرام في اليوم؛ ونقصه يسبب نوعا من أنواع الأنيميا، يعرف باسم الأنيميا الخبيثة (pernicious anemia)، وكذلك يؤدي إلى فقر الدم، أو ما يعرف باسم (megaloplastic anemia).


ثانيا: قد يكون هذا التنميل بسبب مشكلة في العمود الفقري، سواء في الفقرات العنقية أو القطنية؛ وهو ما يؤدي إلى الضغط على الأعصاب في الأيدي والأرجل، ويؤدي إلى حدوث هذا التنميل.


ثالثا: قد يكون هذا التنميل مؤشرا لبداية مرض السكر؛ لذا من الأفضل عمل تحليل لنسبة السكر في الدم مع تحليل دم كامل ونسبة الهيموجلوبين به؛ حتى نستثني أيضا احتمالات الأنيميا التي قد تؤدي في حالات قليلة إلى مثل هذا العرض

nosa_aic
05 - 01 - 2012, 07:24
فصيلة دمك و النظام الغذائى المناسب


سمعنا عن النظام الغذائي المعتمد على كيمياء الجسم و صفاته من حيث الهضم و استهلاك الطاقة الموجودة في الغذاء بعد هضمه و الذي يدل الشخص على النظام الغذائي المناسب له بحسب فصيلة دمه و بذلك يعرف الطعام المناسب له و الذي يستطيع جسمه هضمه و تمثيله غذائيا و حرقه بكفاءة عالية ، ويعرف كذلك الطعام الذي يعيق و يصعب على الجسم عملية التمثيل الغذائى (http://www.libyanyouths.com/vb/t39715.html)

************************************************** ***************************************
فصيلة الدم a

فصيلة الدم a تخزن اللحوم الموجودة في الطعام كدهون في الجسم , لذلك اللحوم الحيوانية تسبب السمنة لأن الحموضة الضعيفة للمعدة تعجز عن هضم اللحوم بشكل جيد وتام و بذلك تعيق التمثي الغذائي(ميتابوليزم) الصحيح للغذاء في الجسم ويتم تخزين البروتينات و الدهون في الجسم دون حرقها ، و للتكيف مع هذا النوع يجب الإعتماد على المحاصيل الزراعية .
> منتجات الألبان : تهضم بضعف وبطء شديد مع a لذا فهي مزعجة وسيئة بسبب تفاعلات الأنسولين لأن منتجات الألبان مشبعة بالدهون لذا تسبب أضراراً بالقلب وتسبب مرض السكر والسمنة .
> القمح : يعتبر من العناصر المختلطة في a يمكن لهذه الفصيلة أكل القمح ولكن ليس بكثرة لأن كثرته تسبب حموضة في عضلات وأنسجة الجسم ، فمن الأطعمة التي تساعد على زيادة الوزن : لأصحاب الفصيله a
> اللحوم : بطيئة الهضم وتخزن في الجسم كدهون وتزيد سموم الهضم .
> مشتقات الألبان : تبطيء عملية التمثيل الغذائي .
> الفاصوليا القلوية : تتداخل مع إنزيمات الهضم وتبطيء عملية التمثيل الغذائي .
> القمح : يوقف ويثبط الأنسولين .
> زيت الخضار : يساعد على الهضم الجيد ويمنع حفظ الماء في الجسم .
> الأطعمة التي تساعد على إنزال الوزن :
> أطعمة الصويا : تساعد على الهضم وتمثيل الغذاء بسرعة .
>
> الخضار : تساعد على التمثيل الغذائي الصحيح وتسرع من حركة الأمعاء .
> الأناناس : يساع على سرعة حركة الأمعاء
> للحصول على أفضـل نتائج فصيلة a يجب عليها الإمتناع عن تـناول اللحوم في نظام أكلها ، فمن المفروض أن هذه الفصيلة أشخاصها معرضين للإصابة بأمراض القلب والسكر وسرطان المعدة ، لذا يجب الإمتناع عن المحظورات و أكل كل ما هو مفيد للجسم .
>
> الأطعمة التي تساعد على زيادة الوزن
>
> اللحوم الحمراء بصفة عامة - الكبد - القلب – الأرنب – البط – الوز – البقر- الماعز- الكافيار – الجمبري – الكلامب ( clamp ) - المحار – الأستاكوزا - الجبن الأمريكي – الجبن الأزرق – الزبدة – زبدة الحليب – جبن الشيدر – الكوتينج – جبن الكريم ( الكاسات ) – الآيس كريم – جبن البارميسان السويسري – الحليب الكامل الدسم – زيت الذرة – زيت القطن – زيت اللوز – زيت دوار الشمس - المكسرات البرازيلية – الكاجو – الفستق – الفاصوليا- خبز القمح الكامل - الدقيق الأبيض – المكرونة المصنوعة من السبانخ والسميد والدقيق الكامل - الكرنب الأحمر والأبيض – الباذنجان الأسود – المشروم ( عش الغراب – الفطر ) - الزيتون الأسود ( اليوناني – الأسباني ) – الفلفل بأنواعه – البطاطس – والجزر اليماني – الطماطم - الموز – النارجــين المانجو – الخربز ( الشمـام ) – الهنـدول – البرتقــال – البابايا – اليوسف أفندي - الجيلاتين – الفلفل الأسود والأبيض – جميع أنواع الخل - الكاتشب – المايونيز- الشاي الأحمر العادي –شاي الليبتون - البيرة – جميع المشروبات الغازية .
>
> الأطعمة التي تساعد على إنقاص الوزن
>
> السمك - الصويا – زيت الزيتون - البندق – الذرة – الأرز - الأرضي الشوكي – أوراق البنجر – البروكلي – الجزر – الخضار الورقية – الهدرباء البرية – البصل بأنواعه – السبانخ – الباميا – الخس – اللفت – الفجل – الثوم – البقدونس – القرع - الخوخ – التوت الأسود والأزرق – الكرز- التين – العنب – الليمون – الأناناس – البرقوق - الزبيب – المشمش – الخردل – الزنجبيل – القهوة الشاي الأخضر .

************************************************** *************************************

فصيلة الدم b

هذه الفصيلة تمثل بشكل أفضل (تحرق) لحوم الحيوانات و الخضار ، وأهم عامل في فصيلة b الذي يساعد على زيادة الوزن هو الذرة و القمح و العدس و اللوز و بذور السمسم و اللحوم البيضاء, حيث أن جميع هذه الأنواع لها كمية مختلفة من الليستين , مما يؤثر على عملية التمثيل , وتؤدي إلى إختزان الماء في الجسم أو الشعور بالتعب والإرهاق هبوط في مستوى السكر في الدم ، فلذلك يجب أكل كميات صغيرة من الطعام لكي يبقى مستوى السكر معتدل في الدم ,
> فالمشكلة في هذه الفصيلة هي ليست متى تأكل و إنما الذي تأكل , فهناك بعض المواد الغذائية تسبب هبوط في مستوى السكر وخاصة للأشخاص المنتمون لهذه الفصيلة , وعند حذف هذه المواد و أكل الأشياء التي يجب عليك تناولها فهذه المشكلة سوف تختفي تماماً
> و سنوضح الأطعمة التي تعمل على زيادة الوزن وكذلك الأطعمة التي تساعد على إنقاص الوزن .
> النشويات أغلبها يؤدي إلى هبوط في مستوى السكر وعدم التمثيل الغذائي الصحيح للطعام مما يؤدي إلى زيادة في الوزن.

الأطعمة التي تساعد على زيادة الوزن

البط – الدجاج – الوز – القلب – الجمبري – الاستاكوزا - الجبن الأمريكي(الأصفر) – الآيس كريم – زيت الذرة – زيت دوار الشمس - الكاجو – اللوز – السمسم ( الطحينة ) – زبدة اللوز السوداني – بذور دوار الشمس – بذور القرع ( الفصفص الدبة ) – بذور البابايا - العدس – اللوبيا – القمح الكامل و دقيقه - الذرة - اللوز– الأفوكادو – الزيتون – القرع – الطماطم – الرمان - شيرة الذرة – الفلفل الأبيض والأسود – الكاتشب الجيلاتين – القرفة – النشا – المشروبات الغازية .

الأطعمة التي تساعد على إنقاص الوزن

لحم الغنم – الأرانب – السمك – الحبار – الجبن الأبيض – اللبن – الزبدة - زيت الزيتون - البروكلي - الكرنب بأنواعه - الجزر - القرنبيط - الباذنجان - الفلفل الرومي - البقدونس - المشروم ( الفطر ، عش الغراب ) البطاطس - الكرفس – الشبت – الفجل – الباميا – البصل – الخس – الكوسا – البازلاء - العنب – البابايا – الأناناس – التفاح – الخوخ – الجزر – الكرفس – الخيار – البرتقال – الجريب فروت – البرقوق - الزنجبيل – الكري – البقدونس – الكزبرة - كريم الترتار – القرنفل – الشيكولاتة – الهرد – الشبت – الثوم – العسل – النعناع – الزعتر – المسترد ( الخردل ) – الدبس – الملح – الفلفل الأحمر – السكر الأبيض والبني – الفانيلا – الخل - الشاي الأخضر – البيرة – القهوة – الشاي العادي .


************************************************** **************************************
فصيلة الدم ab

اللحوم الحمراء : تهضم ببطء شديد وتخزن في الجسم كدهون
> البقول القلوية : تثبت الأنسولين مما يسبب في انخفاض نسبة السكر وذلك بالتالي يسبب انخفاض نسبة التمثيل الغذائى (http://www.libyanyouths.com/vb/t39715.html)للطعام .
> البذور والحبوب : أيضاً تسب انخفاض مستوى السكر في الدم
> الذرة : يقلل من نسبة الأنسولين
> القمح : يبطيء عملية التمثيل ويقلل نسبة الأنسولين .

> الأطعمة التي تساعد في إنقاص الوزن :

> التوفو : يزيد من سرعة التمثيل الغذائي للطعام
> الأطعمة البحرية : تزيد من سرعة التمثيل الغذائي للطعام
> مشتقات الحليب : تساعد على إنتاج الأنسولين
> الخضار الخضراء : تساعد على التمثيل الصحيح
> الأناناس : يساعد على هضم الأطعمة الغير مهضومة ويساعدعلىحركة الأمعاء .
> الكِلب ( kelp ) : هو عشب بحري يساعد على إنتاج الأنسولين .
> يجب الإبتعاد عن الأطعمة المدخنة أو اللحوم المعالجة لأن هذه الأطعمة تسبب سرطان للمعدة بالنسبة للأشخاص الذين يتميزون بقلة الإفرازات الحمضية للمعدة , وهذه الصفة مميزة في الأشخاص من فصيلةa
>
> الأطعمة التي تساعد على زيادة الوزن
>
> لحم البقر – الدجاج – البط – الجمبري - الزبدة – الآيس كريم – الحليب الكامل الدسم – زبدة الحليب – جبن البارميسان – الجبن الأزرق – الجبن الأمريكي - زيت الذرة – زيت القطن – زيت السمسم – زيت دوار الشمس - بذور البابايا – بذور القرع ( الفصفص الدبة ) - زيت السمسم ( الطحينة – بذور دوار الشمس – الذرة – المكرونة - الأرضي الشوكي – الأفوكادو – الذرة البيضاء – الذرة الصفراء – الفلفل الرومي والأحمر والأصفر - الموز – النارجين – الجوافة – المانجا – البرتقال – الرمان - شيرة الذرة – الفلفل بأنواعه – الخل بأنواعه –النشا – الكاتشب - المشروبات الغازية – الشاي .
>
> الأطعمة التي تساعد على إنقاص الوزن
>
> لحم الضأن – الجمل – الديك الرومي – الأرانب – الكبدة – السمك - جبن الموزاريلا – اللبن – حليب الغنم – جبن قريش – اللبنة – جبن الشيدر – الجبن السويسري – جبن الكريم - زيت الزيتون – زيت اللوز – زيت الكتان – زيت كبد الحوت – الجوز – اللوز – الفستق - الكاجو - البروكلي – الكرفس – الخيار – الباذنجان الأسود – الثوم – البقدونس –الكزبرة – البطاطس الحلوة – السبانخ – الكرنب – الجزر – البصل بأنواعه – القرع – الطماطم – المشروم – الخس – الزنجبيل – البامية – الزيتون بأنواعه - الليمون – الأناناس – البرقوق – الكيوي – العنب – الكرز – التفاح – الخوخ – التوت – التمر – الخربز – الكساب – الهندول – اليوسف أفندي – الزبيب – الكمثرى – البابايا - الكري – البقدونس – الثوم – الشبت – الملح الصويا صوص – السكر – التمر الهندي – الفانيلا – النعناع – العسل – الدبس – المسترد – القرنفل – الكمون – الأجار- الألماسية – القرفة – الهرد – الهيل – شيرة الرز- القهوة بأنواعها – الشاي الأخضر – البيرة .
************************************************** ***********************************

فصيلة الدم o

تتميز هذه الفصيلة " o " بأن بعض الأشخاص يفقدون أوزانهم بسرعة بمجرد حذف القمح من نظام غذائهم ، وتعود زيادة الوزن للأشخاص الذين ينتمون لهذه الفصيلة إلى قلة تنظيم وإنتاج الغدة الدرقية لهرمونها وهذه الفصيلة تتميز بقلة هرمون الأيودين فيها ، وقلة إنتاج الغدة الدرقية لهذا الهرمون تؤدي إلى احتباس الماء في الجسم و زيادة في الوزن و فقدان في وزن العضلات
> والشعور بالتعب.
> القمح : يتداخل مع الأنسولين ويبطيء عملية التمثيل الغذائي .
> الذرة : يتداخل مع الأنسولين ويبطيء عملية التمثيل الغذائي .
> البقول القلوي : تفسد وتتلف حرق السعرات الحرارية .
> البقول أو الفاصوليا الزرقاء : تفسد وتتلف حرق السعرات الحرارية .
> العدس : يثبط تمثيل المواد الغذائية الصحيحة .
> الكرنب و القرنبيط : يثبط هرمونات الغدد الدرقية .
> المسترد الأخضر : يثبط إنتاج هرمونات الغدد الدرقي .
>
>
> المأكولات البحرية : تحتوي على الأيودين الذي ينشط الغدة الدرقية
> ملح الأيودين : لاحتوائه على الأيودين .
> الكبد : مصدر لفيتامين b ويساعد على التمثيل الصحيح
> اللحوم الحمراء : تساعد على عملية التمثيل الغذائي الصحيح .
> السبانخ والبروكلي : تساعد على عملية التمثيل الغذائي الصحيح .
> معدة الأشخاص المنتمون لهذه الفصيلة تتميز بالقدرة على هضم جميع اللحوم الموصوفة دون أي مشاكل بسبب قوة حمض الهيدروكلوريك الذي تفرزه المعده بعكس فصيلة الدم a ، و لكن يجب اختيار الخضار و الفواكه المناسبة لكي لا تزيد حموضة المعدة والتي قد تسبب قرحة للمعدة وبالتالي تؤثر على جدار المعدة .
>
>
> الأطعمة التي تساعد على زيادة الوزن
>
> السمك – الجبن – اللبن - زيت الذرة – زيت دوار الشمس – زيت القطن – زيت اللوز - الكاجو– الفستق – زبدة اللوز – اللوز – الفول – العدس – الفاصوليا – الشوفان – الكورن فليكس – المكرونة – الشعير – الدقيق الأبيض – الدقيق الكامل - الأفوكادو – الباذنجان – الكرنب – القرنبيط – المشروم ( الفطر ، عش الغراب ) الزيتون الأسود – البطاطس
> التوت الأسود – النارجين – البرتقال التفاح – الخربز – اليوسف أفندي – الفراولة – الهندول - القرفة – شيرة الذرة - الكاتشب- المخلل - الفلفل الأبيض و الأسود – الخل – الفانيلا – القهوة – الشاي – المشروبات الغازية .
>
>
> الأطعمة التي تساعد على إنقاص الوزن
>
> لحم البقر – لحم الغنم – الحسيل – الكبد – القلب – الجمبري - زيت الزيتون – زيت الكتان – حب القرع - الجوز – الأرضي الشوكي – الشمندر – البروكلي – الخضار الخضراء – الثوم – الفجل – الخس – البصل بأنواعه – الباميا – البقدونس – الفلفل – القرع – البطاطس الحلوة ( الجزر اليماني ) – السبانخ – الطماطم – البازلاء – الكرفس – الزيتون الأخضر - التين الفاتح – البرقوق الأحمر والأخضر – العنب – الجوافة – "معظم الفواكه ما عدا الممنوعات"
> - الكري – البقدونس – الفلفل الاخضر – القرنفل – الكمون – الشكولاته – الآجار – الشبت – الثوم – النعناع – السكر – التمر الهندي – الشاي الأخضر - النعناع – الزنجبيل

nosa_aic
05 - 01 - 2012, 18:55
النظام الغذائى لمرضى القولون


* الممنوعـــــات:-
الملح الزائد(الفسيخ-الرنجة-الاسماك المحفوظة-الطرشي)
- المقليـــات(الاسماك-البطاطس-الطعمية-..........)
- البصل والصلصة بأنواعها فى الخضار المسبك والتقلية
- البسلة والعدس والبقول
- اللحوم السمينة والدهون (البط - الأوز - الحمام - الضأن - الكبد -
الكلاوى - الطحال - القراميط – الثعابين)
- المانجو - البلح - الجوافة - التين البرشومى - التين الشوكى –
المشمش - البطيخ .

* المسموحــات: -
الخبز الأبيض و"التوست" والمكرونة والأرز.
- الشاى الخفيف والقهوة الخالية من "الكافيين" والبليلة باللبن
- اللحم البقرى والضأن الأحمر والدجاج الصغير والأرانب.
- السمك الأبيض المشوى أو المطهو بالفرن.

nosa_aic
05 - 01 - 2012, 19:00
لماذا يقول لك الدكتور طلع لسانك عند الفحص؟


هل سألت نفسك لماذا يطلب منك الطبيب أن تخرج لسانك عند الفحص؟؟ أنا أقول لك وذلك للأسباب التالية:


إذا كـان لون لسانك يميل إلى الاصفرار
فهذا دليل على (نسبة الصفار عالية في الدم )



* إذا كــان لون لسانك يميل إلى الزرقة
فهذا يدل على وجود (مرض بالقلب أوالجهاز التنفسي )



* إذا كان لون اللسان أحمـــــر وردياً
فهذا يدل على الصحة .


* إذا كان لون اللسان باهتاً
فذلك يدل على وجود (أنيميا )


* إذا كـان يكسو اللسان طبقة بيضاء
فهذا يدل على وجود (حمى وإضطراب في الهضم )


* إذا كان هنالك رعشة في اللسان عند إخراجه من الفم
فهذا يدل على وجود (تسمم أو توتر عصبي )

الله يحمينا من شر الأمراض

nosa_aic
05 - 01 - 2012, 19:08
ضرس العقل


لماذا أطلق عليه أسم ضرس العقل ؟


وكم عدد ضروس [/URL]العقل ؟



وما المشاكل المتعلقة بها ؟



نظرا لأنه آخر الأسنان الطبيعية التى بالفم . ويظهر عادة بين سن الثامنة عشرة والخامسة



والعشرين ، وهى فترة النضج العقلى والفكر المتزن ، ومن هنا جاء اسم ضرس العقل وفى



تصور أن ضرس العقل يظهر فى سن متاخرة ليضم جميع الأسنان ويغلق المسافات المفتوحة بين



الأضراس فتمنع تراكم الفضلات وعدد ضرس العقل (http://www.libyanyouths.com/vb/t43510.html) أربعة إثنان بالفك العلوى واثنان بالفك



السفلى.ونظراً لأنها اخر الأسنان التى تظهر بالفم ففى اغلب الاحيان لاتجد لها مكاناً بالفم وبالتالى



إما ان تظل مدفونة فى عظام الفك كلية ، أو تحاول البزوغ جزئياَ، أى يظهر جزء منها بالفم والباقى



مدفوناَ بعظام الفك .



وأبرز أسباب عدم ظهور ضرس العقل [URL="http://www.libyanyouths.com/vb/t43510.html"] هى :

- إختفاء البرعم الخاص به منذ البداية .

- صغر حجم الفك بحيث لايسمح لنمو أو ظهور ضرس العقل.

- قد ينمو ضرس العقل بصورة عرضية أو مائلة لاتسمح له بالظهور بالفك .



أما المشاكل المتعلقة بضرس العقل فهى عديدة أهمها :



- قد يحدث التهاب حاد فى اللثة التى تخص ذلك الضرس عند أول محاولة لظهوره فى الفم .

والواقع أن هذا الالتهاب و التورم قد يحتجز تحته إفرازات صديدية تزيد من الألم فلا يستطيع المريض أن يفتح فمه بسهوله ،

وقد لايستطيع بلع الطعام ، وتصبح رائحة الفم كريهة ،

وترتفع درجة الحرارة ، مع الإحساس بالتعب والاعياء


- قد يصبح ضرس العقل بؤرة تسبب الألم بين الحين

والآخر نتيجة لضغط ضرس العقل على عصب الفك السفلى

، وقد يمتد الألم إلى الأذن

والعين أو أسنان الفك .


- عندما يكون ضرس العقل مائلاَ على الضرس المجاور

يضغط عليه مسببا آلاما شديدة،

وفى هذا الوضع المائل تتجمع فضلات

الطعام محدثة تسوسا فى كل من الضرسين

nosa_aic
05 - 01 - 2012, 19:41
معلومات عن الصحة تهمك

1.ابتعد عن السموم البيضاء الثلاثه: السموم البيضاء هي الملح والسكر والدقيق الأبيض تجنبها قدر الإمكان فهي مضره بالتأكيد قلل من الملح قد الإمكان واستعض عن السكر بالعسل واستخدم الدقيق الأسمر بدل الأبيض.



2. مضغ الخضار جيدا : ان مضغ الطعام جيدا يزيد من نسبة المواد الكيماوية المكافحة للسرطان التي تطلقها الخضراوات مثل البروكلي والملفوف والقرنبيط .




3. المشي يوميا : المشي اليومي لمدة نصف ساعة او ساعة يقلل من امكانية الاصابة بمرض السرطان بنسبة 18 % ويساعد على التخلص من 3 كيلو غرامات تقريبا في السنة ويحافظ على قوام الجسم .



4. الاكثار من تناول اللوز : يفضل تناول اللوز بين الوجبات اليومية وعند الشعور بالجوع فهي غنية بالعناصر المغذية التي قد يفتقر الها النظام الغذائي اليومي .




5. الثوم صيدليه عجيبه يقي من كثير من الأمراض: الثوم من اعجب الأدويه الطبيعيه لكثير من الأمراض ولكن بعد استعماله امضغ شيئ من الخضروات الخضراء مثل البقدونس حتى تزول رائحته ونظف فمك قبل الذهاب للمسجد



6. احرص على متابعة نوع الشامة على الجلد : تشير الابحاث الى ان القدرة على ملاحظات التغيرات التي تطرأ على الشامات المختلفة على الجلد تزداد بنسبة 13% وان الحرص في ملاحظتها يجنب الاصابة بالسرطان .



7. نظافة الاسنان : احرص على تفادي ترطيب فرشاة الاسنان بالماء قبل وضع المعجون عليها حيث ان الفرشاة الجافة تزيد من امكانية التخلص من البلاك بنسبة 67 % .



8. النوم بشكل افضل : تناول التفاح لمكافحة الارق والنوم بشكل عميق فالنوم يساعد على مكافحة الشيخوخة المبكرة والاحتفاظ ببشرة شبابية .



9.استخدم الخل دائما : الخل وخاصة خل التفاح من افود المواد للجسم وفوائده لاتحصى استخدموا ملعقه صغيره مع السلطه يوميا .



10. شرب الشاي الاخضر : ينصح بتناول كوب من الشاي الاخضر يوميا والذي يمنع التاكسد في خلايا الجسم ، ويخفف من امكانية حدوث السرطان ولنتائج افضل اشربوه مركزا بدون سكر.



11. تناول السمك مرة في الاسبوع : على الرغم من ان الاختصاصين يوصون بتناول حصتين من السمك اسبوعيا ، الا ان تناول حصة واحدة يمكن ان تساعد على تحسين توازن المواد الكيميائية الدماغية ، والسمك مفيد لصحة القلب والدماغ ..


12. زيت الزيتون صيدليه متكامله: زيت الزيتون من اغرب المواد الطبيعيه التي لها فوائد لاتحصى فحافطوا عليه يوميا شربا ودهانا.



13. تناول قطعتين من الشوكولاته يوميا : حيث يؤكد الخبراء ان الشوكولاته تبعد عنك فقر الدم وتحسن المزاج ..



14. لا لحمل الاغراض الثقيلة : ابتعد عن حمل اي حقائب ثقيلة كي لا تؤثر على العمود الفقري او على طريقة الوقوف والسير بشكل سلبي .



15. الانتباه للون اللسان : يمكن للون اللسان ان يكون مؤشرا لمشكلات صحية لذا احرص على لونه واكتسابه لاي لون مختلف ، فاللون الابيض يدل على ضعف في جهاز المناعة واللون الاصفر يدل على الافراط في الطعام والشراب والاحمر في طرف اللسان يعتبر مؤشرا على الاجهاد النفسي .

nosa_aic
05 - 01 - 2012, 20:46
الزهايمر

هو مرض عصبي يؤثر على أجزاء من المخ، مما يؤدي إلى تأثر وظائف الذاكرة، والذكاء، واللغة، والقدرة على

الحكم على الأمور، والقدرة على التفكير المنطقي، والسلوك. يطلق عليه أحيانا خرف الشيخوخة، نتيجة للتدهور المستمر في تلك الوظائف مع التقدم في السن، ولأنه يصيب كبار السن في الأساس، فيما عدا حالات نادرة جدا. الأقرباء المقربون من المريض هم الذين يلاحظون الأعراض أولا، وقد يدرك المريض نفسه أحيانا أن هناك شيئاً ما خطأ.

ما الذي يسبب الزهايمر؟

ليس معروفا إلى الآن لماذا تحدث هذه التغييرات في المخ، لكن الأبحاث لازالت مستمرة. هناك ضمور يحدث في الخلايا العصبية بالمخ، وجدائل عصبية ليفية تتكون، وحتى الآن لا أحد يعرف لماذا.

ويبدأ مرض الزهايمر حينما تتوقف البروتينات في الدماغ عن القيام بوظائفها العادية، وتتجمع بدلا من ذلك في عناقيد.


أعراض مرض الزهايمر

• فقدان في الذاكرة.
• عدم القدرة على الحكم على الأمور واتخاذ القرارات.
• عدم القدرة على إدراك الوقت.
• يتوه المريض في الأماكن المألوفة.
• صعوبة في تعلم وتذكر المعلومات الجديدة.
• يلاقي المريض صعوبة في التعبير عن نفسه.
• تناقص القدرة على أداء المهام اليومية التقليدية مثل إعداد الطعام أو تناول الدواء.
باستمرار تقدم الحالة، تزداد الأعراض وتصبح أسوأ، وقد يقوم المريض بتصرفات غريبة وغير لائقة. قد يتطور الأمر أيضا إلى بارانويا وهلوسة وأوهام. وفي المراحل الأكثر تقدما من المرض قد ينسى المريض أشياء أساسية مثل كيفية الأكل أو ارتداء الملابس أو الاستحمام أو النهوض من السرير أو حتى المشي والجلوس

كيف يشخص المرض؟

تشخيص الزهايمر صعب، ويتضمن بحث التاريخ المرضي للعائلة وتقييم حالة المريض العقلية والجسدية، وإجراء أشعة مقطعية ورنين مغناطيسي.


العلاج:

ليس هناك علاج شاف للمرض، لكن الأدوية المتوفرة تهدف إلى منع تدهور الحالة ومساعدة المريض على ممارسة حياته. يجب على المعالج أيضا أن يعالج الأمراض المصاحبة للزهايمر مثل الاكتئاب الذي عادة ما يهاجم المريض

nosa_aic
05 - 01 - 2012, 20:59
الفستق يساعد على الرشاقة (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/145144-%D8%A7%D9%84%D9%81%D8%B3%D8%AA%D9%82-%D9%8A%D8%B3%D8%A7%D8%B9%D8%AF-%D8%B9%D9%84%D9%89-%D8%A7%D9%84%D8%B1%D8%B4%D8%A7%D9%82%D8%A9)



http://www.alwafd.org/images/news/2046530157kae720.jpg





أكدت دراسة علمية أجراها فريق من الباحثين بجامعة بنسلفانيا بالولايات المتحدة الامريكية بالتعاون مع مركز دراسة التغذية التابع لإدارة الزراعة الأمريكية أن تناول الفستق يؤدى الى تقليل مخاطر الاصابة بأمراض القلب ويساهم في تقوية الأوعية الدموية ويساعد على إنقاص الوزن على عكس ما هو شائع.
وقال الباحثون - فى تصريحات على شبكة الانترنت - إن التأثير الايجابي للفستق نسبة إلى ما يحتويه من ألياف غذائية ومادة "الفيتوستيرول"، اضافة الى احتوائه على مواد مغذية وفيتامينات كفيتامين "ب1" والنحاس والمنجنيز والبوتاسيوم وفيتامين "ب 6" والمغنيسيوم والفسفور.
ونصح الباحثون بإدخال الفستق في النظام الغذائي لفائدته العامة خاصة لمن يسعون لإنقاص وزنهم حيث إن نحو 90 % من الدهون التي يحتوي عليها تفيد فى تخفيض مستوى الكوليسترول فى الجسم بشكل ملحوظ .

nosa_aic
05 - 01 - 2012, 21:42
العوامل التى تؤدى للاصابه بهشاشه العظام


- السن:

يزداد خطر الإصابة بهشاشة العظام مع التقدم في العمر. ويبدأ سن الخطر في الثلاثين من العمر، حيث يصبح معدل فقدان العظام أسرع بكثير من معدل تكوين الجسم لها.

- الجسم:

تعد النساء النحيفات وذوات البنية الضئيلة أكثر عرضة للإصابة بهشاشة العظام، لأنهن من الأصل لديهن مقدار أقل من العظام، فيصبحن أكثر عرضة لفقدان الكتلة العظمية مع التقدم في العمر.

- الوراثة:

تلعب الوراثة دورها في الإصابة بالهشاشة، حيث تورث الأمهات المصابة بهذا المرض بناتهن هذا المرض مع الجينات الوراثية، التي تم التعرف على عدد منها مؤخراً.

- الجنس:

النساء أكثر عرضة للإصابة بالمرض من الرجال، للاختلاف الطبيعي للكتلة العظمية بين الرجل والمرأة.
كما يعرف أن سكان قارة آسيا وأصحاب البشرة البيضاء أكثر عرضة للإصابة بالمرض من غيرهم.

- نقص الإستروجين:

يقوم المبيض بإفراز هرمون الإستروجين المهم جدا للمرأة، حيث يعمل على تأخير معدل فقدان العظام.
ومع التقدم في العمر وانقطاع الحيض، أو عند استئصال المبيضين لأسباب مرضية، تفقد المرأة هذا الهرمون؛ فترتفع نسبة خطورة الإصابة بهشاشة العظام.

- نقص فيتامين «دي» والكالسيوم:

الحصول على مقدار غير كاف من الكالسيوم و فيتامين دي الذي يساعد على امتصاص الكالسيوم يجعل مستوى الكالسيوم بالدم أقل من حاجة الجسم، فيبدأ الجسم بسحب الكالسيوم من العظام؛ مما يؤدي إلى فقدانها.

- عدم النشاط والحركة:

عندما يكون الجسم في حالة راحة واسترخاء، يكون معدل تكوُّن العظام بطيئاً؛ وبالتالي يصاب المرء بالهشاشة، فالنشاط والحركة يسرعان معدل بناء العظام.

- التدخين:

من العادات السيئة التي تؤثر على معدل إنتاج الإستروجين، وبالتالي على معدل تكون العظام.

- الكحول:

إن تناول الكحول مرتين يومياً يسرع من معدل فقدان العظام، أما الذين يتناولون الكحول بإفراط، فهم معرضون لخطر أكبر، لأنهم غالباً ما يفقدون شهيتهم للطعام؛ وبالتالي يعانون من نقص التغذية؛ مما يؤدي إلى تفاقم فقدان العظام.

- العقاقير الطبية:

استخدام بعض العقاقير الطبية كالكورتيزون وعلاجات الصرع على المدى الطويل يؤدي إلى فقدان العظام. لذا، يجب تعويض هذا النقص بتناول حبوب الكالسيوم وفيتامين «دي».

- الغدة الدرقية:

المصابون بفرط إفراز هرمون الغدة الدرقية والمرضى الذين يتناولون هرمون الغدة الدرقية ينبغي لهم متابعة مستويات الكالسيوم وفيتامين «دي»، لتأثير زيادة الهرمون الدرقي على العظام، فارتفاع نسبة هرمون الثيروكسين في الجسم يسرع من فقدان العظام.

المشروبات الغازيه

أثبتت الأبحاث الطبية تأثيرالمشروبات الغازية ، كالكولا، على العظام، حيث تضعف بنيتها، وتسرع من عملية فقدانها، وبالتالي الإصابة بهشاشة العظام.

- الجراحة:

بعض العمليات الجراحية للجهاز الهضمي قد تقلل من فرص امتصاص الجسم للكالسيوم والمعادن الأخرى التي يحتاجها الجسم لنمو العظام.

- حالات مرضية أخرى:

من الحالات المرضية التي تسبب فقدان الكتلة العظمية، فقدان الشهية العصبي، وبعض أنواع السرطان، وأمراض الكبد، وفرط إفراز هرمون الغدة الجار درقية، والأمراض التي تؤثر على امتصاص المعادن، كالمرض الجوفي، وبعض الأمراض الخلقية النادرة.

nosa_aic
05 - 01 - 2012, 21:47
الغضب يسد شرايين المرأة

هل تعلمين أن النساء اللاتي يشعرن دائما بالغضب عرضة أكثر من غيرهن للإصابة بانسداد في شرايين القلب‏..‏ هذا ما أكدته الدراسات الحديثة في حين برهنت الدراسات السابقة علي وجود ارتباط بين الغضب والأمراض القلبية

ولكن معظم هذه الدراسات ان لم يكن جميعها كانت تركز علي قلوب الرجال‏.‏ وتفيد نتائج الدراسة الحديثة التي نشرت في العدد الأخير من مجلة صحة النساء أن العلاقة بين الغضب وأمراض القلب موجودة حتي لدي الجنس الناعم‏

ووجد الباحثون ان النساء اللاتي يملن الي التعبير عن الغضب بشكل ظاهر تكون لديهن احتمالات انسداد الشرايين مرتفعة‏,‏ خصوصا اذا توافرت لديهن بعض العوامل المساعدة الأخري كالتقدم في السن‏,‏ والإصابة بمرض السكر‏,‏ أو ارتفاع معدل الكوليسترول في الدم‏.‏
ويقول د‏.‏ ديفيد كرانز المشرف علي الدراسة التي أجريت في جامعة العلوم الصحية بولاية ميرلاند الأمريكية إن ثورات الغضب المتكررة ربما كانت أقوي العوامل الضارة التي تؤثر علي صحة النساء والرجال علي حد سواء‏!‏

وقد شملت الدراسة‏636‏ امرأة يعانين جميعا من آلام في الصدر أو من أعراض أخري لأمراض الشرايين التاجية‏,‏ جميعهن أجري لهن عمليات قسطرة للتأكد من وجود انسدادات في شرايين القلب وتم اخضاع هؤلاء النساء لاختبارات قياسية حول الغضب والمشاعر العدائية بهدف معرفة ما إذا كانت أمزجتهن عدائية وما إذا كن يغضبن لأتفه الأسباب ويعبرن عن ذلك بشكل ظاهر للعيان‏

وتبين أن هناك بالفعل صلة بين الغضب وبين انسداد الشرايين‏,‏ وان اللاتي يثرن ويعبرن عن الغضب أكثر من غيرهن تتفاقم لديهم الأعراض ويأمل الباحثون من دراسة تأثير الغضب وغيره من المشاعر علي القلب‏,‏ في تحسن طرق تشخيص الأمراض التي تصيب عضلة القلب والشرايين التي تغذيها‏.‏

وتشير الدراسة في النهاية الي ان النساء اللائي يعانين من آلام صدرية غير مبررة ربما يكن بحاجة الي مساعدة نفسية في مسألة السيطرة علي مشاعر الغضب وطرق كبتها‏.‏

nosa_aic
05 - 01 - 2012, 22:13
طرق مفيدة لطرد السموم من الجسم (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/145166-%D8%B7%D8%B1%D9%82-%D9%85%D9%81%D9%8A%D8%AF%D8%A9-%D9%84%D8%B7%D8%B1%D8%AF-%D8%A7%D9%84%D8%B3%D9%85%D9%88%D9%85-%D9%85%D9%86-%D8%A7%D9%84%D8%AC%D8%B3%D9%85)


يعد الحفاظ على الجسم بحالة مثلى لا يُسهم في إطالة عمر الانسان وضمان العافية فحسب بل يساعد في الشعور بالشباب والحيوية وصفاء التفكير أيضا.
الجلد هو أكبر أعضاء الجسم ويتعرض الى سموم عديدة كل يوم، ويمكن ان تنفذ هذه السموم الى الجسم عن طريق الجلد والغذاء الذي يتناوله الانسان والسوائل التي يشربها والهواء الذي يتنفسه.
ويعتبر العلاج بالتعرق من أشد الطرق فاعلية لتخليص الجسم من السموم، فإن غدد التعرق في الجسم تقوم بدور قناة صرف كبيرة للتخلص من السموم.
ويتعين تطبيق العلاج بالتعرق على النحو الصحيح بطبيعة الحال لتفادي حدوث خلل في توازن السوائل في الجسم إذ من الضروري تعويض ما يفقده الجسم من سوائل.
كما تُخزن السموم في الأنسجة الدهنية، وهذا سبب آخر للدور المهم الذي تقوم به الألياف في طرد السموم من الجسم، فإن إبقاء السموم في الجسم يسمح لها بالهجوم، بعد ان تضعف دفاعات الجسم الطبيعية وقدرتها على حمايته.
وتبدأ السكريات والخمائر بالتكاثر على نحو منفلت متيحة للغذاء غير المهضوم وغيره من الملوثات ان تدخل الدورة الدموية وان تصنع موادا كيميائية خطيرة.
ويساعد الإكثار من تناول الخضار والفواكه والحبوب الكاملة على طرد السموم من الجسم ومحاولات خفض الوزن.
والمعروف ان الكثير من العقاقير المضادة للالتهاب غير المحتوية على الستيرويد وغيرها من الأدوية التي تُعطى بوصفة من الطبيب تشكل مصدرا لالتهاب جدار الأمعاء مؤدية الى تفاقم حالة المريض واطلاق مواد كيميائية سامة في الجسم.
لذا يُنصح بتناول الاعشاب كلما أمكن ذلك مثل الزنجبيل ونبات الكركم. فإن هذه الأعشاب لا تسبب تحسسا في الجسم ولا تخل بتوازنه الطبيعي. كما يساعد الزنجبيل على إبطال مفعول الجذور الحرة في الجسم وهو مضاد قوي للتأكسد ايضا.
ويمكن ان يشكل الضغط النفسي ضررا كبيرا بالصحة ويتعين ان نتعلم كيف نتعامل بطريقة اشد فاعلية مع الضغط النفسي باضافة وسائل الاسترخاء الى نمط حياتنا وأخذ قسط مناسب من الراحة وممارسة التأمل الروحي ونشاطات صحية مسلية والصلاة. ويعتبر الضحك طريقة جيدة اخرى للتخفيف من وطأة الضغط النفسي.
عندما يعمل الكبد فوق طاقته يصبح بطيئا ومحتقنا ويُنصح باستخدام نبات شوك الحليب الذي يساعد على تجديد الكبد. فالكبد السليم يؤثر إيجابيا على كل ناحية من نواحي عمل الجسم.
ومن الضروري العناية بالدورة الدموية بسب أهميتها لكل الأنسجة والخلايا والجلد ويمكن تحسين الدورة الدموية بالعلاج المائي وتناول الكمية الكافية من السوائل والتمارين البدنية.
ولابد من تجنب الأدوية التي تسبب حساسية ولدى البعض حساسيات مختلفة وبالتالي فإن تناول الأطعمة غير المناسبة يمكن ان يسبب جملة اضطرابات وأمراض.

nosa_aic
06 - 01 - 2012, 10:55
http://www.alamuae.com/gallery/data/media/123/0148.gif (http://www.libyanyouths.com/vb/t16130.html)


السلام عليكم ورحمة الله وبركاته



الآم الظهر







http://www.albdoo.info/uploaded/2/01162314236.gif (http://www.libyanyouths.com/vb/ext.php?ref=http://www.albdoo.info/uploaded/2/01162314236.gif)http://www.alhsa.com/forum/imgcache/301938.imgcache (http://www.libyanyouths.com/vb/t16130.html)




ألم الظهر ليس مرضاً بقدر ما هو عرضاً ينتج أنماط عديدة يتبعها الشخص فى حياته، وقد لا ينجح الطب فى تشخيص


الأسباب لحوالى 85% من الأشخاص التي تعانى من أعراض هذه الآلام.




تحتل آلام الظهر المرتبة الثانية بعد نزلات البرد الشائعة



يصنف الأطباء عادة آلام الظهر إلى: آلام ظهر حادة إذا استمرت لأقل من شهر، وآلام ظهر مزمنة إذا استمرت لفترة أطول من شهر..




* أسباب الإصابة بآلام الظهر:










1- بما أن ألم الظهر عرضاً، فإن الألم قد يظهر بسبب وجود اعتلال فى أعضاء أخرى يمتد تأثير الألم فيها إلى الظهر (Referred pain)، آلام متصلة بعرض آخر.





2- اضطرابات البطن مثل التهاب الزائدة الدودية، أمراض الكلى،عدوى المثانة، عدوى الحوض، اضطرابات المبايض وتضخم الأوعية الدموية (Aneurysms) .. المزيد عن الإسعافات الأولية للزائدة الدودية





3- الأورام قد تكون مصدراً لآلام الهيكل العظمى.





4- عدوى عظام العمود الفقري (Osteomyelitis, Sacroiliitis)، وتشتد الآلام سوءاً أثناء الليل أو أثناء الجلوس أو الوقوف لفترة طويلة من الزمن.





5- (Nerve root syndrome)، وتتمثل الأعراض كأن هناك لمس فى العصب نتيجة للفتق (Herniation)، أو نتوء فى الديسك بين عظام الظهر السفلية. وعصب النسا هو مثال لملامسة منشأ العصب، وآلام الملامسة هذه تكون حادة ومحددة فى مكان واحد وتؤدى إلى تنميل فى منطقة الرجل التي يصل إليها العصب المتأثر.





6- (Fibromyalgia)، تحدث فيها آلام لحوالى 11 من 18 نقطة للاستثارة عند لمسها (Trigger point)، وإحداهما تلك التي توجد فى منطقة الظهر السفلية. من أعراضها العامة هو التيبس، الإرهاق وآلام العضلات.





7- (Myofasical pain) حيث يفقد الإنسان قدرته على تحريك مجموعة العضلات المتأثرة، ويمتد الألم أيضاً إلى العصب المحيط. بوسع الشخص التخلص من هذه الآلام إذا قام بممارسة التمارين





8- (Musculoskeletal pain syndrome) يؤدى إلى حدوث آلام الظهر، ومنها: (Fibromyalgia) و (Myofasical pain).





9- (Cauda equine syndrome)، وهى حالة طبية طارئة، حيث تتمدد مادة الديسك فى قناة العمود الفقري مما تؤدى إلى الضغط على الأعصاب. ولهذا يشعر الشخص بالآلام وفقد الإحساس واضطراب فى الأمعاء أو المثانة مما يؤدى إلى صعوبة التحكم فى البول من الاحتباس أو عدم القدرة على البدء فى التبول.





10- (Spinal stenosis)، يحدث ذلك عندما يفتقد (Intervertebral discs) الرطوبة والحجم نتيجة لتقدم العمر، وبالتالي قلة المسافات بين (Discs). ومع حدوث إصابة ثانوية تحت مثل هذه الظروف يؤدى الأمر إلى حدوث التهاب ولمس العصب الذي ينجم عنه ازدياد الحالة سوءاً، وظهور اضطرابات أخرى من عصب النسا بدون تمزق فى الديسك (Disc rupture).





11- (Spinal degeneration)، انحلال العمود الفقري والسبب فيه التغيرات فى (Disc)، التي تأخذ فى الانحلال. وتتأثر المفاصل وأسفل الظهر مما يؤدى إلى ضيق قناة العمود الفقري. هذه التغيرات ينتج عنها أعراض تظهر عند الفحص بأشعة إكس. الشخص الذي يعانى من انحلال العمود الفقري قد تظهر عليه الأعراض التالية: تيبس فى الصباح أو آلام عند الوقوف لفترة طويلة من الزمن أو المشي لمسافات قصيرة.





12- (Herniated discs)، تنشأ هذه الحالة عندما تتعرض (Spinal discs) إلى الانحلال أو يقل سمكها. والجزء المركزي اللين الذي يشبه الجيلى من الديسك ينتأ من التجويف المركزي و يلامس العصب. تبدأ (Intervertebral discs) فى الانحلال فى العقد الثالث من العمر، ونجد أن هذه الحالة منتشرة بين حوالي 1/3 البالغين الذين يبلغون من العمر أكثر من (20) عاماً، وحوالي 3% فقط من الحالات المصابة يحدث معها أعراض لمس العصب (Nerve impingement/nerve is touched)





* أعراض آلام الظهر:





- حدوث الألم فى الجزء السفلى من الظهر، وهو أول الأعراض لآلام الظهر



- امتدا الآلام للأرجل من الأمام والخلف ومن الجانبين.


- قد تزداد الآلام سوءاً عند بذل نشاط بدني.


- كما تزداد الآلام سوءاً أثناء الليل أو بالجلوس لفترة طويلة فى السيارة "رحلة طويلة بالسيارة".


- قد يكون هناك تنميل أو ضعف فى جزء من الأرجل، الذي يستقبل الإشارات العصبية من الأعصاب المتعرضة للضغط. والأمثلة على ذلك:


عدم القدرة على الوقوف على أصابع القدم


أو حمل القدم لأسفل


وهذا يحدث عندما يكون العصب الأول (First sacral nerve) متعرض لضغط إصابة.


المثال الثاني: عدم القدرة على رفع إصبع القدم الكبر لأعلى وهذا ناتج عن تعرض العصب الخامس للضغط (Fifth lumbar nerve)



هذه صور توضح كيفية حدوث الإنضغاط للعصب فى اوضاع مختلفة ..


http://www.alhsa.com/forum/imgcache/301939.imgcache (http://www.libyanyouths.com/vb/t16130.html)



http://www.alhsa.com/forum/imgcache/301940.imgcache (http://www.libyanyouths.com/vb/t16130.html)



لذلك اتمنى منكم أن تصححو جلستكم هكذا حتى لا ينضغط العطب ويتعطل كل شيء..



http://www.alhsa.com/forum/imgcache/301941.imgcache (http://www.libyanyouths.com/vb/t16130.html)



وهذة تمارين تأهلية بسيطة فى الشكل كبيرة فى المعني حاول القيام بها و لو مرة يوميا

http://www.alhsa.com/forum/imgcache/301942.imgcache (http://www.libyanyouths.com/vb/t16130.html)





http://www.alhsa.com/forum/imgcache/301943.imgcache (http://www.libyanyouths.com/vb/t16130.html)



http://www.alhsa.com/forum/imgcache/301944.imgcache (http://www.libyanyouths.com/vb/t16130.html)



http://www.alhsa.com/forum/imgcache/301945.imgcache (http://www.libyanyouths.com/vb/t16130.html)



http://www.alhsa.com/forum/imgcache/301946.imgcache (http://www.libyanyouths.com/vb/t16130.html)



http://www.alhsa.com/forum/imgcache/301947.imgcache (http://www.libyanyouths.com/vb/t16130.html)



http://www.alhsa.com/forum/imgcache/301948.imgcache (http://www.libyanyouths.com/vb/t16130.html)











لا تنسوا ان افضل وقت للتمارين بعد صلاة الفجر حــيث يكثر غاز الأوزون الطبيعي و الذى يؤثر مباشرة على صحتكم للأفضل..



حيث ان الأوزون فى العيادات مصنع و ليس طبيعيا مثل الأوزون الموجود قبل شروق الشمس


اكيد انك اجهدت رقبتك من كثر المطالعة للكومبيوتر و هذة تمارين تحافط عليك و تعطى رقبتك قوة و صحة و جمال طبيعيى داخلى و للجلد ايضا ,, فقط استلقى و كررها ببطى 10 مرات لكل وضع فى البداية









http://www.alhsa.com/forum/imgcache/301948.imgcache (http://www.libyanyouths.com/vb/t16130.html)



http://www.alhsa.com/forum/imgcache/301949.imgcache (http://www.libyanyouths.com/vb/t16130.html)



تمارين مفيدة جدا لآزالة الألم و تقوية العضلات




http://www.alhsa.com/forum/imgcache/301950.imgcache (http://www.libyanyouths.com/vb/t16130.html)




http://www.alhsa.com/forum/imgcache/301951.imgcache (http://www.libyanyouths.com/vb/t16130.html)



http://www.alhsa.com/forum/imgcache/301952.imgcache (http://www.libyanyouths.com/vb/t16130.html)



http://www.alhsa.com/forum/imgcache/301953.imgcache (http://www.libyanyouths.com/vb/t16130.html)




و الان تمارين البطن البسيطة



http://www.alhsa.com/forum/imgcache/301942.imgcache (http://www.libyanyouths.com/vb/t16130.html)http://www.alhsa.com/forum/imgcache/301943.imgcache (http://www.libyanyouths.com/vb/t16130.html)


واتمنى الشفاء للجميع

nosa_aic
06 - 01 - 2012, 18:18
الوقاية من فقدان البصر بواسطة تناول السمك



في الوقت الذى تضاعف فيه التدخين من مخاطر الاصابة بفقدان البصر بين كبار السن إلا أن تناول كميات وفيرة من الاسماك يساعدهم على مكافحة الوقوع فريسة لهذا الخطر الداهم.


فقد أكدت الابحاث العلمية الحديثة في هذا الصدد أن كبار السن من المدخنين معرضون بنحو الضعفين لمخاطر الاصابة بتدهور وظائف شبكة العين والاصابة بفقدان البصر بالمقارنة بكبار السن من غير المدخنين.

تدهور كفاءة شبكة العين هو من الامراض التي تؤثر بصورة كبيرة على وظيفة إبصار العين حيث تعد من أهم الاسباب للاصابة بالعمى للاشخاص الذين تخطوا الستين عاما.

ويرى الباحثون إمكانية التغلب وخفض مخاطر الاصابة بفقدان البصر بمعدل الثلث في حالة تناول كميات وفيرة من الاسماك إلى جانب تقليل الاثار السلبية الناجمة عن عادة التدخين السيئة.

فقد قدمت دراستان حديثتان سببا آخر للإكثار من تناول السمك، وهو الوقاية من مرض "التنكس البقعي" المرتبط بالتقدم في العمر، والذي يعتبر السبب الرئيسي المؤدي لفقدان البصر عند كبار السن.

ويعرف بأن الأحماض الدهنية المسماة "أوميجا 3"، الموجودة في الأسماك كالسلمون، تساعد على المحافظة على القلب والدماغ بصحة جيدة. وتضيف الدراستان برهانا جديدا يدل على ان اولئك الذين يتناولون السمك يحمون أعينهم أيضا. ورغم ان الدراستين لا تعتبران أقوى دليل علمي، لكنهما تؤيدان اكتشافات علمية خرجت بها دراسات سابقة، كانت قد ربطت بين استهلاك السمك والوقاية من مرض "التنكس البقعي".

وقد اظهرت الدراسة الأولى ان خطورة الاصابة بهذا المرض، الذي يصيب العين عند المدخنين، تزيد بمقدار الضعف تقريبا عنها عند غير المدخنين. يذكر أن مرض "التنكس البقعي" بحدوث اعتام في مركز رؤية العين، ومن ثم يتطور الى العمى بصورة تدريجية أو بسرعة في بعض الاحيان، حسب طبيعة المرض.

nosa_aic
06 - 01 - 2012, 21:16
مع موسم الامتحانات.. أطعمة تقوى الذاكرة



http://img.youm7.com/images/NewsPics/large/smal220101011480.jpg


مع دخول موسم الامتحانات وردت أسئلة عديدة عن علاقة الغذاء بالذاكرة، وهل توجد أطعمة معينة تقوى الذاكرة.

يجيب عن هذا التساؤل الدكتور هانى كمال أستاذ أمراض التغذية بكلية الطب جامعة القاهرة، مشيراً إلى أن هناك بعض الأطعمة التى تحسن من أداء وكفاءة المخ ومراكز التفكير وتقلل من التعرض لأمراض الزهايمر منها الأطعمة التى تحتوى على سكريات، فالسكر يعد غذاءً رئيسياً للمخ خاصة الأطعمة التى تحتوى على سكريات ولا تحتوى على الدهون الثلاثية غير المشبعة التى تزيد من نسبة الكوليسترول بالدم وتسبب أمراض تصلب الشرايين.

يضيف كمال أن الأطعمة الغنية بفيتامين سى تساعد فى تنشيط الذاكرة خاصة الخضروات والفواكه كالليمون والجوافة واليوسفى والبرتقال كما أنها تعمل كمضادات للأكسدة وذلك للتخلص من المخلفات غير المفيدة للجسم والتى تنتج بعد عمليات الأكسدة داخل الجسم.

أما عن تناول الطعام بكثرة فذلك يؤثر فى كفاءة المخ ويصيب العقل بالخمول وقلة التركيز لذا يفضل أن يتم تناول كميات مناسبة من الطعام لا تزيد عن احتياج الجسم.

Osama_720
06 - 01 - 2012, 22:29
كيف توقف الزكام قبل تفاقمه؟ (http://www.klmty.net/2012/01/blog-post_7815.html)

أخبار خفيفة (http://www.klmty.net/search/label/%D8%A3%D8%AE%D8%A8%D8%A7%D8%B1%20%D8%AE%D9%81%D9%8 A%D9%81%D8%A9)


06/01/2012



دليل الشفاء. هل تشعر بدغدغة في حنجرتك. صداع في رأسك. وألم في عضلاتك. إذا كانت الإجابات كلها نعم، فعلى الارجخ بأنك على وشك الاصابة بشيء ما. وعلى الارجح بأنه الزكام. تقول جين سادلر، طبيبة عائلة في مستشفى بايلور- غارلند في غارلند، تكساس، يصاب الشخص البالغ بالزكام ثلاثة مرات في السنة في المتوسط، يدوم كل واحد منها تسعة أيام. لكن هذا لا يعني بالضرورة أن تستسلم للمرض. نقدم لك هذه النصائح للسيطرة على الزكام قبل حدوثه والشعور بالتحسن في الغد.



بمجرد الشعور الأعراض:
http://www.esgmarkets.com/forum/data:image/jpeg;base64,/9j/4AAQSkZJRgABAQAAAQABAAD/2wBDAAkGBwgHBgkIBwgKCgkLDRYPDQwMDRsUFRAWIB0iIiAdHx 8kKDQsJCYxJx8fLT0tMTU3Ojo6Iys/RD84QzQ5Ojf/2wBDAQoKCg0MDRoPDxo3JR8lNzc3Nzc3Nzc3Nzc3Nzc3Nzc3Nz c3Nzc3Nzc3Nzc3Nzc3Nzc3Nzc3Nzc3Nzc3Nzc3Nzf/wAARCAC2ARYDASIAAhEBAxEB/8QAGwAAAQUBAQAAAAAAAAAAAAAAAwACBAUGAQf/xAA6EAABBAECBAUCAggHAAMAAAABAAIDEQQhMQUSQVEGEyJhgT JxkaEUFSNCUrHR4QckM2LB8PE0U3L/xAAZAQADAQEBAAAAAAAAAAAAAAABAgMABAX/xAAkEQACAgMAAgICAwEAAAAAAAAAAQIRAyExEkEEMhNRFCJhcf/aAAwDAQACEQMRAD8A9AiGwIqgnE62VwaChqmu0+xXEekh5N2US EaVdWg2Aa7oheGtFHX2CyDLgj6vqGyYWeq+x1ReYHZd5gb6fCZ sRaGlppv2/FBfYJAH908ymy2vm0J8gBq7oboNpjKxpot1K6+wQuMtzSeuq7M bB9ko1nA11UBumlhsAmr7InNyx2N0Ln6u0KwVs4/0nT+W6E6tNbHuPdcmkp2m1hBe+wO1JbDRx5+ragdwFGdROg1+y fI6yaOhpRvMBkAB2WGoa9vpcSdyorzQJduFYSNJhqt1CmYGhwI 7G0QDGOLoxXerUeawSNNe5UhmjQNq3UecWCTv3RFBONirFXqgz ANJLiB0RHVVFNe3c/8ACwCOB6wAQaQ5a5qA37ogb+2ujfe0ycFhF9kUCQ3l9N0gP23U lv0oD9QaCxMYPp3GoWU8QGsx19gVqSeWlnOMYzp+IOANNDQSVS HSeTgbgEdxHQfVd+yvBpsouBA2GBgHZSU7OZiK4kVxYx1K1xJY wrSXEljHr7q5gO+y51ojVdOv3C4Tr7ErnPQse1odRpde6zV6Cq Sa0k2KUbKmZD9T2X2R4K3Y58oD/wChtRZc5sZF+kHqXKvzcsl45Swjs0glVk0zmtJLjykd6S2w2X3 6cxxPrFjWh/ygyZsbxyhz2i65iw/0WanlcQHc742/xA6D/hQmTTMcT5j3kOHqfynT41RNbN9hzRtaeU6HUGjqE8kCPV1vrqs G3jk4ePMfGWm6DCP6qfi8bkZJynkDQatxA/BGxTZkU2tDrqo85a1pJIvZQcfjUTmAl4rclR/1jFNLfPzUbpBjxYWSV3M49LAATJZyDtrv26qNkZrWjQiwb1UF+ WH0btzj1Slbssw4mx/3ZQGSHzr6k0uPn0JvUmgVzGY50jL19V/3QGT0W849A0um2octXdX291Nmdyss3oKUKT0x276j+SIPRFnIj YzXUu1Ud5qOiuTPa6YWdL099EyWQBhrT7oiy0DuhsdU+r/BBL2kN/FdMno03JRFGWOfTXXQWhZDtgRsnMdZdsNbQsscrXV3sIoWVUdD/T8IdirB26KHPlgQaUD7FV44oGnle4h3TnFJqI+Wy5eA4FV08JO ewkW1zNfhS8WbzmAijfY2nTAc7TXdaOmCe4jRoKGyVpLiocwiu FJcJWMdtcStctEwkly0ljHsdegXv1QyNNda9kd32QpTpra5j0E dNiOmb9rVTnwvk1ka74sfmrZoBb6SDfcpjwQadoOztQsDhmDgO aSXEujPVv1D4TJ+GOaOZs/NY2I3WjkZGRq3UXQ/oVHfHyAghrondCEaAY3Jjnx+YxuIv6y11Ej7f1VRliOM+Y1z71 2ANfFfyK3GRgNPMGNofug7j2vdU2fwl3NztjcC6xQcQhY/iZLIyfSWmR5aB9JbR/NDxs8RGmxb/Uequ8rD/ZujdFzAakuAoKtnwGFhPJH7ANTWhfBgpeLS83ptreoKIONSQRh xsO9rQf1Y4DSmD23TP1bG937R/MR0rda4m8JHP1zNO8NJtvburLEyy9zS5rvfmKrmYWPG/lAo3seis4IQWgk3WwCDa9DKL9k9+R62jm3Gn/fwVxwyZsUXmPdf/KpY2DlA5QXbX2Hsp+NjGVred1NB2GlqbZRRLWGd+U8uH0Xp7rm UdC3ahr90SF3kRhrQAB26qr4hkH1UQT90A0Qi4unNH6Tp1ULOz OShfXX2Tmv5HklwF7kaqq4gHOc436dwqInNkp+a3k5i+gNigji rAK5rFaaqjklLrbqCO+yiSue4/Sa6mlRRIubNE7jLWe/alFyeM80ZFg30Kz7mytNCxXfdcALzZIsFP4om5tllLntddgE9n afmohkDzzN0+EwRv0NOOu9IseLNMSDyg+7kaoXZN4VJIyYchLb 3rZaJ8heG0ByrPw4j4z6muvpW3/ivMWN/KC/slfTP6j6S5UYMTgxEkADCmuapXKhSCkTEYmly0n7ptrAHJJtpI mPaXO0KYbGv4Jx/6E1wcRQ0C5Weijjhd38aKJNzts8xpH5a1cXEHoDSHIY7Iv4u1k bRBOU1l84039v7II4ljuPNz0dqPVScvHaW8zdL9qWfyeD5HmmS DKfGejeUEH2KDY1FwMlshIYGubVgk7EdEKVpewObCHHclUmd+u omRiCGKRrTRDdHH4P87VNneIM7DIjycKeFnLejSbHU2CVqbBaR fZjCQAYJLG/K1VuTBNyBzImtaehNKsb4vxeUl4yDy7kl1BQcjxTBK55ZFkP5d dGk6fKKhL9G84k2bzmOuRo36FQZXvLhsRZ60hnimTOR5eJI1hP 1yAAD8Fz9HznkOfK1oPRrdFqa6FSvgXy5XQAtLSf3Sbvun42TI MoQygAUKIuv5JRQMb+0ldJIddA7Vv2CveE8Ldxp7MfGbzSXbJR +6K6+39lq9IPFbDMxzyBzWDUbgqww4Zq0FdLK3HB/CmFi40YyryJmtHM4kht+w/qrIcJwGG2YzAflUXx5eyX8qC4YocPdJHb5DXsFVZ3DC0F4D679 F6cMHHu/IZ+CfLCwt5SxvL2rRN/H/wBJP5f6R4TxKF8bf2Y/NZfiWdP5oiaANAd179xvwvwzOhcTEIpCPrjdy/lsvPs7/DDLme9+NxGD1f8A2MIIHxaKxuLA80ZI82a+QkB5ItSoCCQRblt YP8KOJChPxfFFfwxOJ/4VhF/ha0NaJOKku68sGnxqi4SAskTCObzD1Q/bTZL9HjkAAcy/wpa/xF4Oj8P4DcxudJKTI1nKW1uD7+yzpbG/6oWP73ukacelYyjJaBR4Feqqb7dflTmYkbTdXXc2EAeWzVkRYP 8Aa4hEORyMsucR2KW2ZpEg+WPSKLu6lMb6R9lV4n7SWwDRKtm7 JokcmjtJJJJyQkCbZHQZdljEOTdMRJN0NEBxJJJYB7ZQJPVLyy SE/wCwTqsdlz9PQI72Hm0v40UZ0b2/SST3J0ViRohlvMNLQoxVyiU1y8p99kIxygF3mxNA9rVlJjMeDz NvsgnGa0VGxoPchCqHRUukljeXEh166sNfdDneyRlTCJ1fcKxm gnv/AF+Uf7WKLLiyvH+vIftX9EoWrKJ2Lw5sRi/RYOUd22oRhxYz+ygjGleloGi0H6odkGg2V7zuS6v7I8fhkknnc xhHyUyjKQrlGJlfI1PLGA2lF8slpc1vpF6HYr0CPwvFIwh2S73 LW0p3DfDHDoZRM9hmrZshtt/atVRYZMR54owHBvCXEeKvjkZC6PGcb894oV3HU/C9R4NwfD4RjeRhxhoOr3n6nnuSp59IA0roB0TS/lC6IY1A5cmWWTvA4NDRN9Z1sAIcLi51onKXGrpVItUdvuSo80g ceRoKfI4ud5bB8rj4ixttOvUoGAOY0D1NPyozo4rsBEmEx31+V HLZB+4gYdyi9zX3TqaNUME9QQml9N1KwDE/4sedxLEwOEYRrImm8wUa0aCN/k/gsPD4H8TBhOJPj5Bbu0P1+OYC/wAV6pI45ORIT9J0afZGwWiAFoAB6oVfR/Klo8Uy+G+JcJ3Jl4skGu7mafB2RsfAlNGR75H1qXO0C9y5w8U4 6Kl4pgYE8n/w4Q67Lg2ifwSSx3wpHKl1HnmHEI9xVKa0aLWR8Nw20IsSLm923/NXMHCcN7WRy4UDtLceQIRxsWeRM87SXoOT4a4XKfTjuiPeNxAP 4rMeIuEQcMbC6B7z5jnAtd0r/wBRcGhFJMpUGVGQpEoxCkGqGUaXdCKIKGpLqSxj3AVymk4DQJo CeD2ChR3DQ3lFbrjhpronk3p1XCDuCQtQUDLT7Jpa7Y6X0RAK6 +67VG9a6lahrI74Wka2UGSMfSLFdlYOYXENa0nT4TxhHlJkcG/mUfxt8F/JGPWQMCL0TPLTfpoqXzAmyKA6orWNawxwtOupJTo8SyPMdY7BX jFpUc05qUrBxtL2kgUy/wAVNjIa0EjX+S4CG+kCgFyZj5WU13KP5p6JN2NfNzbALkTHyuv cdymRMLHhkg1791IlfyU1nTdButsNXpB2NawcoXXaKCMhzH27b sdEWbKi2DwssiZpYpILHZceT5KLy6UU3HADAb0KLSoibIGQwtO 2iiuJCtntFG9lUZLmsca0HRYAJ7wBZ3UPNyGsjcTsuTTWTroFT ZWSZpaB9IOiRsZIJEa1BoIjZgXEgqskyL9DT6Rue6Nju012QsN FkZ9AENxL9evRCYbrVHgHqBItEULiQkOL3gC9lNjkcBRtCDwdw F11tFtPwmQBz5+X6jbjroFk/F8rpJcYFpDacQT12WgmfZPMLHcrMeKHl2TACbAjNae6WfArpSI ciIhyKQ5Dl3QyiyoSIDiSSSxj29rrNFO9kJhpdLtRSgdw9riTs ul1ba/mmMvqNF0mkQ0LpXujQxeYd6b1KZjxGeYNG25KlykRnlZsNAqQj e2TyZPHS6E5mQspo2/NR3OfI7XQdkg1ztXFdVunNwexoACITyj3TG7KDxTPbjMq/U4fgs3SMo+TokSZEcZLpHANb3VVP4ljNjChkncNiKaPxO/wFmZs3L4jkSNdJ/lw4hrG7O9z3V9wbhwFOduFz/klJ1E61ghFXIJw/jGRk5BZmR+XzC4wBoD2tXDH88hJ2CgzMbHlRsABGrvsjsd+ycd iQjFtumHwVWkMmlMkpoekbBDcwOeG6kH8QjxsoFxCDCHOyPZaU dWMpDWZj8GYRucSw9FoceZssQe02CFiuMTAZwb2FK/8OSmTDFnRu5RwSd+JD5ONJKSJ3EMmPFgc+Rwa0aklYvN4xJPL6 GObGToXdVacSm/WnFnY4P8Al8ceofxO/sqjjsQjLSB6QdVsmR+uGx4FVvosrLDYxHfqdv7KunlHKQ069VF lkcH8x/eS05HO2Tp2iUo+LDwMBUtoc3Sio2MdFPYRVFFCM6z3UvHI3Kjh l/Tr7dURjqbRFFMKyY2T7FO5raooNHUhO5gfsiAfKCRposn4lP8A n2tu+WMfzK1lX1VZxjhP6czzItJ2j0n+L2KEtoy0ZBDk2RXsdG 9zJGlrmmiCNQUOTZSGIcqCjTdUFEBxJJJYx7QHa0iNoUhdTonV ehUDtQ8m3DpS703TeoI6IsEXnStZ0J1Psstuh7pWWGFF5UBcfq dr8IL9XkqTM+7Y3YboAABcT2XXVKjitttsbrQSC67p7rg9Is/AWMPJpupWK8Tvdk5bYoy7Xej0C1eZL5WO5xNE6BZSIOyJ3zVq4 +n2HRRzSpUdHx47sNwnh5DWCtfZaaBghYGDQ0oODG8Nov2+FJe 4QxlxOqSMklorNOTpie+MPe+Q/SA0UlzMeweWKHuq+GTzYucnR0hPwNFIb63jksCtkkMg7xpIluk ayKtyeyjvk8uNzwK0tFk0YG1oq/PeWwuBvbZUc22JGKRns6cvzHuJvdarhUjsHwt+kOH7SRpeB99l jp2l89N+p5DR86La8Zc3H4G5rfojh2rsFsS6wfJlfjEznhqcmG R7zzPc8ku7m1M4wBJE/tSzfhTNa+MMJG5Wmmb5rOU7OIU1yjpaqRl3N5oy07tUBrSyWi6 xfUq34rB5bWyssXeoVS+3G3deoVFP0zlyQ9lhDKG1RUtk/uqaBxboST8qfE4V0IVEzmaLKOc7Ao7ZbHqIKro3tG5tSWv0FCk 1iUSuUHUGk4AjqPxUYOP8R/FODteqNgok8zmgO6XuFKxZmSMBbqCocZsEHY7gouDBHHKS6R1H Sq0RQrA+IOCszsc5EAAyGjQ/xjsVhZmuY4teC1zTRB6FemiwSA6wq7ivBcXiLS5w8uXpI0a/PdaUb4ZM83l6oCsuL8OyOHZBiyGGv3Xgelw9iq0qYTiSSSJj2o C2rh29wnN+kWUtCCeygztRxnqbqVPw2hkRl6nRqhxM5yxg3JpW ZZoGt0a0UFTFG3ZPNKlQDmIcn/u/dNc3lOqeR6WqyINjXmhp0TG61e66SLrogzyiKMu69B3WYUV3G5 +dzYGfvb+w6oGNjcpoBNYHSTue4kuKm/6bLOi5Z/2ds7sa8VQVh5G1YA3UDi2X5cLzezSU1+WXaE2drVXxJ36S5mMw 2ZXBm/dSlLVItCG7Ze4kQZh44AGkY1P21T4SeYucOqM+IxwhraDWgAD2 XYYw3fshGOyblaH7+yquKuuIgb0rYNvmLtFScVfyiQ9GqktIWG 5FFhsycrisZgiDmwnmeTsOy0XE5ct2HI0xteSwjlafZE4BAY+G Rv6v9Z+URj/NnMZAo7KkU4xNkqUr/RgeC+HOJYjPP/SIgbsR6n81p+FZzZz5Uo5ZYtHAqVI0Y+ZyV6H7fdZ3jhkwc1mT HowHUDqOqlftFVLy0y44jjc2OR2JKzWREYgCRoVqIMpuZitcwg gjVV+Zj8+K70+pthF72icuUyjiP4hTYo7bbTuq9w5COU6Dcqdi uO7HEuO5OyaMqOecbJLGOJqkYc10U+F3V7SK290YBrqo/irpp8INNAW2njm3RRHSdyaJqFsG0urcpcz+rj+KIG0Eg32RoFn MLJML+R59JOh7K2ZJeu4VG+Oip2FOGxAyHbT7rIDFx/KxYOHvOUxj2kVyOFgleZSua+RzmsDGk6NBJA/FW/iPiBz81zmueYm6Na7Sj1VKUrdsKOJJJIGPamEHQJFuuvXdNiFA 9HIwBe5oA1JoKNWdjZIwYhfN8BTnCj8KMSImBo3UhruenDal0w XiqOSbcnYKZtj3XHmmtA7IrhegBQcn0kdqTMCYCSUNCrMtzpHc xJvZo7KW87kqLXPJ9lKT0WgtnceGgu5LSRQUpgDG6qFlyWDqoP h1ReyqyntiYSOiZ4ZiOdnSZb2nysc8rL6v/sD+aDxVziRHGLe+g1vclanhWG3Cwosdg+kakDc9SpxjbLTnUf8 AoaUaAV7rrAC2yk/V35JwoBVSOVsDM4BhaOqy3iGUtieAdStFlPq6WS46/wA7IhgG8kjR+aSfC2Ff2Nlhs8vAibVUwD8kDDjAyC6lIxA58Ia 40AEgxrQS3dWctKiX7TKXj7/Le2T+F4KreMwieDbQhS/Ebrgf9k2D/M4TOppRXWUuoplB4eyTiZDsR7tN232Wn8oPje3o4LG8bx5MWUz xA88ZsV1HZaLw9xJuZiNcTrS0f0Ge1ZWz8M9L2tBFkqLGZcWQR voN6EdVsHxNdZoaquysBrm25gRSIt2RceTmo7qY2MOGuiqfVhv Jo8n8lZYeZFIB6gnpAoL5cjPpNjsU4SNungsPvspUZY8ekhOfj hzUyk0TcEwHIKsbJpaeVwHZOdiFurHFv2K4fPjbuHfdOsi9k3i foDXNG3uRqqzieWMJpANyH6W3+ZVllZrWRHmjp42rqsblSPlme +W+cnUdkXJPgri10h5Li97nuNucbKilSJuqjlABxJJJYx7O0kk KXh/vSHZo/MqDG8XXXoj+bTA1tjWz7qa07Ol7VEokvf7KRE6m8vyFAY9zRd2 ntywK5m6d2qiyIm8brRZsFNBJpAy/VGXdAdESGeOZgcw83SuxQ899QhlDU2qvhJKmVkzuVpK5iNLjZG 6bI0yvbGOu/wBlPhibEylCW2dEdIFMBsFX5QDWkvOgU+Rwbdqi41mBrSAVGTo vjjbI/CYzmcXMrhbIRzfJ2WtYeUWqfw5iugwBJI2pJjzuveun5K2daMd IOR26Gje12R1MNJNGuqUuoToj7KzNdTCstjxnL8RRDcQgvP32C 0nE38sblWeFYPMycvIcN3Bo+P8A1RkrdHTj1Fs0cTiKF0lO4Na aKeQ1gLgLP2UDJe7foU1NCVZSeIH3BJ9il4XlE2C0nXQBRPEEo 8mT/wDJUXwHl+ZihpPXZCL2O1eMseMwCWSShoNFmsOV/B84NJvHlOnsVtOJ4txySN6rK8Yxy/DIY3mcBrW6zTTFjJGuwshs0TSDupQi5xqsL4T4w9zP0fIBZLHo Q7dbvElD2gg2mQk40VHE8TQ0FnMkuxHc7QSzY0NlucmDnaVRZu DzOcANEWhU6IWBxJ5DTyuaT3V9jZoeNSLWEycPKgyHNimkDDqA SjYuRmROFOc87UVhqTPQGva4aUmub7FUnD80mg8+rqrqKQPb7r CtUV2dDzepo16LKcRgLXF/W/UtzNHY2sKi4piWHUNCitMVq1RjplGO6m5cRieWuUI7qhzNUcSS SRAexMPVFY7akkkjOkIXelCeQe6SSmx0G4O8jIczoW38hSeIuJ KSSvj+hCf3OQMDW3uTuU+Q8rdNkkkjKogZL7aTss83G/WXFI4Xmowed47gdEklzy6jqhqLNexulBPeNEklY5mcaBdpkySS b0KUPFneh32TfCtnBc5tWXuv8UklFfc6l9C3kDy0kuFKNkCo26 6NF/dJJNIR8MV4nlLcad/+wrNeBOIvikDNaSSS+iseUepxSedj6jQjqqyXCYCSDoUkk0jne uFFxPhHK45WO8NmZqCdj7FWfAuIvlY2xR6pJIIfsTTNPOy0CSE H5SSTkmUPEcVj3OvuoTIxF6+hNNHZJJKMJrQ6SxoVaYMpbQJJS SRM+Fq11tF9lFzIg5pKSSJP2ZTi+G14cRoRqCs07dJJPEnk6NS SSTEj/9k= (http://data:image/jpeg;base64,/9j/4AAQSkZJRgABAQAAAQABAAD/2wBDAAkGBwgHBgkIBwgKCgkLDRYPDQwMDRsUFRAWIB0iIiAdHx 8kKDQsJCYxJx8fLT0tMTU3Ojo6Iys/RD84QzQ5Ojf/2wBDAQoKCg0MDRoPDxo3JR8lNzc3Nzc3Nzc3Nzc3Nzc3Nzc3Nz c3Nzc3Nzc3Nzc3Nzc3Nzc3Nzc3Nzc3Nzc3Nzc3Nzf/wAARCAC2ARYDASIAAhEBAxEB/8QAGwAAAQUBAQAAAAAAAAAAAAAAAwACBAUGAQf/xAA6EAABBAECBAUCAggHAAMAAAABAAIDEQQhMQUSQVEGEyJhgT JxkaEUFSNCUrHR4QckM2LB8PE0U3L/xAAZAQADAQEBAAAAAAAAAAAAAAABAgMABAX/xAAkEQACAgMAAgICAwEAAAAAAAAAAQIRAyExEkEEMhNRFCJhcf/aAAwDAQACEQMRAD8A9AiGwIqgnE62VwaChqmu0+xXEekh5N2US EaVdWg2Aa7oheGtFHX2CyDLgj6vqGyYWeq+x1ReYHZd5gb6fCZ sRaGlppv2/FBfYJAH908ymy2vm0J8gBq7oboNpjKxpot1K6+wQuMtzSeuq7M bB9ko1nA11UBumlhsAmr7InNyx2N0Ln6u0KwVs4/0nT+W6E6tNbHuPdcmkp2m1hBe+wO1JbDRx5+ragdwFGdROg1+y fI6yaOhpRvMBkAB2WGoa9vpcSdyorzQJduFYSNJhqt1CmYGhwI 7G0QDGOLoxXerUeawSNNe5UhmjQNq3UecWCTv3RFBONirFXqgz ANJLiB0RHVVFNe3c/8ACwCOB6wAQaQ5a5qA37ogb+2ujfe0ycFhF9kUCQ3l9N0gP23U lv0oD9QaCxMYPp3GoWU8QGsx19gVqSeWlnOMYzp+IOANNDQSVS HSeTgbgEdxHQfVd+yvBpsouBA2GBgHZSU7OZiK4kVxYx1K1xJY wrSXEljHr7q5gO+y51ojVdOv3C4Tr7ErnPQse1odRpde6zV6Cq Sa0k2KUbKmZD9T2X2R4K3Y58oD/wChtRZc5sZF+kHqXKvzcsl45Swjs0glVk0zmtJLjykd6S2w2X3 6cxxPrFjWh/ygyZsbxyhz2i65iw/0WanlcQHc742/xA6D/hQmTTMcT5j3kOHqfynT41RNbN9hzRtaeU6HUGjqE8kCPV1vrqs G3jk4ePMfGWm6DCP6qfi8bkZJynkDQatxA/BGxTZkU2tDrqo85a1pJIvZQcfjUTmAl4rclR/1jFNLfPzUbpBjxYWSV3M49LAATJZyDtrv26qNkZrWjQiwb1UF+ WH0btzj1Slbssw4mx/3ZQGSHzr6k0uPn0JvUmgVzGY50jL19V/3QGT0W849A0um2octXdX291Nmdyss3oKUKT0x276j+SIPRFnIj YzXUu1Ud5qOiuTPa6YWdL099EyWQBhrT7oiy0DuhsdU+r/BBL2kN/FdMno03JRFGWOfTXXQWhZDtgRsnMdZdsNbQsscrXV3sIoWVUdD/T8IdirB26KHPlgQaUD7FV44oGnle4h3TnFJqI+Wy5eA4FV08JO ewkW1zNfhS8WbzmAijfY2nTAc7TXdaOmCe4jRoKGyVpLiocwiu FJcJWMdtcStctEwkly0ljHsdegXv1QyNNda9kd32QpTpra5j0E dNiOmb9rVTnwvk1ka74sfmrZoBb6SDfcpjwQadoOztQsDhmDgO aSXEujPVv1D4TJ+GOaOZs/NY2I3WjkZGRq3UXQ/oVHfHyAghrondCEaAY3Jjnx+YxuIv6y11Ej7f1VRliOM+Y1z71 2ANfFfyK3GRgNPMGNofug7j2vdU2fwl3NztjcC6xQcQhY/iZLIyfSWmR5aB9JbR/NDxs8RGmxb/Uequ8rD/ZujdFzAakuAoKtnwGFhPJH7ANTWhfBgpeLS83ptreoKIONSQRh xsO9rQf1Y4DSmD23TP1bG937R/MR0rda4m8JHP1zNO8NJtvburLEyy9zS5rvfmKrmYWPG/lAo3seis4IQWgk3WwCDa9DKL9k9+R62jm3Gn/fwVxwyZsUXmPdf/KpY2DlA5QXbX2Hsp+NjGVred1NB2GlqbZRRLWGd+U8uH0Xp7rm UdC3ahr90SF3kRhrQAB26qr4hkH1UQT90A0Qi4unNH6Tp1ULOz OShfXX2Tmv5HklwF7kaqq4gHOc436dwqInNkp+a3k5i+gNigji rAK5rFaaqjklLrbqCO+yiSue4/Sa6mlRRIubNE7jLWe/alFyeM80ZFg30Kz7mytNCxXfdcALzZIsFP4om5tllLntddgE9n afmohkDzzN0+EwRv0NOOu9IseLNMSDyg+7kaoXZN4VJIyYchLb 3rZaJ8heG0ByrPw4j4z6muvpW3/ivMWN/KC/slfTP6j6S5UYMTgxEkADCmuapXKhSCkTEYmly0n7ptrAHJJtpI mPaXO0KYbGv4Jx/6E1wcRQ0C5Weijjhd38aKJNzts8xpH5a1cXEHoDSHIY7Iv4u1k bRBOU1l84039v7II4ljuPNz0dqPVScvHaW8zdL9qWfyeD5HmmS DKfGejeUEH2KDY1FwMlshIYGubVgk7EdEKVpewObCHHclUmd+u omRiCGKRrTRDdHH4P87VNneIM7DIjycKeFnLejSbHU2CVqbBaR fZjCQAYJLG/K1VuTBNyBzImtaehNKsb4vxeUl4yDy7kl1BQcjxTBK55ZFkP5d dGk6fKKhL9G84k2bzmOuRo36FQZXvLhsRZ60hnimTOR5eJI1hP 1yAAD8Fz9HznkOfK1oPRrdFqa6FSvgXy5XQAtLSf3Sbvun42TI MoQygAUKIuv5JRQMb+0ldJIddA7Vv2CveE8Ldxp7MfGbzSXbJR +6K6+39lq9IPFbDMxzyBzWDUbgqww4Zq0FdLK3HB/CmFi40YyryJmtHM4kht+w/qrIcJwGG2YzAflUXx5eyX8qC4YocPdJHb5DXsFVZ3DC0F4D679 F6cMHHu/IZ+CfLCwt5SxvL2rRN/H/wBJP5f6R4TxKF8bf2Y/NZfiWdP5oiaANAd179xvwvwzOhcTEIpCPrjdy/lsvPs7/DDLme9+NxGD1f8A2MIIHxaKxuLA80ZI82a+QkB5ItSoCCQRblt YP8KOJChPxfFFfwxOJ/4VhF/ha0NaJOKku68sGnxqi4SAskTCObzD1Q/bTZL9HjkAAcy/wpa/xF4Oj8P4DcxudJKTI1nKW1uD7+yzpbG/6oWP73ukacelYyjJaBR4Feqqb7dflTmYkbTdXXc2EAeWzVkRYP 8Aa4hEORyMsucR2KW2ZpEg+WPSKLu6lMb6R9lV4n7SWwDRKtm7 JokcmjtJJJJyQkCbZHQZdljEOTdMRJN0NEBxJJJYB7ZQJPVLyy SE/wCwTqsdlz9PQI72Hm0v40UZ0b2/SST3J0ViRohlvMNLQoxVyiU1y8p99kIxygF3mxNA9rVlJjMeDz NvsgnGa0VGxoPchCqHRUukljeXEh166sNfdDneyRlTCJ1fcKxm gnv/AF+Uf7WKLLiyvH+vIftX9EoWrKJ2Lw5sRi/RYOUd22oRhxYz+ygjGleloGi0H6odkGg2V7zuS6v7I8fhkknnc xhHyUyjKQrlGJlfI1PLGA2lF8slpc1vpF6HYr0CPwvFIwh2S73 LW0p3DfDHDoZRM9hmrZshtt/atVRYZMR54owHBvCXEeKvjkZC6PGcb894oV3HU/C9R4NwfD4RjeRhxhoOr3n6nnuSp59IA0roB0TS/lC6IY1A5cmWWTvA4NDRN9Z1sAIcLi51onKXGrpVItUdvuSo80g ceRoKfI4ud5bB8rj4ixttOvUoGAOY0D1NPyozo4rsBEmEx31+V HLZB+4gYdyi9zX3TqaNUME9QQml9N1KwDE/4sedxLEwOEYRrImm8wUa0aCN/k/gsPD4H8TBhOJPj5Bbu0P1+OYC/wAV6pI45ORIT9J0afZGwWiAFoAB6oVfR/Klo8Uy+G+JcJ3Jl4skGu7mafB2RsfAlNGR75H1qXO0C9y5w8U4 6Kl4pgYE8n/w4Q67Lg2ifwSSx3wpHKl1HnmHEI9xVKa0aLWR8Nw20I)
ابدأ بشرب الماء أو العصير الطازج.

الحفاظ على الترطيب يقلل من الأعراض السيئة للمرض مثل إلتهاب الحنجرة واحتقان الأنف.

غرغر فمك بالماء المالح.

لمحاربة ألتهاب الحنجرة قم بمزج نصف ملعقة شاي من الملح الى كوب ماء دافئ. " يقوم الملح بسحب الماء الفائض في أنسجة حنجرتك، مما يخفض الإلتهاب، ويقلل المخاط والمهيجات من خلف الحنجرة، الماء المالح يشطف البكتيريا والفيروسات أيضا.

أبق أنفك نظيفا.

إستعمال رذاذ الأنف الملحي مباشرة بعد الشعور بالأعراض قد يقلل من تأثيرها. كذلك الامر بالنسبة لأخذ دش ماء ساخن: تساعد الرطوبة الدافئة على تنظيف الممرات الأنفية.

توجه إلى الصيدلية خلال الساعتين الأوليتين.

خذ دواءا مسكنا لآلام مثل acetaminophen للسيطرة على الصداع. كذلك الامر بالنسبة لأدوية الحساسية التي يمكن أن تساعد في السيطرة على أعراض احتقان الأنف والعيون المدمعة؛ لأنها تحتوي على مخففات للإحتقان، مثل Claritin D أو Alavert D، تساعد على تنظيف الجيوب والحفاظ على تنفس طبيعي.

لا تأخذ علاج السعال في الساعات الست التالية.

ملعقة عسل هي أفضل ما يمكن أن تأخذه لتخفيف السعال وألم الحنجرة (كما أن مذاقه رائع )، خذ ملعقة إلى ملعقتي طعام مباشرة من العلبة أو ذوبها في كوب شاي. ولا تتجه الى الاقراص والرذاذ فالعسل سيعالج أي مشكلة بدون آثار جانبية.

تغيب عن العمل.

يمكن أن يصد جسمك أي فيروس إذا كنت مرتاحا بشكل جيد. لكن إذا كنت مضطرا للعمل، فهذه ليس نهاية العالم، فقط تجنب الاقتراب من زملاءك في العمل في الأيام القليلة الأولى لأنك قد تكون معديا جدا. لمنع المشاركة في جراثيمك، اغسل يديك بإنتظام أو استعمل هلام مطهرا أساسه كحول ولا تستعمل أغراض زملائك.

المصدر/http://www.klmty.net/2012/01/blog-post_7815.html

nosa_aic
07 - 01 - 2012, 08:21
كيف توقف الزكام قبل تفاقمه؟ (http://www.klmty.net/2012/01/blog-post_7815.html)

أخبار خفيفة (http://www.klmty.net/search/label/%d8%a3%d8%ae%d8%a8%d8%a7%d8%b1%20%d8%ae%d9%81%d9%8 a%d9%81%d8%a9)


06/01/2012



دليل الشفاء. هل تشعر بدغدغة في حنجرتك. صداع في رأسك. وألم في عضلاتك. إذا كانت الإجابات كلها نعم، فعلى الارجخ بأنك على وشك الاصابة بشيء ما. وعلى الارجح بأنه الزكام. تقول جين سادلر، طبيبة عائلة في مستشفى بايلور- غارلند في غارلند، تكساس، يصاب الشخص البالغ بالزكام ثلاثة مرات في السنة في المتوسط، يدوم كل واحد منها تسعة أيام. لكن هذا لا يعني بالضرورة أن تستسلم للمرض. نقدم لك هذه النصائح للسيطرة على الزكام قبل حدوثه والشعور بالتحسن في الغد.



بمجرد الشعور الأعراض:
http://www.esgmarkets.com/forum/data:image/jpeg;base64,/9j/4aaqskzjrgabaqaaaqabaad/2wbdaakgbwghbgkibwgkcgkldrypdqwmdrsufrawib0iiiadhx 8kkdqsjcyxjx8flt0tmtu3ojo6iys/rd84qzq5ojf/2wbdaqokcg0mdropdxo3jr8lnzc3nzc3nzc3nzc3nzc3nzc3nz c3nzc3nzc3nzc3nzc3nzc3nzc3nzc3nzc3nzc3nzf/waarcac2arydasiaahebaxeb/8qagwaaaqubaqaaaaaaaaaaaaaaawacbaugaqf/xaa6eaabbaecbaucagghaamaaaabaaideqqhmqusqvegeyjhgt jxkaeufsncurhr4qckm2lb8pe0u3l/xaazaqadaqebaaaaaaaaaaaaaaabagmabax/xaakeqacagmaagicaweaaaaaaaaaaqirayexekeemhnrfcjhcf/aaawdaqaceqmrad8a9aigwiqgne62vwachqmu0+xxeekh5n2us eavdwg2aa7ohegtfhx2cydlgj6vqgyyweq+x1reyhzd5gb6fcz sraglppv2/fbfyjah908ymy2vm0j8gbq7obonpjkxpot1k6+wqumtzseuq7m bb9ko1na11ubumlhsamr7innyx2n0ln6u0kwvs4/0nt+w6e6tnbhupdcmkp2m1hbe+wo1jbdrx5+ragdwfgdrog1+y fi6yaohprvmbkab2wgoa9vpcsdyorzqjdufysnjhqt1cmyghwi 7g0qdgoloxxerueawsnne5uhmjqnq3uecwctv3rfbonirfxqgz anjlib0rhvvfne3c/8acwcob6waqaq5a5qa37ogb+2ujfe0ycfhf9kucq3l9n0gp23u lv0od9qacxmypp3gowu8qgsx19gvqsewlnomyzp+ioanndqsvs hsetgbgedxhqfvd+yvbpsouba2gbghzsu7ozik4kvxyx1k1xjy wrsxeljhr7q5go+y51ojvdov3c4tr7ernpqse1odrpde6zv6cq sa0k2kubkmzd9t2x2r4k3y58od/wchtrzc5szf+khqxkvzcsl45swjs0glvk0zmtjljykd6s2w2x3 6cxxprfjwh/ygyzsbxyhz2i65iw/0wanlcqhc742/xa6d/hqmttmct5j3kohqfynt41rnbn9hzrtaeu6hugjqe8kcpv1vrqs g3jk4epmfgwm6dcp6qfi8bkzjynkdqatxa/bgxtzku2tdrqo85a1pjivzqcfjutmal4rclr/1jfnlfpzubpbjxywsv3m49laatjzydtrv26qnkzrwjqiwb1uf+ wh0btzj1slbssw4mx/3zqgshzr6k0upn0jvumgvzgy50jl19v/3qgt0w849a0um2octxdx291nmdyss3okukt0x276j+siprfnij yzxuu1ud5qoiutpa6ywdl099eywqbhrt7oiy0duhsdu+r/bbl2kn/fdmno03jrfgwoftxxqwhzdtgrsnmdzdsnbqsscrxv3siowvudd/t8idirb26khplgqaud7fv44ognle4h3tnfjqi+wy5ea4fv08jo ewkw1znfhs8wbzmaijfy2ntac7txdaomce4jrokgyvpliocwiu fjcjwmdtcstctewkly0ljhsdegxv1qynnda9kd32qptpra5j0e dniomb9rvtnwvk1ka74sfmrzobb6sdfcpjwqadooztqsdhmdgo asxeujpvv1d4tj+goaozs/ny2i3wjkzgrq3uxq/ovhfhyaghrondceaay3jjnx+yxuiv6y11ej7f1vrliom+y1z71 2anfffyk3grgnpmgnofug7j2vdu2fwl3nztjcc6xqcqhy/izliyfswmr5ab9jbr/ndxs8rgmxb/uequ8rd/zujdfzaakuaoktnwgfhpjh7antwhfbgpels83ptreokionsqrh xso9rqf1y4dsmd23tp1bg937r/mr0rda4m8jhp1zno8njtvburleyy9zs5rvfmkrmywpg/lao3seis4iqwgk3wwcda9dkl9k9+r62jm3gn/fwvxwyzsuxmpdf/kpy2dla5qxbx2hsp+njgvred1nb2glqbzrrlwgd+u8uh0xp7rm udc3ahr90sf3krhrqab26qr4hkh1uqt90a0qi4unnh6tp1uloz oshfxx2tmv5hklwf7kaqq4ghoc436dwqinnkp+a3k5i+gnigji rak5rfaaqjkllrbqco+yisue4/sa6mlrriubne7jlwe/alfyem80zfg30kz7mytncxxfdcalzzisfp4om5tlllntddge9n afmohkdzzn0+ewrv0noou9iselnmsdyg+7kaoxzn4vjiyychlb 3rzaj8heg0byrpw4j4z6muvpw3/ivmwn/kc/slftp6j6s5uymtgxekadcmuapxkhsckteymly0n7ptrahjjtpi mpaxo0kybgv4jx/6e1wcrq0c5weijjhd38akjnzts8xph5a1cxehodshiy7iv4u1k brbou1l84039v7ii4ljupnz0dqpvscvhaw8zdl9qwfyed5hmms dkfgejeueh2kdy1fwmlshiygubvgk7edekvpewobchhclumd+u omricgkrrtrddhh4p87vnneim7dijyckefnlejsbhu2cvqbbar fzjcqayjlg/k1vutbnybzimtaehnksb4vxeul4ydy7kl1bqcjxtbk55zfkp5d dgk6fkkhl9g84k2bzmouro36fqzxvlhsrz60hnimtor5eji1hp 1yaad8fz9hznkofk1oprrdfqa6fsvgxy5xqatlsf3sbvun42ti moqygaukiuv5jrqmb+0ldjidda7vv2cvee8ldxp7mfgbzsxbjr +6k6+39lq9ipfbdmxzybzwdubgqww4zq0fdlk3hb/cmfi40yyryjmthm4kht+w/qricjwgg2yzafluxx5eyx8qc4yocpdjhb5dxsfvz3dc0f4d679 f6cmhhu/iz+cflcwt5sxvl2rrn/h/wbjp5f6r4txkf8bf2y/nzfiwdp5oiaanad179xvwvwzohcteipcprjdy/lsvps7/ddlme9+nxgd1f8a2miihxakxula80zi82a+qkb5itsoccqrblt yp8kojchpxffffwxoj/4vhf/ha0najokku68sgnxqi4sasktcobzd1q/btzl9hjkaacy/wpa/xf4oj8p4dcxudjkti1nkw1ud7+yzpbg/6owp73ukacelyyjjabr4feqqb7dfltmykbtdxxc2eaewzvkryp 8aa4heorymsucr2kw2zpeg+wpsklu6lmb6r9lv4n7swwdrktm7 jokcmjtjjjjyqkcbzhqzdljeotdmrjn0nebxjjjyb7zqjpvlyy se/wcwtqsdlz9pqi72hm0v40uz0b2/sst3j0virohlvmnlqoxvyiu1y8p99kixygf3mxna9rvljjmedz nvsgnga0vgxopchcqhruukljexeh166snfddneyrltcj1fckxm gnv/af+uf7wklliyvh+viftx9eowrkj2lw5sri/ryoud22orhxyz+ygjglelogi0h6odkgg2v7zus6v7i8fhkknnc xhhyuyjkqrlgjlfi1plga2lf8slpc1vpf6hyr0cpwvfiwh2s73 lw0p3dfdhdozrm9hmrzshtt/atvryzmr54owhbvcxeekvjkzc6pgcb894ov3hu/c9r4nwfd4rjerhxhoor3n6nnusp59ia0rob0ts/lc6iy1a5cmwwtva4ndrn9z1saicli51onkxgrpvitudvuso80g cerokfi4ud5bb8rj4ixttovuogaoy0d1npyozo4rsbemex31+v hlzb+4gydyi9zx3tqanume9qqml9n1kwde/4sedxlewoeyrrimm8wua0acn/k/gspd4h8tbhojpj5bbu0p1+oyc/wav6pi45orit9j0afzgwwiafoab6ovfr/klo8uy+g+jcj3jl4skgu7mafb2rsfalngr75h1qxo0c9y5w8u4 6kl4pgye8n/w4q67lg2ifwssx3wphkl1hnmhei9xvka0alwr8nw20isslm923/nxmhccn7wry4udtlceqirxswerm87sxoot4a4xkftjuipenxap 4rmeiueqcmbc6b7z5jnatd0r/wbrcghfjmpugvgqpeoxckgqguaxdckikgplqsxj3avymk4dqjo ced2chr3dq3lfbrjhpronk3p1xcducqtqudlt7jpa7y6x0rak6 +67vg9a6lahri74wka2ugsmfslfdlyoyxena0nt4txhhljkcg/mufxt8f/jgpwqmcl0tpltfpoqxzamyka6orwnawxwtoupjto8sypmdy7bx jfpuc05qurbxtl2kguy/wavnjia0ejx+s4cg+kcgfyzj5wu13kp5p6jn2nfnzbalkthyuv cdymrmlhhkg1791ilfyu1ntdbutsnxpb2nawcoxxakcmhzh27b sdewbki2dwssizpypilhzcet5kly6uu3hadab0klsoibigqwto 2iiujctntfg9luzlmsca0hryaj7wbz3upnygsjctsuttwtroft zwszpab9ioirszijea1boijzgxegqskyl9dt6rue6nju012qsn fkz9aenxl9evrcybrvhghqbiteuliqkol3gc9lnjkcbrtcdwdw f11tftpwmqbz5+x6jbjrofk/f8rpjcyfpdacqt12wgmfzpmlhcrmekhl2tacbajnae6wfarpsi ciihykq5dl3qyiyosidisssxj29rrnfo9kjhpdltrsgdw9rits ul1ba/mmmvqnf0mkq0lpxujqxeyd6b1kzjxgeyng25klykrnlzsnaqqj e2tyzphs6e5mqspo2/nr3ofi7xqdkg1ztxfdvunnwexoacityj3tg7kdxtpbjmq/u4fgs3smo+tokszeczlphanb3vvp4ljnjchkncnikapxo/wfmzs3l4jksndj/lw4hrg7o9z3v9wbhwfodufz/klj1e61ghfxijw/jgrk5bzmr+xzc4wbod2txdh88hj2cgzmbhlrsabgrvsjsd+ycd iqjftumhwvwkmmlmkpoekbbdcwoeg6kh8qjxsofxcdchoypzau dwmpdwzj8gyrucsw9focezssqe02cfiumtazwb2fk/8osmtdfnru5rwsd+jd5onjksj3emmpfgc+rwa0aklyvn4xjpl6 gobgtoxdvacsm/wnfny4p8al8ceofxo/sqjjsqjlsb6qdvsmr+ugx4fvvosrldyxhfqdv7kunlhkq069vf lkch8x/es05ho2tp2iuo+ldwmbutoc3sio2mdfpyrvffcm6z3uvhi3kjh l/tr7durjqbrffmkyy2t7fo5raoonhuho5gfsiafkcrposn4lp8a n2tu+wmfzk1lx1vzxjhp6czzitj2j0n+l2ketoy0zbdk2rxsdg 9zjglrmmicnquotzsgicqcjtdufebxjjjyx7qha0inouhdtonv ehudtq8m3dps703teoi6isexnstz0j1psstuh7pwwgff5ubcfq dr8il9xkqtm+7y3yboaabct2xxvkjitttsbrqsc67p7rg9is/awmpjpupwk8tvdk5byoy7xej0c1ezl5wo5xne6bzsioyj3zvq4 +n2hrrzspudhx47snwnh5dwctfzaabghygdq0oodg8nov2+fje 4qxlxoqsmklornotpie+mpe+q/sa0ulzmewewkhuq+gtzyucnr0hpwnfib63jksctkkmg7xpiluk ayktyeyjvk8unzwk0tfk0yg1oq/pewwubvbzuc22jgkrns6cvzhujvdarhujshwt+koh7srpeb99l jp2l89n+p5dr86la8zc3h4g5rfojh2rsfss6wfjlfjeznhqcmg r7zzpc8ku7m1m4wbje/tszfhtna+mmjg5wmmb5rou7oiu1yjpaqrl3n5oy07tubrsywi6 xfuq34rb5bwyssxeovs+3g3deovfp0zlyq9lhdkg1rutk/uqabxbost8qfe4v0ivezmalkoc7ao7zbhqikro3tg5tswv0fck 1iusuuhugk4ajqpxuyop8r/fodteqngok8zmgo6xufkxzmsmbbqcoczsehy7goudbhhks6r1h sq0rqra+iocszsc5eaaygjq/xjsvhzmuy4tec1ztrb6femiwsa6wq7ivbcxils5w8uxpi0a/pdaub4zm83l6ocsul8oyohzbiyggv3xgelw9iq0qytisssjj2o c2rh29wnn+kwutcceygztrxnqbqvpw2hkrl6nrqhxm5yxg3jpw zzogt0a0uftfg3zpnklqdmicn/u/dnc3loqer6wqyinjxmhp0tg61e66slrogzyikmu69b3wyuv3g5 +dzygfvb+w6ognjcpobnyhstue4kukm/6bloi5z/2ds7sa8vqvh5g1ya3udi2x5clzezsu1+wxae2drvxxj36s5mmw 2zxbm/dsllvitcg7ze4kqzh44agky1p21t4seyucoqm+ixwhradwgad2 xyyw3fshgoyblah7+yqukuuigb0rynvmltfscvfyiq9gqktiwg 5ffhsycriszgidmwnmetsoy0xe5ct2hi0xteswjlafze4bay+g rv6v9z+urj/nnmzao7kku4xnkqur/rgec+hojyjpp/sigbsr6n81p+fzzzz5uo5zythaqvi0y+zyv6h7fdz3jhkwc1mt howhudqoqlftfvly0y44jjc2or2jkzwreygcrovqimpuzitcwg gjvv+zj8+k70+pthf72icuuyjip4htyo7bbtuq9w5cou6dcqdi uo7heuo5oyamqoecbjlgojqkyc10u+f3v7sk290ybrqo/irpp8innaw2njm3rrhsdyajqfsg0urcpcz+rj+kig0eg32rofn mljml+r59joh7k2zjeu4vg+oip2fogxayhbt7ridfx/kxyohvouxj2kvyofglezsua+rzmsdgk6nbja/fw/ipibz81zmueym6na7sj1vkurdskojjjigpamehqjfuuvxdnifa 9hiwbe5oa1joknwdjziwyhfn8btncj8kmsimbo3uhruendal0w xiqosbcnykztj3xhmmta7irhegbqcn0kdqtmcycsuncrmtzphc xjvzo7kw87kqlxpj9lkt0wgtnceggu5lsrqupgdg6qflywdqop h1reyqyntiysoiz4ziodnszb2nysc8rl6v/sd+adxvzirhgle+g1vclanhwg3cwosdg+kakdc9spxjbltnuf8 aoauaav7rrac2yk/v35jwobvsovsdm4bhaoqy3igutieadstflpq6ws46/wa7ihgg8kjr+asfc2ff2nlhs8vaibvuwd8kddjayc6lixa58ia 40aegxrqs3dwctkix7tkxj7/le2t+f4kremwiedbqhs/ebrgf9k2d/m4topprxwuuoplb4eytizdsr7tn232wn8opje3o4lg8bx5mwuz xa88zsv1hzalw9xjuzinctrs0f0ge1zwz8m9l2tbfkqlgzcwqr von6edvshxndzoaquysbrm25grsit2rcetmo7qy2moguiqfvhv jo8n8lzyezfib6gnpaol5cjppnjsu4snungspvspuzy8ekhofj hzuyk0tcewhiksbjpaevwhzodifurhfv2k4fpjbuhfdosi9k3i fodxng3urqqziewmjpanyh6w3+zvllzrwrhmjp42rqsblsplme +w+cnudkxjpgri10h5li97nunucbkilsjuqjlabxjjjyx7o0kk kxh/vshzo/mqdg8xxxoj+bta1tjwz7qa07ol7veokvf7kre6m8vyfay9zrd2 ntywk5m6d2qiyim8brrzsfnbjpay/vgxdadesgeozgcw83suxq899qhldu2qvhjkmvkzuvpk5inljzg 6bi0yvbgou/wblphibeylcw2dedifmbsfx5qdwkvogu+rwbdqi41mbrsavgto vjjbi/cyzmcxmrhbirzfj2wtyeuwqfw5iugwbji2pjjzuveun5k2damd ior26gje12r1mnjnguquuotoj7kzndtcstjxnl8rrdcqgvp32c 0ne38sblwefypmycvicn3bo+p8a1rkrdhtj1fs0ctikf0lo4na akeq1glglp2udje7fou1ncvzseih3bj9il4xle2c0nxqbrpeeo 8mt/wdjuxwhl+zihppxzcl2o1emsemwcwsshonfmsov/b84njvhlonsvtoj4txysn6rk8yxy/diy3mcbrw6zttfjjguwshs0tsdupqi5xqsl4t4w9zp0fibzlho q7dbveld2gg2mqk40vhe8tq0fnmkuxhc7qszy0nlucmdnavrzu dzocanewhu6iwbxj5dtyuat3v9jzoenslweycpkgyhnimkddqa sjyurmrofoc87uvhqtpqgva4aumub7fund80mg8+rqrqkqpb7r ctuv2ddzepo16lkcrglxf/w/utznhy2ski4piwhuncitmvq1rjplgo6m5criewuui7qhznucss sraexmpvfy7akkkjokixelceqe6ssmx0g4o8jiczow38hseiuj kssvj+hcf3oqmdw3utuu+q8rdnkkkjkogzl7atss83g/wxfi4xmowed47gdeklzy6jqhqlnexulbpenekly5mcabdpkyss b0kupfneh32tfctnbc5twxuv8uklffc6l9c3kdy0kufknkco26 6nf/djjnir8mv4nllcad/+wrneboivikdnasss+iseuepxsedj6jqjqqyxcycsdoukk0jne uffxphhk45wo8nmzqcdj7fwfauivly2xr6pjiifsttnpoy0cse h5sstkmupecvj3ovuotixf6+hnnhzjjkmjrq6sxovaympbqjjs srm+fq11tf9lfzig5pkssjp2zti+g14crorqcs07djjpenk6ns sstej/9k= (http://data:image/jpeg;base64,/9j/4aaqskzjrgabaqaaaqabaad/2wbdaakgbwghbgkibwgkcgkldrypdqwmdrsufrawib0iiiadhx 8kkdqsjcyxjx8flt0tmtu3ojo6iys/rd84qzq5ojf/2wbdaqokcg0mdropdxo3jr8lnzc3nzc3nzc3nzc3nzc3nzc3nz c3nzc3nzc3nzc3nzc3nzc3nzc3nzc3nzc3nzc3nzf/waarcac2arydasiaahebaxeb/8qagwaaaqubaqaaaaaaaaaaaaaaawacbaugaqf/xaa6eaabbaecbaucagghaamaaaabaaideqqhmqusqvegeyjhgt jxkaeufsncurhr4qckm2lb8pe0u3l/xaazaqadaqebaaaaaaaaaaaaaaabagmabax/xaakeqacagmaagicaweaaaaaaaaaaqirayexekeemhnrfcjhcf/aaawdaqaceqmrad8a9aigwiqgne62vwachqmu0+xxeekh5n2us eavdwg2aa7ohegtfhx2cydlgj6vqgyyweq+x1reyhzd5gb6fcz sraglppv2/fbfyjah908ymy2vm0j8gbq7obonpjkxpot1k6+wqumtzseuq7m bb9ko1na11ubumlhsamr7innyx2n0ln6u0kwvs4/0nt+w6e6tnbhupdcmkp2m1hbe+wo1jbdrx5+ragdwfgdrog1+y fi6yaohprvmbkab2wgoa9vpcsdyorzqjdufysnjhqt1cmyghwi 7g0qdgoloxxerueawsnne5uhmjqnq3uecwctv3rfbonirfxqgz anjlib0rhvvfne3c/8acwcob6waqaq5a5qa37ogb+2ujfe0ycfhf9kucq3l9n0gp23u lv0od9qacxmypp3gowu8qgsx19gvqsewlnomyzp+ioanndqsvs hsetgbgedxhqfvd+yvbpsouba2gbghzsu7ozik4kvxyx1k1xjy wrsxeljhr7q5go+y51ojvdov3c4tr7ernpqse1odrpde6zv6cq sa0k2kubkmzd9t2x2r4k3y58od/wchtrzc5szf+khqxkvzcsl45swjs0glvk0zmtjljykd6s2w2x3 6cxxprfjwh/ygyzsbxyhz2i65iw/0wanlcqhc742/xa6d/hqmttmct5j3kohqfynt41rnbn9hzrtaeu6hugjqe8kcpv1vrqs g3jk4epmfgwm6dcp6qfi8bkzjynkdqatxa/bgxtzku2tdrqo85a1pjivzqcfjutmal4rclr/1jfnlfpzubpbjxywsv3m49laatjzydtrv26qnkzrwjqiwb1uf+ wh0btzj1slbssw4mx/3zqgshzr6k0upn0jvumgvzgy50jl19v/3qgt0w849a0um2octxdx291nmdyss3okukt0x276j+siprfnij yzxuu1ud5qoiutpa6ywdl099eywqbhrt7oiy0duhsdu+r/bbl2kn/fdmno03jrfgwoftxxqwhzdtgrsnmdzdsnbqsscrxv3siowvudd/t8idirb26khplgqaud7fv44ognle4h3tnfjqi+wy5ea4fv08jo ewkw1znfhs8wbzmaijfy2ntac7txdaomce4jrokgyvpliocwiu fjcjwmdtcstctewkly0ljhsdegxv1qynnda9kd32qptpra5j0e dniomb9rvtnwvk1ka74sfmrzobb6sdfcpjwqadooztqsdhmdgo asxeujpvv1d4tj+goaozs/ny2i3wjkzgrq3uxq/ovhfhyaghrondceaay3jjnx+yxuiv6y11ej7f1vrliom+y1z71 2anfffyk3grgnpmgnofug7j2vdu2fwl3nztjcc6xqcqhy/izliyfswmr5ab9jbr/ndxs8rgmxb/uequ8rd/zujdfzaakuaoktnwgfhpjh7antwhfbgpels83ptreokionsqrh xso9rqf1y4dsmd23tp1bg937r/mr0rda4m8jhp1zno8njtvburleyy9zs5rvfmkrmywpg/lao3seis4iqwgk3wwcda9dkl9k9+r62jm3gn/fwvxwyzsuxmpdf/kpy2dla5qxbx2hsp+njgvred1nb2glqbzrrlwgd+u8uh0xp7rm udc3ahr90sf3krhrqab26qr4hkh1uqt90a0qi4unnh6tp1uloz oshfxx2tmv5hklwf7kaqq4ghoc436dwqinnkp+a3k5i+gnigji rak5rfaaqjkllrbqco+yisue4/sa6mlrriubne7jlwe/alfyem80zfg30kz7mytncxxfdcalzzisfp4om5tlllntddge9n afmohkdzzn0+ewrv0noou9iselnmsdyg+7kaoxzn4vjiyychlb 3rzaj8heg0byrpw4j4z6muvpw3/ivmwn/kc/slftp6j6s5uymtgxekadcmuapxkhsckteymly0n7ptrahjjtpi mpaxo0kybgv4jx/6e1wcrq0c5weijjhd38akjnzts8xph5a1cxehodshiy7iv4u1k brbou1l84039v7ii4ljupnz0dqpvscvhaw8zdl9qwfyed5hmms dkfgejeueh2kdy1fwmlshiygubvgk7edekvpewobchhclumd+u omricgkrrtrddhh4p87vnneim7dijyckefnlejsbhu2cvqbbar fzjcqayjlg/k1vutbnybzimtaehnksb4vxeul4ydy7kl1bqcjxtbk55zfkp5d dgk6fkkhl9g84k2bzmouro36fqzxvlhsrz60hnimtor5eji1hp 1yaad8fz9hznkofk1oprrdfqa6fsvgxy5xqatlsf3sbvun42ti moqygaukiuv5jrqmb+0ldjidda7vv2cvee8ldxp7mfgbzsxbjr +6k6+39lq9ipfbdmxzybzwdubgqww4zq0fdlk3hb/cmfi40yyryjmthm4kht+w/qricjwgg2yzafluxx5eyx8qc4yocpdjhb5dxsfvz3dc0f4d679 f6cmhhu/iz+cflcwt5sxvl2rrn/h/wbjp5f6r4txkf8bf2y/nzfiwdp5oiaanad179xvwvwzohcteipcprjdy/lsvps7/ddlme9+nxgd1f8a2miihxakxula80zi82a+qkb5itsoccqrblt yp8kojchpxffffwxoj/4vhf/ha0najokku68sgnxqi4sasktcobzd1q/btzl9hjkaacy/wpa/xf4oj8p4dcxudjkti1nkw1ud7+yzpbg/6owp73ukacelyyjjabr4feqqb7dfltmykbtdxxc2eaewzvkryp 8aa4heorymsucr2kw2zpeg+wpsklu6lmb6r9lv4n7swwdrktm7 jokcmjtjjjjyqkcbzhqzdljeotdmrjn0nebxjjjyb7zqjpvlyy se/wcwtqsdlz9pqi72hm0v40uz0b2/sst3j0virohlvmnlqoxvyiu1y8p99kixygf3mxna9rvljjmedz nvsgnga0vgxopchcqhruukljexeh166snfddneyrltcj1fckxm gnv/af+uf7wklliyvh+viftx9eowrkj2lw5sri/ryoud22orhxyz+ygjglelogi0h6odkgg2v7zus6v7i8fhkknnc xhhyuyjkqrlgjlfi1plga2lf8slpc1vpf6hyr0cpwvfiwh2s73 lw0p3dfdhdozrm9hmrzshtt/atvryzmr54owhbvcxeekvjkzc6pgcb894ov3hu/c9r4nwfd4rjerhxhoor3n6nnusp59ia0rob0ts/lc6iy1a5cmwwtva4ndrn9z1saicli51onkxgrpvitudvuso80g cerokfi4ud5bb8rj4ixttovuogaoy0d1npyozo4rsbemex31+v hlzb+4gydyi9zx3tqanume9qqml9n1kwde/4sedxlewoeyrrimm8wua0acn/k/gspd4h8tbhojpj5bbu0p1+oyc/wav6pi45orit9j0afzgwwiafoab6ovfr/klo8uy+g+jcj3jl4skgu7mafb2rsfalngr75h1qxo0c9y5w8u4 6kl4pgye8n/w4q67lg2ifwssx3wphkl1hnmhei9xvka0alwr8nw20i)
ابدأ بشرب الماء أو العصير الطازج.

الحفاظ على الترطيب يقلل من الأعراض السيئة للمرض مثل إلتهاب الحنجرة واحتقان الأنف.

غرغر فمك بالماء المالح.

لمحاربة ألتهاب الحنجرة قم بمزج نصف ملعقة شاي من الملح الى كوب ماء دافئ. " يقوم الملح بسحب الماء الفائض في أنسجة حنجرتك، مما يخفض الإلتهاب، ويقلل المخاط والمهيجات من خلف الحنجرة، الماء المالح يشطف البكتيريا والفيروسات أيضا.

أبق أنفك نظيفا.

إستعمال رذاذ الأنف الملحي مباشرة بعد الشعور بالأعراض قد يقلل من تأثيرها. كذلك الامر بالنسبة لأخذ دش ماء ساخن: تساعد الرطوبة الدافئة على تنظيف الممرات الأنفية.

توجه إلى الصيدلية خلال الساعتين الأوليتين.

خذ دواءا مسكنا لآلام مثل acetaminophen للسيطرة على الصداع. كذلك الامر بالنسبة لأدوية الحساسية التي يمكن أن تساعد في السيطرة على أعراض احتقان الأنف والعيون المدمعة؛ لأنها تحتوي على مخففات للإحتقان، مثل claritin d أو alavert d، تساعد على تنظيف الجيوب والحفاظ على تنفس طبيعي.

لا تأخذ علاج السعال في الساعات الست التالية.

ملعقة عسل هي أفضل ما يمكن أن تأخذه لتخفيف السعال وألم الحنجرة (كما أن مذاقه رائع )، خذ ملعقة إلى ملعقتي طعام مباشرة من العلبة أو ذوبها في كوب شاي. ولا تتجه الى الاقراص والرذاذ فالعسل سيعالج أي مشكلة بدون آثار جانبية.

تغيب عن العمل.

يمكن أن يصد جسمك أي فيروس إذا كنت مرتاحا بشكل جيد. لكن إذا كنت مضطرا للعمل، فهذه ليس نهاية العالم، فقط تجنب الاقتراب من زملاءك في العمل في الأيام القليلة الأولى لأنك قد تكون معديا جدا. لمنع المشاركة في جراثيمك، اغسل يديك بإنتظام أو استعمل هلام مطهرا أساسه كحول ولا تستعمل أغراض زملائك.

المصدر/http://www.klmty.net/2012/01/blog-post_7815.html



مرحبا بحضرتك اخى الفاضل

و لا تحرمنا من مشاركاتك المفيدة

nosa_aic
07 - 01 - 2012, 09:05
وجبة الإفطار تحميك من السكتات القلبية والجلطات


اكدت البحوث الحديثة التى اجرتها جامعة ميموريال فى سانت جونس بكندا مؤخرا ان وجبة الافطار هى من الوجبات على الاطلاق لانها تمنع نشاط التصاق التصافح الدموية ببعض وتراكمها, وبذلك يتم منع تكون الجلطات الدموية التي قد تسبب السكتات القلبية أو تجلط الدم المسبب لها.
ويحدث ذلك لأن السكتات القلبية والجلطات المؤدية إلي الوفاة المفاجئة تكون بين الساعة6 صباحا حتي الظهر, وأعلي نسبة لها تكون بين8 و10 صباحا, وإن ما توصلت إليه هذه الدراسة أن أكثر حالات الموت المفاجئ تكون في الصباح الباكر, لأن صفائح الدم, وهي عنصر الدم الذي يمنع النزيف الحاد إذا ما حصل جرح في الجسم, يزداد تخثرها فتتجلط بسبب تراكم الكوليسترول في بطانة الشريان, وفي ساعات الصباح تكون الصفائح الدموية أكثر نشاطا وتميل إلي تشكيل جلطات الدم, وفي اقل تقدير حتي الأكل الخفيف جدا لوجبة الإفطار في الصباح يمنع تنشيط صفائح الدم التي يمكن أن تسبب تلك السكتات القلبية.
وهذه الدراسة أكدت أن الأكل الخفيف, القليل الدهون لوجبة الإفطار كان حاسما في تعديل نشاط الصفائح الدموية, وفي ضوء هذا البحث تبين أن استهلاك إفطارمنخفض الدهون أو خال من الدهون مثل الزبادي وعصير البرتقال, أو حتي حبة فاكهة طازجة.

nosa_aic
07 - 01 - 2012, 09:09
دراسة : توصي بتجميد اللحوم قبل طهوها للقضاء علي الميكروبات


أكدت دراسة بحثية أجريت بمعهد بحوث صحة الحيوان بطنطا بضرورة تجميد اللحوم في درجة ـ‏12‏ درجة مئوية لمدة بضع ساعات قبل تناولها‏.
حيث إن هذا التجميد يؤدي إلي قتل حويصلات طفيل التوكسوبلازما ثم تسخينها إلي درجه حرارة67 درجة مئوية كافيه لقتل حويصلات الطفيل قبل تناولها, مع طهو اللحوم والأحشاء الداخلية للحيوان( القلب واللسان والكبد) الطازجة جيدا وعدم تذوقها أثناء الطهو,حتي يختفي اللون الأحمر نهائيا وعدم أكل اللحوم والكبدة المشوية النيئة( غير مكتملة النضج) وذلك لتجنب الإصابة بالأمراض.
يذكر أن طفيل التوكسوبلازما الذي يعرف بـ داء القطط, لأنها من أهم أسباب انتقاله للإنسان عن طريق تناولها أطعمة غير مطهوة, وتسبب إجهاض الحوامل أو مواليد مصابة بمشكلات في القرنية والدماغ, كما أن لحوم الأغنام والأبقار قد تكون حاملة لبويضات هذا الطفيل, وطهوها جيدا يقضي عليه.
وأكدت المختصة بالمعهد أنه تم فحص عينات من منتجات اللحوم الجاهزة للأكل من( اللانشون والبسطرمة والسلامي), تم جمعها عشوائيا من محلات البقالة والسوبرماركت في محافظه الغربية, وأظهرت النتائج وجود حويصلات طفيل التوكسوبلازما في العينات التي تم جمعها بنسبه33.3%,66.7% و46.7% في اللانشون والبسطرمة والسلامي, علي التوالي, وترجع هذه النسب العالية إلي عدم تعريض هذه المنتجات إلي درجه حرارة عاليه كافيه لقتل الطفيل في اللحوم المستخدمة أو تعرض هذه المنتجات للتلوث بالطور المعدي للطفيل بعد معالجتها الحرارية أثناء التصنيع أو تلوثها أثناء تقطيعها واعداها للبيع للمستهلك

nosa_aic
07 - 01 - 2012, 12:14
التطعيم تعريفه و اهميته للبالغين و المرأة الحامل



تعتبر التطعيمات أنجع الطرق لمحاربة الإصابة بالأمراض المعدية. والتطعيم، عبارة عن محلول يحتوي على الفيروس المسبب للمرض، لكنه عادة ما يكون ميتا أو ضعيفا بشكل لا يمكنه من التسبب بالمرض بشكل فعلي. هذا الأمر "يستفز" جهاز المناعة في الجسم فيقوم بإنتاج المضادات لهذا الفيروس. وقد نجحت عمليات التطعيم الواسعة بالتقليل بشكل كبير من حالات الإصابة بالأمراض التي أوقعت أعدادا كبيرة من الضحايا في السابق.

من الأمراض التي استطاعت التطعيمات القضاء عليها بشكل تام في العقود الماضية، مرض الجدري ومرض البوليو (شلل الأطفال)، كما استطاعت التطعيمات أن تقلل من نسبة الإصابة بمرض التيتانوس إلى حد كبير جعله مرضا نادر الوجود في العالم. بالإضافة إلى عدد كبير من الأمراض الأخرى.

ورغم أن غالبية التطعيمات تعطى للإنسان في سنوات حياته الأولى، إلا أن نجاحة هذه التطعيمات تبدأ بالأفول مع مرور الوقت، مما يستدعي إعادة تجديدها من خلال إعطاء وجبة إضافية منها. كما أن هنالك عدد من التطعيمات المخصصة لفئات عمرية معينة عادة ما تكون من البالغين.

في القائمة التالية، سنعرض مجمعة من أهم التطعيمات التي تعطى بشكل عام للبالغين فوق الـ18 عام:

• الكزاز/ الدفتيريا/ السعال الديكي: وهو التطعيم "المثالي" الذي يعطى للأولاد، إلا أن جرعة إضافية مقوية ضد السعال الديكي فقط هي أمر ضروري بعد عدة سنوات. ومن ثم يصبح بالإمكان إعادة تلقي هذا التطعيم (التطعيم الكامل) مرة كل عشر سنوات. أما التطعيم [/URL] ضد السعال الديكي فهو مفيد بشكل خاص للنساء في مرحلة ما بعد الولادة، كما أنه موصى به للأشخاص الذين يتعاملون مع الأولاد تحت عمر السنة لمنع نقل المرض لهؤلاء الأطفال
.
• HPV: ينتقل فيروس الـHPV من خلال العملية الجنسية، وهو يسبب الإصابة بسرطان عنق الرحم. ويفضل إعطاء هذا التطعيم (http://www.libyanyouths.com/vb/t114709.html) للشابات والسيدات في عمر 11 إلى 26 عام. وهو يعطى عادة على ثلاث جرعات، بحيث تعطى الجرعة الثانية بعد الجرعة الأولى بشهرين، بينما تعطى الجرعة الثالثة بعد مرور ستة أشهر على إعطاء الأولى.

• الجدري: يفضل إعطاءالتطعيم ضد الجدري للبالغين الذين لم يصابوا بالمرض خلال طفولتهم، ومن الممكن بواسطة فحص دم بسيط اكتشاف إذا ما تلقى الشخص هذا التطعيم (http://www.libyanyouths.com/vb/t114709.html) من قبل أم لا، في حالة عدم التأكد. وعادة ما يعطى هذا التطعيم على جرعتين بفارق زمني قدره أربعة أسابيع على الأقل بين الجرعة والأخرى. ومن الأفضل إعطاؤه للأشخاص القريبين من آخرين معرضين للإصابة بالأمراض الخطيرة مثل السرطان، أو ذوي جهاز مناعة ضعيف. ونظرا لكون هذا التطعيم سائلا يحوي بداخله فيروس المرض بشكل مضعـّف فإنه لا يصح إعطاؤه للأشخاص الذين يعانون من ضعف في جهاز المناعة أو للنساء الحوامل.

• القوباء المنطقية (Zostavax): وهي عادة ما تصيب الكبار في السن فوق الستين عاما والذين أصيبوا في طفولتهم بالجدري. وتعتبر مرضا جلديا يسبب آلاما شديدة لفترة عدة أشهر. وهو ما يميز هذا التطعيم، إذ أنه تطعيم ضد فيروس كان الجسم قد أصيب به من قبل. يعطى هذا التطعيم على جرعة واحدة للأشخاص فوق سن الستين.

• النكاف/ الحصبة الألمانية/ والحصبة: مواليد الأعوام 1957 حتى 1978 (شامل) يحتاجون إلى جرعة تقوية من هذا التطعيم. ولكن نظرا لكونه تطعيما حياً مضعـّفا فإنه لا يجب إعطاؤه لضعيفي المناعة أو للحوامل. ولكنه محبذ أن يعطي للنساء خلال فترة الخصوبة (دون الحمل) خاصة لمن ليس لديهن مضادات الحصبة الألمانية للحيلولة دون الإصابة بالمرض والتأثير على الجنين خلال الحمل.

• الرشح (الأنفلونزا): وهو تطعيم موسمي يوصى بإعطائه لأبناء الخمسين عاما وما فوق. كما يجب إعطاؤه للمرضى المزمنين، الحوامل وكل المحيطين بهؤلاء. أما من لم يتجاوزا الخمسين عاما بعد ولا يعانون من الأمراض المزمنة، فبإمكانهم تلقي تطعيما حيا مضعـّفا من خلال رشه بالأنف.

• الالتهاب الرئوي (Pneumovax): وهو تطعيم ضد أكثر مسببات الالتهاب الرئوي والتهاب السحايا انتشارا لدى البالغين. وهو مخصص لأبناء ما فوق 65 عاما ولمن يعانون من أمراض القلب والرئتين بشكل مزمن، السكري، الكلى، الكبد، وضعف المناعة. يعطى التطعيم على جرعة واحدة ولدى أصحاب جهاز المناعة الضعيف، من المفضل أخذ جرعة ثانية بعد خمسة أعوام.

• اليرقان من النوع A: يفضل إعطاء هذا التطعيم لفئة الأشخاص المعرضين للإصابة، كمرضى الكبد، والمسافرين لبلاد ينتشر فيها الفيروس أو للمثليين جنسيا. وعادة ما يعطى هذا التطعيم بجرعتين بفارق زمني يمتد ما بين 6 إلى 12 شهرا بينهما.

• اليرقان من النوع B: وينصح بإعطائه لمرضى الكبد، الإيدز (HIV)، مرضى الكلى من المحتاجين للدياليزا وللعاملين في الخدمات الصحية. وبما أن الفيروس المسبب لهذا المرض ينتقل خلال العملية الجنسية أيضا، فأنه من المفضل إعطاؤه للمعرضين لمخاطر الأمراض الجنسية أيضا. يعطى هذا التطعيم على ثلاث جرعات، الجرعة الثانية تعطى بعد الأولى بشهر واحد، بينما تعطى الثالثة بعد مرور ستة أشهر من الجرعة الأولى. ومن الممكن تلقي تطعيما واحدا ضد نوعي اليرقان A و B.

• التهاب السحايا: يعطى للطلاب القاطنين في المسكن الطلابية، أو لمن أجروا عمليات استئصال للطحال والمسافرين لمناطق مركز إفريقيا. كما يوصى
المتجهون إلى مكة لأداء فريضة الحج بتلقي هذا التطعيم. ويبقى هذا التطعيم فعالا لمدة خمس سنوات.


من الجدير ذكره بأن التطعيمات المذكورة أعلاه يمكن تلقيها بغالبيتها في مختلف صناديق المرضى في البلاد بعد الحصول على توجيه من الطبيب المعالج.

ماهي اللقاحات التي تتضمنها جداول تطعيم البالغين؟

تغطي جداول التطعيم الخاصة بالبالغين لقاحات عديدة مثل التيتانوس – دفتيريا Tetanus-diphtheria (Td) واللقاح الثلاثي (الحصبة- النكاف- الحصبة الألمانية) MMR ،و جدري الماء (الحماق – العنقز) Varicella، والإنفلونزا. يتطلب تطعيم البالغين عدداً مُعيناً من جرعات اللقاحات يُحدد بالاعتماد على معرفة تاريخ التطعيم الأولي (عدد الجرعات وتاريخ إعطائها) ، باستثناء لقاح الإنفلونزا الذي يجب أن يُعطى سنوياً.

هناك لُقاحات أخرى يُنصح بها للبالغين [URL="http://www.libyanyouths.com/vb/t114709.html"] (http://www.libyanyouths.com/vb/t114709.html) في حالات مُعينة فقط، مثل نوعية المهنة، أو وجود مشاكل صحية معينة، وتتضمن هذه اللقاحات التالي:

لُقاح المكورات الرئوية مُتعدد السكريدات PPV: يُنصح به للبالغين المصابين بمشاكل صحية مُعينة مثل الاضطرابات الرئوية المُزمنة، وأمراض القلب والأوعية، ومرض السكري، وأمراض الكبد المُزمنة، وفقدان الطحال asplenia الوظيفي أو الجراحي، وبعض حالات فقدان المناعة. يُعطى على شكل جرعة واحدة مع تجديد التطعيم بعد مرور 5 سنوات.

لقاح التهاب الكبد الوبائي النوع أي Hepatitis A: يُنصح به للأشخاص المصابين بمشاكل صحية مُعينة كأمراض الكبد المُزمنة، والعاملين في مهن مُعينة مثل موظفي المختبرات، والمسافرين. وُيعطى على جُرعتين بفاصل زمني مقداره 6 أشهر على الأقل. أدرجت الولايات المتحدة الأمريكية حديثاً هذا اللقاح في جدول التطعيم الأولي للأطفال بدءاً من عمر السنة.

لقاح التهاب الكبد الوبائي النوع بي Hepatitis B: يُوصف للبالغين الذين يُعانون من بعض المشاكل الصحية كالمرضى الخاضعين لعملية الغسيل الكلوي hemodialysis، وللعاملين في المجال الصحي، أو الأشخاص السليمين المعرضين للعدوى بسبب نوعية عملهم أو حياتهم. يعطى بنفس الطريقة التي تُستعمل للأطفال، وذلك على ثلاث جرعات، بفاصل زمني مدته شهر واحد بين الجرعة الأولى والثانية، أما الجرعة الثالثة فتُعطى بعد 6 أشهر من تاريخ الجرعة الثانية.

لقاح المكورات السحائية Meningococcal: يوجد نوعين من هذا اللقاح الأول لقاح المكورات السحائية مُتعدد السكريدات polysaccharide ويُدعى اختصاراً ( أم بي أس في4 MPSV4)، والثاني لقاح المكورات السحائية المُتِّحد ويُدعى أم سي في MCV وهو الأحدث. ويُنصح بلقاح المكورات السحائية المُتِّحد في حالات صحية مُعينة مثل فقدان الطحال asplenia الوظيفي أو الجراحي، وللمسافرين إلى المناطق الموبوءة، أو في حالة خطر العدوى بالمرض. يوصف لقاح أم سي في MCV للفئة العمرية بين 11 – 55 سنة، بينما يوصف لقاح أم بي أس في4 MPSV4 للأطفال من عمر2- 10 سنوات والبالغين الذين تجاوزوا 55 سنة من العمر. يمكن أن يُستعمل لقاح أم بي أس في4 MPSV4 بدلاً من لقاح أم سي في MCV في حال عدم توفره.

ماهي اللقاحات الواجب إعطاؤها للمسافرين؟

يتعلق تطعيم المسافرين بعوامل متعددة مثل البلد المقصود السفر إليه، ومدة الإقامة، والحالة الصحية للمسافر، وعمره، وخطورة وجوده في المناطق الريفية أثناء السفر. لا توجد هناك جداول معيارية للتطعيم قبل السفر حيث تُكيف وفقاً للظروف الخاصة بالمسافر وبلد الوجهة. ويمكن الحصول على المعلومات الخاصة بالتطعيم قبل السفر من مراكز منظمة الصحة العالمية. تتضمن اللقاحات الخاصة بالمسافرين التالي:

لقاح المكورات السحائية: ذُكر في السؤال السابق.

لقاح التهاب الكبد الوبائي النوع أي : ذُكر في السؤال السابق.

لُقاح الحُمَّى الصفراء Yellow fever: يُستعمل للوقاية من فيروس الحُمَّى الصفراء الذي ينتقل بواسطة لدغ البعوض الذي يوجد في عدة مناطق من أفريقيا وأمريكا الجنوبية، ولا ينتقل هذا المرض من شخص إلى آخر. يُعطى اللقاح على جرعة واحدة للأطفال < 9أشهر وللبالغين. ويجب أن لا يُعطى للأطفال الأصغر من 4 أشهر من العمر. تُعطى الجرعات عادة في العيادات المُتخصصة. يوصى بإعادة التطعيم بعد 10 سنوات إذا لزم الأمر.

لُقاح التهاب الدماغ الياباني Japanese encephalitis: شبيه بمرض الحُمَّى الصفراء يُسببه فيروس ينتقل بواسطة لدغ البعوض الذي يوجد في بعض المناطق الريفية من آسيا، ولا ينتقل هذا المرض من شخص إلى آخر. يُنصح بهذا اللقاح للأشخاص الذين ستطول مدة إقامتهم لأكثر من 4 أسابيع في المناطق الموبوءة، ويُعطى عل شكل ثلاث حقن متتالية في اليوم البدء، ثم في اليوم 7،ثم في اليوم 30.

لُقاح الكوليرا Cholera vaccine: يُستعمل للحماية من مرض الكوليرا الذي تُسببه جراثيم تنتقل بالعدوى عبر الغذاء والماء الملوثين، حيث تُهاجم الجهاز الهضمي مُسببةً إسهالاً شديداً. لا ينصح مركز مراقبة الأمراض Center of Disease Control CDCبهذا اللقاح وهو غير متوفر في الولايات المُتحدة الأمريكية، لأن المرض لا يُشكل مشكلة هناك كما أنه يمكن السيطرة عليه وعلاجه من خلال اتباع المقاييس الصحية الصحيحة. ويتوفر لقاح الكوليرا الذي يؤخذ عن طريق الفم في بعض البلدان وبنطاق محدود.

لُقاح التيفوئيد Typhoid vaccine: يُستعمل للحماية من الحُمّى التيفية، وهي مرض خطير تسببه جراثيم السالمونيلا تايفي Salmonella Typhi . يتوفر اللقاح على شكلين، الأول عبارة عن جراثيم مُضعّفة ويؤخذ عن طريق الفم، والثاني عبارة عن جراثيم مُعطلة ويؤخذ على شكل حقن. يُنصح المسافرين إلى المناطق الموبؤة بأخذ اللقاح.

يجب عدم استعمال اللقاح المتوفر على شكل حقن للأطفال الأصغر من سنتين من العمر. يُعطى على شكل حقنة واحدة قيل السفر بمدة أسبوعين مع جرعة داعمة بعد سنتين إذا احتاج الأمر.

يُعطى اللقاح الفموي على 4 جرعات بفاصل يومين بين الجرعة والأخرى بحيث تُعطى الجرعة الأخيرة قبل السفر بأسبوع. يجب أن لا يُعطى للأطفال الأصغر من 6 سنوات من العمر. يمكن إعطاء جرعة داعمة بعد 5 سنوات إذا لزم الأمر.



ماذا عن التطعيم أثناء فترة الحمل؟

يُمكن إعطاء بعض اللقاحات أثناء فترة الحمل إذا لزم الأمر، مع الموازنة بين خطورة اللقاح على الجنين وفائدة الأم منه. تُعتبر فترة الثلاثة شهور الثانية من الحمل بشكل عام هي الأفضل لإجراء عملية التطعيم. لا توصف كل اللقاحات المُكونة من الفيروسات الحيّة المُضَّعفة مثل اللقاح الثلاثي، ولقاح جدري الماء، ولقاح الإنفلونزا الأنفي، أثناء فترة الحمل.

يجب وصف بعض اللقاحات للحوامل إذا لزم الأمر مثل لقاح الإنفلونزا الذي يعطى عن طريق الحقن والتمهاب الكبد الوبائي من النوع ب، و التيتانوس – دفتيريا، و المكورات السحائية مُتعدد السكريدات.



التطعيم أو اللقاح هو عبارة عن جرثومة بكتيري ميت أو حي خامل نظرا لإعادة تركيبية جينيا أو فيروس تم إخضاعه لعوامل فيزيائية أو كيماوية بحيث يصبح ضعيفا أو ميتا ولا يستطيع إحداث المرض.

والهدف هو تحفيز جسم الإنسان أو الطفل والتفاعل مع الجهاز المناعي على إنتاج المواد المناعية اللازمة للتعرف على هذا العامل الممرض في المستقبل بحيث لا يصاب الطفل بهذا المرض في المستقبل أو يقلل من درجة خطورة المرض عند تعرضه لنوع المرض الذي أخذ لقاحا ضده لأن هذه المواد المناعية تتعرف في مرحلة ما بعد اللقاح على العامل الممرض بشكل سريع وتحارب المرض و تسمى هذه المواد المناعية (الأجسام المضادة).

((الهدف من التطعيمات))



بفضل الله عز وجل كان لتطعيمات فائدة كبيرة في الحد من خطورة عدد من الأمراض الشائعة والتي كانت تسبب نسبة أمراض معدية ومرضية عالية وكانت تسبب نسبة وفيات وإعاقات عالية.

و قد اختفت الكثير من الأمراض المشمولة بالتلقيح من دول العالم فمرض الجدري مثلا اختفى من العالم نهائيا بعد حملات التلقيح العالمية و كذلك مرض شلل الأطفال في طريقة للاختفاء وكذلك مرض الحصبة

وعلى الرغم من بعض المضار الجانبية للتطعيمات فأن فوائده تفوق بكثير ما يسببه اللقاح من تأثيرات جانبية نادرة الحدوث


((جدول التلقيح))




أولا : عند الولادة

نوع التطعيم / رقم الجرعة / المرض

الطعم الواقي من الدرن b.c.g / جرعة عند الولادة / الدرن

طعم شلل الأطفالo.p.v / الجرعة الصفرية / السنجابي (شلل الأطفال)

طعم الألتهاب الكبدي البائي / جرعة عند الولادة / الألتهاب الكبدي البائي
hep.b.v



تانيا: عند عمر الشهرين / وأربعة أشهر / وستة أشهر


1_الطعم الخماسي penta.v.ويشمل:

طعم الألتهاب الكبدي البائيhep.b.v / الألتهاب الكبدي البائي

الطعم الثلاثي البكتيريd.p.t / الخناق/الشاهوق/الكزاز

طعم المستديمة النزلية(ب) hib.v / حمية الأنفلونزا



2_طعم شلل الأطفالo.p.v / السنجابي(شلل الأطفال)




نفس التطعيمات السابقة مقسمة الي جرعات :


1_ في عمر الشهرين / الجرعة الأولي


2_ في عمر الأربع أشهر / الجرعة التانية


3_ في عمر ستة أشهر / الجرعة الثالثة




ثالثا : في عمر 12 شهر (سنة)

الطعم المركب الفيروسيm.m.r / الجرعة الأساسية / الحصبة/النكاف/الحميراء




رابعا : في عمر 18 شهر ( سنة ونصف)

الطعم الثلاثي البكثيريd.p.t / جرعة منشطة / الخناق/الشاهوق/الكزاز

الطعم المركب الفيروسيm.m.r / اعادة تطعيم / الحصبة/النكاف/الحميراء

طعم شلل الأطفالo.p.v / جرعة منشطة / السنجابي(شلل الأطفال)




خامسا : في عمر 6سنوات أو عند دخول المدرسة

الطعم الثنائي البكثيريd.t / جرعة منشطة / الخناق/ الكزاز

طعم شلل الأطفالo.p.v / جرعة منشطة / السنجابي(شلل الأطفال)

الطعم السحائي الرباعيa.c.y.w135 / التهاب السحايا




سادسا : في عمر 12 السنة

طعم شلل الأطفالo.p.v / جرعة منشطة / السنجابي(شلل الأطفال)




سابعا : في عمر 15 السنة

طعم الكزاز والخناق(جرعة كبار) t.d / جرعة منشطة / الكزاز/الخناق




التطعيم حق للطفل وواجب علي ولي الأمر

التطعيم يحمي الطفل من الأمراض المسببة للوفاة أو الأعاقة




((التطعيم الثلاثي))

ماذا سيحدث إذا لم تعط طفلك اللقاح الثلاثي ؟



ما سيحدث إن طفلك سيكون عرضة للإصابة بأحد هذه الأمراض أكثر بكثير من الأطفال الذين تلقوا هذا اللقاح و هذه الأمراض هي من الأمراض الخطيرة و خطورتها تكمن في الحقائق التالية:

طفل واحد يموت من كل 10 أطفال يصابون بالكزاز

طفل واحد يموت من كل 15 طفل يصابون بالدفتريا

طفل واحد يموت من كل 1000 طفل يصابون بالسعال الديكي

ثلاثة أطفال من كل 4 أطفال يصابون بالسعال الديكي يحتاجون لدخول المستشفى.

**التأثيرات الجانبية لتطعيمات خصوصا التطعيم الثلاثي:

قد يصبح الطفل خلال اليوم الأول التالي للتلقيح اقل حيوية مما سبق و قد ترتفع درجة حرارته وقد يصبح مكان اللقاح محمرا ومؤلما و هذه هي التأثيرات الجانبية العادية للقاح و التي تستمر حوالي اليومين و يكفي لتخفيفها إعطاء الطفل الباراسيتامول بجرعة تناسب وزن الطفل ويعطى السيتامول كل أربعة أو كل ستة ساعات و يجب عدم إعطاء الطفل الأسبرين


**مشاكل يجب استشارة الطبيب بما حدث بعد التطعيم؟

يجب على الأهل إخبار طبيب الأطفال في حال ملاحظتهم لأي من الأعراض التالية على الطفل بعد تلقيه للقاح الثلاثي و التي تعتبر تأثيرات جانبية قليلة الحدوث

بكاء مستمر لا يهدأ لأكثر من 3 ساعات.

بكاء عالي بشكل غير معتاد مع علامات ارتباك شديدة أدى الطفل.

ميل شديد للنوم مع صعوبة في إيقاظ الطفل.

إذا بدت على الطفل علامات الإعياء أو الشحوب بعد اللقاح.

وصول درجة حرارة الطفل إلى 40 درجة مئوية أو أكثر

علما إن نسبة حدوث أي من هذه التأثيرات الجانبية هي اقل من 1%



**الحالات التي يمكن منع التطعيم الثلاثي لطفل؟

يجب تأجيل إعطاء اللقاح الثلاثي أو عدم إعطائه نهائيا في الحالات التالية:

حدوث حساسية شديدة للقاح أو حدوث التهاب في الدماغ عند الطفل

إصابة الطفل بتشنجات حادة بعد تلقي العلاج.

أي مما سبق ذكره من مشاكل بعد التطعيم.



**لقاح شلل الأطفال Polio Vaccine **

شلل الأطفال هو مرض يصيب الحبل الشوكي مما يؤدي إلى تعطل العضلات التي يدعمها هذا العصب, وأحيانا يكون المرض خفيفا أشبه بنزلة البرد.

الإصابة بالمرض العصبي لشلل الأطفال يؤدي إلى الإعاقة الدائمة لاسمح الله ولكن ولله الحمد سجلت حالات قليلة لهذا المرض الذي في طريقه إلى الاختفاء.



أنواع لقاح شلل الأطفال

1) نوع يؤخذ عن طريق العضل وهو عبارة عن جرثومة ميتة

تعطى عند الأطفال الصغار وعند الأطفال ذوي المناعة الضعيفة

2) النوع الذي يؤخذ عن طريق الفم

وهو عبارة عن جرثومة معدلة جينيا

من مميزاتها سهولة إعطائها لطفل عن طريق الفم وتحفيزها للمناعة بشكل أكبر

من عيوبها أنها غير فعالة في حالات النزلة المعوية وعند أعطاء الطفل من حليب الأم قبل أو بعد ساعة من إعطاء اللقاح

عدم إعطائها للأطفال الذين يعانون من ضعف المناعة


لقاح الحصبة والحصبة الألمانية و النكاف MMR

هذه الأحرف الثلاثة هي الأحرف الأولى من أسماء اللقاحات باللغة الإنكليزية و يعطى هذا اللقاح بجرعة وحيدة بعمر السنة أو أكثر قليلا على الرغم من إن هذه الأمراض نادرا ماتسبب أمراض خطيرة.

طفح جلدي خفيف

تضخم خفيف في العقد اللمفاوية عند أعلى الرقبة و خلف العنق

حرارة خفيفة

ميل للنوم

يجب الانتباه وأخبار الطبيب إذا كان الطفل لديه حساسية تجاه البيض لأن الطفل قد تحدث له حساسية شديدة ومشاكل عصبية إذا أعطي هذا التطعيم.

من الحالات الأخرى التي يجب إلا يعطى فيها الطفل هذا اللقاح هي وجود نقص في مناعة الطفل أو إذا كان يتلقى أي دواء مضعف للمناعة

لقاح جدري الماء ( العنقز)

و هو من اللقاحات الجديدة التي لا تعطى في جميع دول العالم و هو آخذ بالإنتشار تدريجيا و هو يحمي من مرض جدري الماء اوالعنقز و للمرض تسميات عديدة حسب البلدان و يعطى اللقاح لجميع الأطفال الأصحاء بعمر السنة أو أكثر قليلا و لا يعطى لمن أصيب سابقا بالمرض و بالنسبة للأطفال الذين لم يلقحوا سابقا وأعمارهم دون 13 سنة فيجب أن يعطوا جرعة واحدة من هذا اللقاح و المراهقين والكبار الذين لم يصابوا بالمرض و لم يتلقوا أي جرعة من اللقاح يجب أن يعطوا جرعتين منه بفاصل شهر.

و المرض ليس خطيرا عادة و لكن بعض الأطفال قد يهددهم المرض و هؤلاء الأطفال هم الأطفال دون السنة من العمر و المصابين بنقص المناعة و المصابين بالاكزيما و المصابين بالربو.


لقاح المستدمية النزلية من النوع ب (Hemophilus influenza B)

هذه الجرثومة هي من الجراثيم الخطيرة على الأطفال دون ال 5 سنوات من العمر و هي تسبب الكثير من الأمراض أهمها التهاب لسان المزمار و التهاب السحايا و يجب البدء بإعطاء هذا اللقاح من عمر الشهرين و هو يعطى الآن مع اللقاح الثلاثي


اللقاحات الخاصة

لقاح الرئويات Pneumococcal vaccine

يعطى هذا اللقاح للأطفال ممن هم فوق السنتين في الحالات التالية:
عند استئصال الطحال

مرضى فقر الدم المنجلي

قد يفيد في حالات التهاب الأذن الوسطى المتكررة

في حالات التهاب السحايا المتكرر.

لمن لديهم ضعف مناعي

لقاح السحائيات Meningococcal vaccine

مرضى فقر الدم المنجلي

بعد استئصال الطحال

في حالات الرحلات الخارجية وفي الحج


لقاح الأنفلونزا Influenza vaccine

يعطى في الحالات التالية :
مرضى الربو

الأمراض الرئوية المزمنة

مرضى القلب

مرضى الإيدز

قبل السفر إلى منطقة موبوءة

مرضى الدم والسرطان

لقاح التهاب الكبد أ Hepatitis A vaccine

يعطى في حالات انتشار المرض و للمسافرين إلى المناطق الموبوءة

اميره اميره
07 - 01 - 2012, 14:13
انيميا الفول


يعتبر مرض أنيميا الفول مرضاً شائعاً ينتشر في كل أنحاء العالم حيث تشير التقديرات إلى إصابة حوالي 200مليون شخص حول العالم.
ينجم المرض عن عوز وراثي في انزيم G6PD وهذا ما يجعل الكريات الحمراء قابلة للتكسر والانحلال عند تعرضها لبعض المواد المؤكسدة ومنها الفول الاخضر لذلك يدعى المرض احياناً بأنيميا الفول أو الفوال favism (وبالتحديد الحالات الشديدة من المرض).

ماهو أنزيم G6PD؟
- يدعى هذا الانزيم غلوكوز - 6- فوسفات دي هيدروجيناز وهو انزيم ضروري لعمل الكريات الحمراء وسلامتها حيث يساهم هذا الانزيم في سلسلة من التفاعلات التي تتم في الكرية الحمراء والتي تؤدي في النهاية لإنتاج مادة الغلوثاثيون المرجع reduced التي تحمي الكريات الحمراء من التكسر عند تعرضها للمواد المؤكسدة وتمنع تخربها. لذلك يؤدي نقص انزيم G6PD إلى نقص إنتاج الغلوتاثيون المرجع وبالتالي فقدان الحماية عن الكريات الحمراء التي تصبح معرضة للتكسر والانحلال عند تعرضها لمواد مؤكسدة مثل الفول وبعض الادوية.

أين ينتشر؟
- ينتشر المرض في كل أنحاء العالم لكنه يتركز في اليونان وإيطاليا ودول حوض البحر المتوسط والشرق الأوسط.

انتقاله
ان مرض نقص انزيم G6PD مرض وراثي متنح مرتبط بالصبغي الجنسي X حيث يشرف على تركيب هذا الانزيم جين (مورثة) متوضع على الصبغي الجنسي X ويؤدي حدوث خلل في هذا الجين (الطفرة) إلى نقص تركيب هذا الانزيم وقد تم تحديد وجود أكثر من 400طفرة قد تصيب جين الانزيم ويفسر اختلاف الطفرات وكثرتها اختلاف الاعراض وشدتها.
ان مرض انيميا الفول مرض متنح اي لا يظهر المرض إلا اذا اصيبت كل نسخ الصبغي الجنسي X.
توجد عند المرأة نسختان من الصبغي الجنسي X لذلك تقوم إحدى النسختين بالتعويض في حال إصابة النسخة الاخرى وهذا يفسر قلة إصابة الاناث بالمرض، اما عند الرجل فلا توجد الا نسخة واحدة من الصبغي الجنسي X لذلك تؤدي إصابة هذه النسخة إلى الإصابة بالمرض وهذا يفسر كثرة إصابة الذكور.
ينقل الذكور المصابون المرض إلى بناتهم ولا ينقلونه ابداً إلى اولادهم الذكور.
اما الام الحاملة للمرض فتنقله إلى أبناءها الذكور والإناث، ولا تصاب المرأة عادة بهذا المرض إلا نادراً.

الاعراض
يؤدي تناول الفول او بعض انواع الادوية عند الاشخاص المصابين بنقص انزيم G6PD إلى حدوث تكسر الكريات الحمراء (الانحلال الدموي) وبالتالي يحدث فقر الدم الذي قد يكون شديداً ومهدداً للحياة.
واهم الاعراض السريرية هي الشحوب والصداع والدوار والغثيان والاقياء والم الظهر والوهن والالم البطني والحمى الخفيفة ومن الاعراض الهامة اليرقان (الصفار) وهو تلون الجلد والاغشية المخاطية (ملتحمة العين) باللون الاصفر الناجم عن زيادة إنتاج مادة البيلروبين نتيجة للتخرب الشديد للكريات الحمراء، وهذه المادة قد تكون ضارة جداً عند الاطفال حديثي الولادة حيث يمكن لها ان تترسب داخل الدماغ محدثة مشاكل خطيرة.

الاسباب
1- تناول بعض انواع الاطعمة وعلى رأسها البقوليات بأنواعها خاصة الفول الاخضر والعدس والفاصوليا والبازلاء، ويمكن ايضاً لغبار طلع الفول ان يؤدي إلى نفس النتيجة.
2- بعض أنواع الادوية (انظر الجدول التالي).
3- التعرض للالتهابات الفيروسية والجرثومية (مثل التهاب الكبد).
4- قد يحدث تكسر الكريات تلقائياً دون سبب واضح في بعض الحالات.

جدول يبين أهم الادوية التي قد تؤدي إلى تكسر الكريات الحمراء عند مرضى عوزG6PD*
* المضادات الحيوية
- السلفوناميدات
- الكلورامفينكول
- النتروفورانتوئين
- TMP-SMX
* مضادات الملاريا
- الكلوروكين، الكيناكرين.
* فيتامين C.
* المسكنات (مثل الاسبرين)
* مضادات الاقياء (مشتقات الفينوتيازين)
* أدوية السل (مثل الإيزونيازيد)
* ادوية القلب (مثل الهيدرالازين)


التشخيص
يتم التشخيص اعتماداً على القصة المرضية وفحص المريض إضافة إلى إجراء بعض الفحوص المخبرية حيث يكون هيموغلوبين الدم منخفضاً والبيلروبين مرتفعاً وتبدو الكريات الحمراء تحت المجهر متكسرة ومتجزأة. أما فحص البول فيظهر وجود البيلة الخضابية. ويتم إثبات التشخيص بمعايرة فعالية انزيم G6PD في الكريات الحمراء حيث تكون هذه الفعالية منخفضة.

المعالجة
ذا كان تكسر الكريات الحمراء شديداً ادى ذلك لحدوث فقر دم حاد وشديد عند المريض وهذه الحالة إسعافية تستلزم نقل الدم الاسعافي تحت إشراف طبي مع مراقبة المريض عن كثب وقد نضطر لنقل الدم اكثر من مرة، ويتم مراقبة وظائف الكلية خوفاً من حدوث الفشل الكلوي الحاد الناجم عن انحلال الدم الشديد.

الوقاية
ان الوقاية هي اساس تدبير هذا المرض الوراثي، فطالما كان المريض بعيداً عن الاطعمة والادوية المسببة لتكسر الدم كانت أموره سوية تماماً لذلك فإن تثقيف المريض وأهله (إن كان المريض صغيراً) من الامور الاساسية حيث لابد من التأكيد على طبيعة المرض الوراثية وانه ليس مرضاً معدياً، كما يتم تزويد المريض وأهله بقائمة الاطعمة والادوية والمواد الاخرى التي يجب ان يتجنبها لمنع حدوث تكسر الدم، ومن الامور الهامة ايضاً ضرورة تذكير الطبيب دوماً بوجود نقص انزيم G6PD عند المريض حتى يراعي ذلك عند وصف الدواء.

كلمة أخيرة:
مرض نقص انزيم G6PDمرض شائع في منطقتنا العربية وهو مرض وراثي ينقل عن طريق الوراثة المرتبطة بالصبغي الجنسي X، يؤدي المرض لحدوث الخلال دموي عند تناول بعض انواع الاطعمة (الفول، الفاصوليا) والادوية، ويتظاهر ذلك بالشحوب واليرقان والبيلة الدموية.
يجب تثقيف المريض واهله حول طبيعة هذا المرض ولابد من الابتعاد عن كل الاطعمة والادوية والمواد الأخرى التي قد تسبب تكسر الدم لان ذلك هو السبيل الوحيد للوقاية من هذا المرض.

اميره اميره
07 - 01 - 2012, 14:17
وصفات لمقاومة خشونة القدمين فى الشتاء

http://www.hafedatkhadija.com/vb/images/smilies/b1c89fb4c5.gif




تتعرض الأقدام للخشونة بسبب التغيرات المناخية وبرودة الجو فى الشتاء والأعمال المنزلية أو الاستخدام المتكرر للأحذية ، وكذلك تلك المفتوحة التي تجعل القدم عرضة لتأثيرات الخارجية ويقدم الخبراء بعض الوصفات التى تساعدك على الحصول على قدمين ناعمتين ومنها:



- يمكنك الاستعانة بحجر الحفاف في حك جلد القدمين من الجوانب ومن أسفل للتخلص من الجلد الزائد الخشن ويمكن ترطيب الحجر بقليل من الماء والصابون أو يمكنك وضع قدميك في ماء دافئ وملح، ثم توضع في إناء آخر به ماء دافئ وصابون ومن ثم القيام بدعكهما بالحجر.


- للحصول على مفعول ملين للبشرة، يمكن إضافة بعض النوعيات من الأعشاب لماء الحمام والتي تساعد على ذلك، وهذه مثل:
* النعناع ويضاف منه ملعقة كبيرة من الأوراق المجففة للماء المغلي ثم يستخدم الماء دافئاً.
* كما يمكنك إضافة مقدار ملعقة كبيرة من خل التفاح.
* فنجان من منقوع البابونج (يحضر المنقوع بإضافة ملعقتين كبيرتين من زهرة البابونج إلى فنجان ماء مغلي، ويترك العشب لينقع لمدة 15 دقيقة)، ثم نضيف له 6 نقاط من زيت اللافندر مع 6 نقاط من زيت الجرانيوم.
- يمكنك استخدام دهان مرطب بعد عمل حمامات الماء وذلك بدهان الجلد بفيتامين (هـ) وذلك بتفريغ الزيت الموجود داخل كبسولة الفيتامين واستعماله في تدليك الجلد وذلك قبل وضع المرطب.
- اخلطي كمية مناسبة من الفازلين+ جليسرين+ عصير ليمون وضعيها في علبة واحرصي على دهن أقدامك كل يوم قبل الخلود إلى النوم
http://www.hafedatkhadija.com/vb/images/smilies/b1c89fb4c5.gif

اميره اميره
07 - 01 - 2012, 14:20
http://www.7irtny.com/vb/7irtny.com/7irtny1288924341_588.gif


هل انتي سريعة النسيان؟؟؟؟

http://www.hafedatkhadija.com/vb/images/smilies/love242.gifاذا كنتي سريعة النسيان..http://www.hafedatkhadija.com/vb/images/smilies/love242.gif

فإليك خمس طرق يوصي بها اخصائي التغذيه لمعاجة هذه المشكله:

-إحرصي على تناول 21حبة زبيب وخاصة اليماني.


-امضغي اللبان الذكر.


-تناولي اللوز يوميا.


-شرب النعناع يوميا..خصوصا دوش المدينه.


-إشربي مدة اربعة اشهر قبل الإفطارملعقه صغيره عسل اصلي مذاب في كوب ماء...




http://www.hafedatkhadija.com/vb/images/smilies/love242.gifhttp://www.7irtny.com/vb/7irtny.com/7irtny1288924347_137.gifhttp://www.hafedatkhadija.com/vb/images/smilies/love242.gif

nosa_aic
07 - 01 - 2012, 17:07
الاخت العزيزة اميرة

مرحبا بك و بمشاركات

:cgiving:

nosa_aic
07 - 01 - 2012, 17:17
التوت مفيد للقلب و الجلد و الشعر و به فوائد كثيرة



للتوت فوائد صحية عديدة ، فالصبغة الحمراء فيها تحمي القلب. وهناك معادن مهمة في التوت مثل الزنك الضروري لصحة الجلد و الشعر وللمناعة والخصوبة، والمغنيسيوم الضروري لنقل الإشارات العصبية.

وهو ايضا غني بالحديد الذي يعتبر أحد مكونات الهيموجلوبين في الدم الذي ينقل الأوكسجين للمساعدة في إطلاق الطاقة. وللتوت خصائص مقوية ومجددة للنشاط لما تحويه من الأملاح والفيتامينات، وهو مفيد لمرضى التهاب المفاصل. كما أنه سهل الهضم, ويوافق المعدة الضعيفة ويساعد على الهضم. كما أن عصير التوت يفيد بعض السيدات في تخفيف آلام الحيض، ويساعد حامض الفوليك الموجود فيها على انقسام الخلايا ويحافظ على النمو الطبيعي للجنين في حالة الحمل.

nosa_aic
07 - 01 - 2012, 17:28
الضحك و دوره فى التخلص من المشاعر السلبية


الضحك مفيد للصحة فهو لا يضفي السعادة على حياتنا فحسب بل على جسمنا ومعنوياتنا دقيقة واحدة من الضحك تعادل 45 دقيقة من الاسترخاء إذا لماذا نحرم أنفسنا منها؟؟

يوضح الأطباء والمعالجون النفسيون أننا لا نضحك لأننا سعداء بل نحن نسعد لأننا نضحك فالضحك يساعدنا على نسيان مشاكلنا ولو قليلا منها أو على وضعها جانبا أو تأجيلها ويعمل الضحك مثل الترياق أو عامل مضاد للإجهاد والمشاعر السلبية [/URL] كالغضب والخوف والإحباط والعدائية والخجل والاكتئاب وهو يشكل العلاج المثالي لكي نشعر أفضل حالا كما أننا يمكننا الحصول عليه في أي وقت وليس له أي آثار جانبية أو مؤذية.
منافع الضحك كثيرة على جسمنا، حسب مجلة الغذاء الصحي، فلديه التأثير نفسه للمشي السريع، إذ يعزز استرخاء العضلات ومن يجد صعوبة في الضحك (http://www.libyanyouths.com/vb/t2092.html) فلقد أنشئت عدة نواد للضحك تكون رابطا بين الأعضاء المشاركين فالجميع يأتون ليضحكوا معا وللابتعاد عن القلق والهموم والإجهاد والمشاكل.

هذا وأثبتت الدراسات الحديثة أن للضحك فوائد طبية مرافقة لما نشعر به من الراحة النفسية، ويقول الأطباء إن الضحك مرات عديدة في اليوم ينعش القلب ويبقيه بصحة جيدة ويقلل من الإصابة بتجلط الدم.

وينصح الأطباء بالإكثار من الضحك الذي يؤدي إلى الشعور بالحرية والراحة النفسية والانطلاق ومحاولةالضحك بصوت أعلى أي القهقهة بينك وبين نفسك عند عمل أي شيء مضحك أو إذا ارتكبت أي خطأ مضحك.‏

واليك أهم هذه الفوائد..

- الضحك يؤدي إلى تحسن عمل نظام المناعة في الجسم وذلك عن طريق زيادة إنتاج خلايا تسمى (T-cells) و التي هي مسؤولة عن مقاومة العدوى و تحفز الجسم على الشفاء السريع من الأمراض.

- إن الضحك يقوم بتخفيض نسبة الكوليسترول في جسمك، وهو هرمون يسبب الضغط و يؤدي إلى خفض قدرة جهاز المناعة في الجسم.

- إن عملية الضحك تحفز الجسم على إنتاج (endorphins) وهو مسكن الألم الطبيعي الذي ينتجه الجسم، الأمر الذي يساعد في التخفيف من حدة الألم وكذلك يساعد في تحسين المزاج بشكل عام.

- تبين أيضا أن بعد الانتهاء من الضحك [URL="http://www.libyanyouths.com/vb/t2092.html"] (http://www.libyanyouths.com/vb/t2092.html) فإن ضغط الدم وسرعة نبضات القلب تنخفض بشكل ملموس، كذلك فأن الضحك يساعد في التخفيف من توتر العضلات.


- الضحك يخفف من وطأة أعباء الحياة على كاهلك ويؤدي إلى التخفيف من نزعتك نحو الكمال و يزيد من قدرتك على التكيف مع المتغيرات المحيطة بك.

ومن جانب آخر، توصلت دراسة أميركية إلى أن الضحك أفضل دواء وأن مجرد التطلع إلى حدث إيجابي مضحك أو مشاهدة تجربة مضحكة‏،‏ قد يعزز جهاز المناعة ويقلل التوتر‏.‏

وأثبتت اختبارات أجريت أنه بمجرد توقع حدث سعيد بهيج أو مضحك‏،‏ قد يرفع مستويات الأندروفين والهرمونات الأخرى التي تحدث شعورا بالمتعة والاسترخاء وتخفض إفراز الهرمونات المصاحبة للتوتر‏.‏

هذا وقد بدأ الأطباء مؤخرا بإدخال الضحك والابتسامات على لائحة وصفاتهم الطبية التي لا تصرف من الصيدليات بل بتنظيم روتين حياة المريض مع الابتعاد عن الضغوطات النفسية والجسدية بالقدر المستطاع بالإضافة إلى الترفيه عن النفس.

ويرى الأطباء أيضا أن المرح داخل المراكز العلاجية مفيد للأطباء والممرضين أيضا، لأنه يساعدهم على التخلص من الضغط العصبي الناتج عن طبيعة عملهم الشاق.

ويعتقد بعض الخبراء أن لإضحاك المرضى وإدخال البهجة في نفوسهم أثرا مباشرا على أجهزة المناعة الطبيعية في أجسادهم. ويؤكد بعضهم أن فائدة الضحك لا تقتصر على تحسين الحالة النفسية للمرضى، بل تتجاوزها بشحذها قدرة الجسد على مقاومة الأمراض.

وإن الكثير من الأبحاث قد أجريت لاكتشاف التأثير الإيجابي للمرح على الحالة البدنية، حيث أظهرت تلك الأبحاث أن من يتعرضون للأزمات القلبية يمكنهم تفادي الإصابة بأزمة ثانية والتعرض لارتفاع ضغط الدم، ويمكنهم الاستغناء عن تعاطي كميات كبيرة من الأدوية إذا ضحكوا لمدة نصف ساعة كل يوم.

وقد ثبت علميا أن الضحك يؤدي لخفض معدلات إفراز المواد الكيميائية المرتبطة بحالات التوتر العصبي، ويقوي أجهزة المناعة وقدرة الجسد على تحمل الآلام.

وأكد الأطباء النفسيون أن المرح يعد وسيلة فعالة للتخلص من الضغط العصبي، وسلاحا لمواجهة وتجاوز ما يتعرض له الإنسان من إهانة أو مواقف صعبة ومحرجة، ويساعد على تجاوز كل أنواع الألم والمعاناة

nosa_aic
08 - 01 - 2012, 05:52
لا تتجاهل أي من الأعراض العشرة التالية:

تَعْرفُ بأنّ الإشاراتَ والأعراضَ الواضحةَ من- ألم صدرِ، ألم بطني أَو نزف غير مفسر - سببَ جيدَ عموماً للإسعافات الطبيةِ الفوريةِ.ولكن
يجب عليك ألا تهمل أي من الأعراض التالية عندما تتعرض لها حيث قد يكون اهتمامك بها منقذ لحياتك حين تستشير طبيبك في وقت مبكر.
لا تُتجاهل أي من الإشاراتَ الـ10 التاليةَ فهي دائما قَدْ تُشيرُ إلى مشكلةِ صحيةً مهددة للحياة:

1. نقص الوزن الغير مفسر.

عندما تجد إن وزنك ينقص دون خضوعك لبرنامج غذائي معين لإنقاص وزنك.حيث ينقص حوالي-
"5 بالمائة وزنِكَ خلال شهر واحد أو
"10 بالمائة من وزنِكَ خلال 6 إلى 12 شهرِ
فهذا الهبوط الغير مفسر في الوزنِ يُمكنُ أَنْ يخفي ورائه عدد مِنْ الأمراض، مثل فرط نشاط في الغدّة الدرقّيةِ، الكآبة، أمراض الكبدِ، السرطانات، أَو اِضطرابات غير سرطانية أخرى، أَو أدواء أسواءِ الامتصاص.

2. الحرارة المستمرة.

إذا كان جهاز المناعة لديك طبيعي وأنت لا تَخضعُ لأي علاج ، مثل العلاج الكيماوي للسرطانِ , فان استمرار ارتفاع الحرارة لديك أكثر من 37 درجة مئوية لمدة تزيد عن الأسبوع فهذا يتطلب منك مراجعة طبيبك بأسرع وقت ممكن لمعرفة السبب المؤدي لذلك.
إذا كان عِنْدَكَ مشكلةُ في جهازِ المناعة أَو انك تَأْخذُ أدوية مثبطة للمناعةَ ، فان وجود الحرارة قد لايكون إشارة تحذيرية موثوقة وطبيبكِ الأساسي أَو طبيب أورامكِ هو من يخبرك فيما إذا كانت حالتك بحاجة للتقييم من جديد أو إن الأمر طبيعي بالنسبة لحالتك .
فالحُمَّى الدائمة يُمْكِنُ أَنْ تُشيرَ إلى إصاباتِ خفيةِ، حيث يُمكنُ أَنْ تَكُونَ بوليةِ أو السُلِّ. في بعض الأوقاتِ الأخرى، أورام خبيثة - مثل ورم الغدد اللمفاويةِ - حمّى مجهولة السبب، كما يُمْكِنُ أن تكون دوائية ، ردود أفعال إلى بَعْض المخدّراتِ.
استمرار الحرارة لأكثر مِنْ أسبوعين، قد يكون سببه.الحمى التيفية أو المالطية،التهاب الكبد،بعض الأمراض الفيروسية وأمراض الغراء، بَعْض أمراضِ السرطان التحتيةِ ، كما يُمْكِنُ السبب هو السُلَّ أو اِضطراباتَ أخرى.

3. ضيق التنفّس.

الشعور بأنك غير قادر على التنفس - ما بعد الأنفِ أَو ضيقِ التنفّس الذي يلي القيام ببعض التمارين الخفيفة - يُمْكِنُ أَنْ يُشيرَ إلى مشكلةِ صحيةِ مخبئة. عندما تَجِدُ نفسك بأنّك غير قادر على الحُصُول على نفسِكَ أَو بأنّك تَلْهثُ طلباً للهواء أَو تَتنفّسُ بصعوبة، عندها قد تكون بحاجة إلى عنايةَ طبيةَ طارئةَ. فعند شعورك بضيق التنفس هذا مَنْ الضَّرُوري أَنْ تُقيّمَ طبياً بدون تأخير.
أسباب إنقطاعِ النفس قَدْ يَتضمّنُ أمراض الرئة الانسداية المزمنة، التهاب قصبات هوائية مُزمن، الربو، المشاكل القلبِية، القلق، هجمات الرعبِ، ذات الرئة , الصمة الرئوية، التليف الرئوي، ارتفاع الضغط.

4. تغييرات غير مفسرة في عاداتِ الأمعاءِ.

راجعْ طبيبَكَ إذا ظهرعِنْدَكَ أيّ من التالي:
1-"إسهال حادّ دامُ أكثر مِنْ يومين.
2-" إسهالِ معتدل استمر أكثر أسبوع.
3-"إمساك دامُ لأكثر مِنْ أسبوعين.
4-"إلحاح غير مفسر يدعوك للذهاب إلى المرحاض عدة مرات في اليوم.
5-"إسهال دموي.
6-"التبرز الأسود أو بلون القطران.
إن هذه التغييرات في عاداتِ الأمعاءِ قَدْ تُشيرُ إلى عدوى جرثومية - مثل الكامبيلوبكترِ أَو السالمونيلا - أَو عدوى فيروسية أَو طُفيلية. بين الأسبابِ المحتملةِ الأخرى مرضَ أمعاءِ التهابي غير جرثومي كداء كرون أو التهاب القولون التقرحي كذلك قد يكون هناك سرطانِ قولونِ.

5. ظهور تغيرات في الحالة العقلية.

يجب إجراء تقييم طبي فوري إذا وجد أي مما يأتي:
1-وجود تشوّش في "التَفْكير مفاجئ أَو تدريجي.
2-"اضطراب في التوجه.
3-"سلوك عدواني مفاجئ.
4-"هلوسة في شخص ما ،لم تكن موجودة عنده سابقا.
التغييرات في السلوكِ أَو التَفْكير قَدْ تكون بسبب إنتان، ضربة على الرأسِ، صدمة، نقص سكر الدم أَو أدويةِ، خصوصاً إذا تم تناولها مؤخرا.

6 . الصداع الحادّ الجديد أَو الأكثر شدة (خصوصاً إذا كان
عُمرك يزيد عنِ إل 50 سنة)

تحتاج إلى عناية طبية عاجلة إذا كان لديك:
1- صداع مفاجئ وحادّ، في أغلب الأحيان يسمّى صداع thunderclap(الراعد المفاجئ )، لأنه يَجيءُ فجأة مثل تصفيق الرعدِ.
"2-أي صداع مصحوب بحرارة، صلابة نقرة، تشويش عقلي ، طفح جلدي، اضطرابات في الرؤية، اختلاج , حس خدر ونمل، صعوبات في الكلام، مضض في فروةِ الرأس أَو ألمِ بالمَضْغ.
3- الصداع الذي يظهر أو يتفاقم بعد إجراء جراحة الرأس.
أعراضِ الصداعِ هذه قَدْ يكُون سببها الصدمة، التهاب الأوعية الدموية (arteritis)، التهاب سحايا أو ورم دماغي أو تمدد الأوعية الدموية أَو نزف الدماغ بعد رض على الرأس.

7. فقدان الرؤية خلال فترة قصيرة ،أو اضطراب القدرة على الكلام أو اضطراب في الحركة.

إذا ظهرت عِنْدَكَ هذه الإشاراتِ والأعراضِ خلال دقائق. فهذه الإشارات قد تشير إلى ضربة وعائية أو هجمة نقص تروية دماغية عابر. أنت تحتاج إلى عنايةَ طبيةَ طارئةَ فوريةَ، إذا ظهرعِنْدَكَ أيّ من التالي:
1-"ضعف مفاجئ أَو خدر ونمل في الوجهِ أو الذراعِ أَو الساقِ أو لجهة نصفية مِنْ جسمِكَ.
2-"تعتيم مفاجئ أو تَشويش أَو فقدان الرؤيةِ.
3-"فقدان الكلام، أَو اضطراب في الكلام أَو تفهيم الكلام.
"4-أي صداع راعد مفاجئ.
5-"دوخة مفاجئة , اضطراب في التوازن أَو سقوط.

8. الشعور المفاجئ بومضات الضوءِ.

الإحساس المفاجئ بالإضاءة المتوهجة قَدْ يُشيرُ إلى بداية حدوث انفصال في الشبكية. وفي هذه الحالة فان العناية الطبية الفورية قد تنقذ العين المصابة من العمى.

9. الإحساس بالشبع بعد الأكل القليل جدا.

الإحساس بالشبع بعد تناول كمية من الطعام اقل من طبيعية مع حدوث أعراض غثيان أو اقياء لفترة تزيد عن الأسبوع قد تكون علامة إنذار تدعوك لمراجعة طبيبك .حيث هناك العديد من الأسباب المحتملةِ تتضمن، سرطانِ البنكرياس، سرطان المعدةِ ،وسرطان المبيض.

10. المفصل المُنْتَفخ الأحمر أو الحار.

هذه الإشاراتِ التحذيريةِ تلاحظ في التهابات المفصل الجرثومية،حيث تَتطلّبُ عناية طبية اسعافية وذلك للحفاظ على المفصل من التخريب من قبل الجراثيم ولمنع انتشار هذه الجراثيم إلى أماكن أخرى. أسباب أخرى قَدْ تسبب هذه الأعراض وتَتضمّنُ النقرسَ، بَعْض أنواعِ التهابات المفاصل مثل التهاب المفاصل الرثواني.

nosa_aic
08 - 01 - 2012, 06:00
كل شئ عن الربو بالصور

كيف تعمل الرئتان؟

تعمل شبكة أنابيب الشعيبات الهوائية على إدخال الهواء إلى أنسجة الرئتين وتحمل الهواء المستخدم إلى خارج الجسم. يمر الهواء الداخل من خلال هذه الأنابيب إلى أن يدخل إلى الأكياس الهوائية التي تقع في نهايات أصغر الأنابيب، وهي الموقع الذي يتم فيه تبادل الغاز بين الرئة ونظام الدورة الدموية، حيث يدخل الأكسجين إلى الأكياس الهوائية ويمر منها إلى الأوعية الشعرية ويدخل ثاني أكسيد الكربون من الأوعية الشعرية إلى الأكياس الهوائية ليتم نقله إلى خارج الرئتين.





http://www.sehha.com/diseases/rt/rt1a.jpg






http://www.sehha.com/diseases/rt/lung2a.jpg


ما هو الربو؟

الربو مرض مزمن تصاب به الرئتين حيث تضيق فيه مجاري الهواء التي تحمل الهواء من وإلى الرئة وبالتالي يصعب التنفس. مجاري الهواء في الشخص المصاب بالربو تكون شديدة الحساسية لعوامل معينة تسمى المهيجات triggers وعند إثارتها بهذه المهيجات تلتهب مجاري الهواء وتنتفخ ويزيد إفرازها للمخاط وتنقبض عضلاتها ويؤدي ذلك إلى إعاقة التدفق العادي للهواء، وهذا ما يسمى بنوبة الربو asthma attack. بالإمكان السيطرة على أعراض نوبة الربو، ولكن يمكن أن يتكرر حدوث النوبة خلال ساعات بعد حدوث النوبة الأولى.


http://www.sehha.com/diseases/rt/bronch1a.jpg

ما هي العلامات والأعراض؟


تختلف الأعراض من شخص لشخص، وتتراوح ما بين خفيفة إلى حادة، وتحدث في كل من نوبات الربو التي تسببها الحساسية وتلك التي تحدث من أسباب غير الحساسية ويمكن أن تشمل:

سعال
أزيز wheezing (صوت تصفير أثناء الزفير)
صعوبة في التنفس
انقباض في الصدر
زيادة إفراز المخاط
اتساع في فتحتا الأنف
ما هي نوبة الربو؟
الشخص الذي يصاب بنوبة الربو يجد صعوبة في التنفس، إذ تنقبض العضلات التي تحيط بأنابيب القصبة الهوائية وتؤدي إلى تضييق مجاري الهواء. ويعيق هذا التشنج الشعبي التدفق الطبيعي للهواء، كما تؤدي الزيادة في الإفراز المخاطي إلى تكوين سدادات مخاطية. كذلك يحدث انتفاخ في أنابيب القصبة الهوائية مما يزيد في إعاقة تدفق الهواء. إذا استمرت النوبة فإن استفحال التشنج الشعبي والمخاط يحبس الهواء في الأكياس الهوائية، مما يعيق تبادل الهواء. ويستخدم الشخص الذي يصاب بالنوبة عضلات الصدر بدرجة أكبر لكي تساعده في التنفس.

http://www.sehha.com/diseases/rt/bronch2a.jpg http://www.sehha.com/diseases/rt/bronch3a.jpg

ما هي مراحل نوبة الربو؟

صعوبة التنفس -أزيز-الاستجابة للدواءخفيفةأوطفيفة يوجدنوبة متوسطةأثناء الراحة- يوجدنوبة حادة واضحة- يختفي أو يزيد صوت التنفس- توقف التنفس حاد



ما هو الأزيز وكيف يحدث؟

الأزيز صوت يحدث عندما يمر الهواء في مجاري التنفس الضيقة بفعل الانتفاخ والمخاط والتشنج الشعبي. ويمكن أن يحدث الأزيز فجأة ويكون إشارة إلى صعوبة في التنفس. إذا تطورت حدة النوبة قد يختفي الأزيز. إن غياب الأزيز هو إشارة إلى أن الهواء لا يتحرك داخل أو خارج الرئتين، وهذه حالة خطيرة للغاية. سيعود الأزيز مع تحسن النوبة، ويختفي في النهاية تماما.

من يصاب بالربو؟

يمكن لأي شخص أن يصاب بالربو. وهو مرض غير معدي يعاني منه ملايين الناس في كل أرجاء المعمورة بصرف النظر عن العرق أو الثقافة أو السن أو الجنس. ويزيد من احتمال الإصابة بالربو وجود تاريخ عائلي بها. الأشخاص الذين يعانون من الحساسية معرضين أكثر للإصابة بالربو. في الحقيقة يقدر أن 80% من الأطفال و 50% من البالغين المصابين بالربو يوجد لديهم حساسية أيضا. عادة يحدث الربو عند الأطفال في سن الخامسة، وفي البالغين في العقد الثالث، ويمكن أيضا أن يصاب به كبار السن، فحوالي 10% من حالات الربو التي المشخصة تكون بعد سن 65.


ما هي أنواع الربو؟

هناك نوعان أساسيان من الربو: ربو خارجي المنشأ (من الحساسية)، وربو داخلي المنشأ (لا يثار بالحساسية). ويمكن أن يكون الشخص مصابا بالنوعين معا، وهو خليط من الربو الخارجي المنشأ والداخلي المنشأ.

الربو الخارجي المنشأ أكثر انتشارا بين الأطفال والمراهقين وعادة يختفي مع السن ومع تفادي العوامل المثيرة للحساسية. ويكون للشخص المصاب بهذا النوع من الربو حساسية غير عادية تجاه العوامل المثيرة للحساسية. عندما يتعرض المصاب بالربو للمرة الأولى للعوامل المثيرة للحساسية، ينتج جهاز المناعة كميات غير عادية من البروتينات الدفاعية تسمى الأجسام المضادة. إن اميونوجلوبولين (جلوبولين المناعة) إي (آي جي إي IgE) هو الجسم المضاد الذي يسبب أعراض الحساسية. ودور أجسام آي جي إي المضادة هو تمييز عوامل معينة مثيرة للحساسية، مثل لقاح نبات "الرجيد"، وتلصق بالخلايا البدنية (خلايا تحتوي على وسائط كيماوية). تتراكم هذه الخلايا في أنسجة معرضة للبيئة مثل الأغشية المخاطية في الجهاز التنفسي. خلال التعرض الثاني تميز أجسام آي جي إي المضادة العوامل المثيرة للحساسية وتعمل على تنبيه الخلايا البدنية لكي تطلق الهيستامين histamine والوسائط الكيماوية.إن الوسائط هي كيماويات التهابية تترك تأثيرها على أنابيب الشعيبات الهوائية لكي تؤدي إلى إنتاج المزيد من المخاط فيها والانتفاخ والتشنج الشعبي.
الربو الداخلي المنشأ شائع أكثر في الأطفال الذين تقل أعمارهم عن 3 سنوات وفي البالغين الذين تزيد أعمارهم عن 30 سنة. إن الالتهابات الفيروسية التنفسية هي مهيجات أساسية وتؤثر إما على الأعصاب أو الخلايا قرب سطح أنابيب القصبة الهوائية. وقد يسبب ذلك تشنج شعبي أو إطلاق وسائط كيماوية مما يؤدي إلى حدوث نوبة الربو. وتشمل المهيجات الأخرى

العوامل المثيرة للحساسية
والتمارين الرياضية
والهواء البارد
والتغييرات العاطفية والتي قد تسبب أيضا تشنج شعبي.

nosa_aic
08 - 01 - 2012, 06:27
المهيجات الشائعة للربو Triggers


مهيجات الربو هي تلك العوامل التي تعمل على إحداث أعراض الربو، وهذه المهيجات تتفاوت بين المصابين بالربو، ولذلك من الضروري معرفة العوامل التي تحدث النوبة:

العوامل المثيرة للحساسية: ريش أو شعر الحيوانات، عث الغبار (يوجد أيضا في السجاد ومكيفات النوافذ التي لا تنظف دوريا)، غبار الطلع، الأطعمة مثل الفول السوداني والسمك والمحار والبيض.
المثيرات في الهواء: دخان التبغ من السجائر أو السيجار أو الغليون أو النارجيلة (الشيشة)، دخان الشوي بالفحم، رائحة الطلاء والوقود، الملوثات مثل عوادم السيارات ومداخن المصانع.
الطقس: الهواء البارد والجاف والرطوبة العالية أو التغيرات المفاجئة بالطقس يمكن أن تسبب أعراض الربو. الرياح تنقل المواد المهيجة المثيرة للحساسية، والمطر يسهل نمو وإطلاق الفطر واللقاح.
المواد المهيجة: البخاخات (الإيروسول spray/aerosol) والغبار والأبخرة من منتجات التنظيف.
المرض: الالتهابات الفيروسية مثل الزكام/الرشح، الانفلونزا ، التهابات الحلق والجيوب الأنفية تعتبر من المهيجات الشائعة للربو لدى الأطفال.
التمارين الرياضية: التمارين الرياضية مهيجات شائعة للربو. ويمكن أن تحدث لدى كل الأشخاص المصابين بعد أداء تمارين رياضية عنيفة لمدة 5 دقائق على الأقل. أما الألعاب الرياضية مثل السباحة فهي أقل المهيجات للربو، بينما الجري لمسافات طويلة وكرة القدم عادة ما تؤدي إلى حدوث نوبة الربو عند المعرضين للإصابة.
التغييرات العاطفية: الضحك والبكاء والخوف والصراخ والسعال يمكن أن تتسبب في أعراض الربو.

nosa_aic
08 - 01 - 2012, 06:31
ما هي أدوية الربو؟


تنقسم أدوية الربو إلى قسمين أساسيين هما أدوية السيطرة طويلة الأمد و أدوية السيطرة السريعة.

أدوية السيطرة طويلة الأمد

تستخدم للسيطرة على الربو المزمن أو الدائم. هذه المجموعة من الأدوية تشتمل على

الكورتيزون الذي يستنشق أو يعطى عن طريق الفم
كرومولين
نيدوكروميل
معززات البيتا 2 طويلة المفعول
لثيوفيلين
معدلات الليكوترينين

أفضل الأدوية للسيطرة طويلة الأمد هي تلك الأدوية التي تمنع أو تعكس الالتهاب في مجاري التنفس وبالتالي تقلل من حساسية مجاري التنفس وتمنع إثاراتها بواسطة المهيجات بسهولة. الهدف من استخدام هذه المجموعة من الأدوية هو منع حدوث نوبات الربو.
أدوية السيطرة السريعة

هذه المجموعة تعالج أعراض نوبة الربو الحادة أو تفاقم النوبات، وهذه المجموعة تشتمل على

معززات البيتا 2 قصيرة المفعول
إبراتروبيام بروميد
الكورتيزون الغير مستنشق

موسعات القصبات الهوائية (معززات البيتا 2 قصيرة المفعول و الإبراتروبيام بروميد ) توسع مجاري التنفس عن طريق إرخاء العضلات التي تحيط بأنابيب القصبة الهوائية وتكون منقبضة أثناء نوبة الربو.

معظم أدوية الربو تعطى عن طريق الاستنشاق، ولكي تتم الفائدة المطلوبة يجب استخدام أدوات الاستنشاق بطريقة صحيحة. فلقد لوحظ أن نصف الأشخاص الذين يستخدمون أدوات الاستنشاق لا يستخدموها بطريقة صحيحة. لذلك اطلب من مزود الخدمة الطبية لملاحظتك أثناء استخدامها للتأكد من طريقتك في الاستخدام.

nosa_aic
08 - 01 - 2012, 06:39
أسئلة وأجوبة متنوعة


إلى أي حد يعتبر الربو مرضا شائعا ؟


الربو مرض شائع جدا . واحد من كل عشر أشخاص مصاب بالربو مما يعني أن حوالي 600 مليون شخص في العالم مصابين بمرض الربو .





هل تسبب أدوية الربو التعود أو الإدمان ؟
لا تسبب الأدوية أو البخاخات إطلاقا أي تعود أو إدمان لدى المصابين بمرض الربو . وعلى العكس من ذلك فإن البخاخات تعتبر أفضل طرق العلاج الموصى بها من قبل الجمعيات العلمية المحلية والعالمية . حيث أنها تضع علاج الربو مباشرة في الرئة وتكون عندئذ كمية العلاج قليلة مما يقلل الآثار الجانبية ، على عكس طرق العلاج الأخرى كالأقراص والحقن وغير ذلك .



هل يمكن لمرضى الربو أن يعيشوا حياة طبيعية ؟
نعم . ليس هناك من سبب يمنع مرضى الربو من العيش بشكل طبيعي طالما أنهم يداومون على تناول العلاج يوميا .



هل للمناخ تأثير بالإصابة في الربو ؟
يعاني الناس من الربو في جميع أنحاء العالم سواء في الأقطار الحارة أو الباردة . إلا أن التغييرات المناخية تزيد من حدة الربو لدي الكثير من المصابين به .



هل يمكنني كمصاب بالربو ممارسة الالعاب او التمارين الرياضية ؟

نعم ، يمكنك ممارسة هذه التمارين طالما أنك تتناول الأدوية الموسعة للشعب الهوائية قبل البدء بالرياضة وتعتبر بعض أنواع الرياضة كالسباحة أفضل من غيرها بالنسبة لمرضى الربو . تذكر ألا تفرط في ممارسة التمارين الرياضية الى أن تصبح لائقا بدنيا .



ما هي الاشارات التحذيرية التي يشعر بها مريض الربو قبل حدوث النوبة ؟
يمكن أن تحصل نوبات الربو في أي وقت . فإذا شعرت بان أعراض الربو لا تزول حتى بعد تناول العلاجات المهدئة عندئذ تكون حالة الربو لديك في ازدياد . راجع طبيبك فورا فقد تكون بحاجة إلى جرعات اكبر من العلاجات الوقائية كي تتمكن من السيطرة على الربو .



هل يمكن الشفاء من مرض الربو ؟
أكثر من 80% من الاطفال الذين يصابون بالربو قبل سن دخول المدرسة . تزول أعراض الربو لديهم قبل أو عند سن البلوغ . المستقبل يحمل دائما في طياته الأمل كما أن العلاجات المتطورة أصبحت في متناول مرضى الربو . اما إذا كنت تقصد بسؤالك هل يمكن منع أو الحد من نوبات الربو فالجواب " نعم" ولكن شريطة تناول العلاجات يوميا كما وصفها لك الطبيب .



هل الربو مرض معد ؟
لا. مرض الربو غير معد البته .



هل أتناول العلاجات الموسعة للشعب حتى لو كنت اشعر بأن حالة الربو عندي مستقرة؟ لا تتناول العلاجات المهدئة لازمة الربو الا حسب إستشارة الطبيب . قد ينصحك الطبيب أحيانا بتناول العلاجات الموسعة للشعب في كل مرة تشعر فيها بأعراض الربو . لا يشكل ذلك خطرا على صحتك أما إذا تناولت هذه العلاجات أكثر من أربع مرات في اليوم عندئذ يجب عليك اعلام طبيبك لانك قد تكون بحاجة الى مزيد من العلاجات الوقائية .



هل استعمال الستيرويدات (الكورتيزون) مضر ؟
هناك العديد من الستيرويدات . فمنها ما يتشكل طبيعيا مثل الهرمونات . وتصنع غيرها لاستعمالها في المراهم ولمعالجة التهاب المفاصل . ويستعمل البعض الآخر لبنية الجسم . وتختلف الستيرويدات المستنشقة لعلاج الربو عن هذه الستيرويدات . ان الجرعات الستيرويدية التي تستعمل هي جرعات صغيرة تؤخذ بالإستنشاق ، حيث تصل مباشرة الى الرئتين خلافا للستيرويدات التي تنفذ الى داخل الجسم .



هل لعلاجات الربو أعراضا جانبية ؟
يتعرض بعض مرضى الربو لنسبة طفيفة من الأعراض الجانبية لكنها لا تكون لفترة طويلة كما أنها تتوقف عند التوقف عن تناول الدواء او تقليل جرعته . راجع الطبيب دائما اذا شعرت بهذه الأعراض وهو سيشير عليك بما يجب عمله . ان التوقف عن تناول الدواء دون استشارة الطبيب قد يكون خطيرا .

قياس القدرة القصوى لنفخ الهواء

اختبار قياس كفاءة الرئة
هذا الاجراء يماثل قياس نسبة السكر في الدم الذي يجريه مريض السكر بنفسه في المنزل أو قياس ضغط الدم بغرض مراقبة السيطرة على هذه الامراض . يشير قياس قدرة الرئة إلى كفاءة الرئة وسرعة تدفق الهواء منها ومدى توسع مسالك الهواء فيها .

كيف تقيس كفاءة الرئة؟
يمكن اجراء هذا القياس بنفسك باستخدام جهاز قياس القدرة القصوى لنفخ الهواء لمعرفة أعلى معدل لتدفق الهواء ومدى توسع مسالك الهواء في الرئة .


يجب عليك متابعة حالتك في المنزل من خلال تسجيل نتائج هذا القياس صباحا ومساء لمساعدة الطبيب على :

تقدير مدى استجابتك للعلاج
التنبؤ بحدة النوبة
تحديد العلاج المناسب

كيفية استخدام جهاز قياس القدرة القصوى لنفخ الهواء

ضع المؤشر مقابل علامة الصفر وتجنب لمس المؤشر أثناء النفخ

2.قف وامسك بالجهاز افقيا مقابل فمك
http://www.sehha.com/diseases/rt/asthma/asthma11.jpg

3.خذ نفسا عميقا على قدر المستطاع
http://www.sehha.com/diseases/rt/asthma/asthma13.jpg

4.ضع شفتيك باحكام حول فتحة الفم
http://www.sehha.com/diseases/rt/asthma/asthma12.jpg

5.انفخ بأقصى وبأسرع ما تستطيع وسجل قياس المؤشر
http://www.sehha.com/diseases/rt/asthma/asthma15.jpg

6.أعد المحاولة مرتين وسجل قياس المؤشر كل مرة
http://www.sehha.com/diseases/rt/asthma/asthma14.jpg
7.سجل أعلى قياس من الثلاثة قياسات


وبذلك تحصل على مؤشر لقدرتك القصوى لنفخ الهواء في هذه الوقت

نظام ألوان الإشارة

أرقام المعدل الأقصى لتدفق الهواء يمكن وضعها في نطاق ثلاثة ألوان تشبه إشارة المرور . بمقارنة أرقام معدلك الأقصى لتدفق الهواء تستطيع تحديد لون الإشارة الذي يقع فيه الرقم الذي تسجله يوميا لتدفق زفيرك.

الإشارة خضراء (80% - 100% من الرقم النهائي)
إنطلق - أنت في أمان من النوبات ، وتستطيع الاستمرار في تناول الجرعات المعتادة
الإشارة صفراء (50% - 80% من الرقم النهائي)
إحترس - حالتك ليست تحت التحكم ويجب تعديل خطة العلاج لتحاشي الخطورة. اتصل بطبيبك.
الإشارة حمراء (تحت 50% من الرقم النهائي)
خطر - يجب عليك أن تتناول فورا موسع شعب سريع المفعول ثم تتصل مباشرة بطبيبك.

nosa_aic
08 - 01 - 2012, 16:18
بكاء نوبات المغص لدى الرضيع.. كيف تتعاملين معه؟

حينما تنزعج الأم وتحتار عند بدء طفلها الرضيع بالبكاء بشكل متواصل وبشدة أكبر من المعتاد، نتيجة شعوره بنوبات المغص، فإن عليها تذكر أن البكاء هو الشيء الوحيد الذي بمقدور الطفل فعله إزاء ما يشعر به، وأنها ليست الوحيدة في الشعور بالحيرة إزاء بكاء الطفل آنذاك، بل ان الأطباء ايضا يُشاطرونها الحيرة في إعطاء تفسير وجيه حول سبب ظهور هذه المشكلة لدى الأطفال الرضع. ومع هذا، فإن الأكيد هو أن الأطفال، وهم في نوبات المغص والبكاء تلك، إنما هم بصحة جيدة، أي ليسوا مرضى، والأمر لا علاقة له بالطريقة التي تعتني أو تتعامل بها الأم مع رضيعها، ولا ذنب لها ولا للأب في التسبب بمعاناة الطفل تلك. لكن ما على الأم إدراكه هو أن الطفل في نوبات المغص والبكاء يكون أكثر حساسية لما يدور حوله من أمور قد تكون مزعجة له بالمقارنة مع ما يتفاعل به الطفل في حالاته العادية أو ما يُحس به عادة بقية الأطفال الرضع الآخرين إزاء تلك الأمور.
* بكاء المغص ولا يُوجد اتفاق حول تعريف تلك النوبات بعبارات طبية دقيقة، لكن يُعتبر بكاء الطفل من نوع بكاء المغص حينما يبكي بشدة متكررة أكثر من ثلاثة أيام في الأسبوع، لمدة تزيد بمجملها عن ثلاثة ساعات يومياً، خلال أكثر من ثلاثة أسابيع في الشهر الواحد.
وتظهر نوبات بكاء مغص الطفل baby colic عادة في الفترة بين الأسبوع الثالث والسادس بعد الولادة. ويُصاب بها في الغالب الأطفال الذين يرضعون بالقارورة، لكن حتى الأطفال الذين يرضعون رضاعة طبيعية من ثدي الأم عُرضة لتك المعاناة. وغالباً ما تزول عند بلوغ سن ثلاثة أشهر، بشكل مفاجئ أحياناً. وفي نوبات المغص تلك، قد يبكي الطفل بشكل متواصل أو بشكل متقطع لمدة قد تزيد عن ثلاث ساعات طوال اليوم. وتختلف شدة بكاء الطفل الواحد من آن لآخر، كما تختلف الشدة في البكاء بين الأطفال. وكلما بكى الطفل، فإنه سيبتلع الهواء، ما يزيد من كمية الغازات في بطنه، ويزيد بالتالي من معاناة المغص تلك. وبالرغم من أن نوبات المغص تلك، والبكاء المصاحب لها قد تظهر أو تزداد سوءا عند حلول المساء، إلا أن الأمر قد يحصل في أي ساعات النهار.
* عوامل وأسباب يعتقد البعض أن المغص الذي ينتاب البطن لدى الطفل إنما ينتج عن احتباس غازات في قنوات أمعاء الجهاز الهضمي. وبالرغم من دعم بعض الأدلة العلمية الطبية لهذا الاعتقاد، إلا أن هذا الأمر، أي احتباس غازات في الأمعاء، ليس السبب الوحيد في كل الحالات التي تنتاب الأطفال الرضع تلك النوبات من البكاء. وثمة نظرات طبية أشمل، ترى أن الحالة تحصل عند اجتماع عدة عناصر لدى الطفل. وهي ما تشمل أربعة عناصر: الأول: تدني عتبة حساسية تفاعل الطفل ومزاجه مع الظروف المحيطة به من درجة الحرارة أو الرطوبة أو الضجيج أو الاهتمام أو غيره، مما يجعل الطفل سهل اللجوء إلى البكاء. ثانياً: عدم اكتمال نمو الجهاز العصبي لدى الطفل، سواء في الأطراف العصبية المنتشرة في الأمعاء ودرجة تفاعلها مع ما يدور فيها، وأيضاً درجة نمو الجهاز العصبي المركزي التي قد لا تُمكن الطفل من ضبط دواعي لجوئه إلي البكاء وعدم السيطرة عليه إلا عند الضرورة.
ومن المهم إدراك الأمهات والآباء، وبقية الإخوة والأخوات، لهذين الجانبين عند تعاملهم مع الأطفال الرضع وتفاعلهم مع بكائهم، لأن الطفل الرضيع قد يبكي من أسباب قد نراها نحن، بأجهزتنا العصبية والعقلية المتطورة النمو، تافهة أو يغيب عن بالنا أنها قد تثير بكاء الطفل، بينما الأمر مختلف تماماً لديه. وعلى سبيل المثال كلنا نُدرك ونعلم أنه يضحك لأتفه الأسباب أو عند سماع أصوات غريبة، لكن الغريب هو أننا برغم علمنا بذلك الأمر مع الضحك فإننا نستغرب أمورا أخرى تدفع الطفل للبكاء، أي بمعنى ان كلنا يعلم أن الطفل الرضيع قد يضحك لأشياء نراها غريبة عجيبة، فلماذا نتعجب أو نستغرب منه حينما يبكي لأشياء أخرى غريبة عجيبة قد لا تخطر على البال؟
ثالثاً: عدم اكتمال نمو الجهاز الهضمي بنية ووظيفة في التعامل مع الغذاء الذي يأخذه عن طريق البلع، وفي أيضاً التعامل والتعود على وجود هواء غازي في مجاري قنوات الهضم. والطفل في تلك المرحلة المبكرة من العمر في طور بناء قدرات التعامل تلك. ولذا قد نلحظ ببساطة أن الطفل أثناء الرضاعة يبتلع كميات من الهواء، ما يُملي على المُرضعة إعطاء راحة أثناء الرضاعة للطفل ووضعه في وضعية قائمة لاعطاء فرصة لخروج أكبر كمية من الهواء الذي ابتلعه من خلال التجشؤ عبر الفم، وهو ما قد يخرج بشكل مفاجئ للطفل ويصدر عنه صوت قد يرتاع ويبكي الطفل منه! وكذلك الحال مع تعود الأمعاء على آلية طبيعية لخروج الغازات عبر فتحة الشرج، وهو أمر حتى البالغين قد يُواجهون صعوبات فيه بالرغم من التطور في نمو الجهاز الهضمي لديهم ومعرفتهم بأنسب الطرق لتسهيل خروج الغازات بشكل طبيعي.
رابعاً: هناك من الدراسات الحديثة للباحثين من الولايات المتحدة، وخاصة جامعة براون، تقول إن أكثر من نصف حالات بكاء مغص الطفل الرضيع إنما هي نتيجة لدرجة متوسطة من ترجيع محتويات المعدة إلى المريء gastroesophageal reflux، وبعضها نتيجة لعدم تقبل الأمعاء للحليب lactose intolerance. ولذا تغلب الحالة لدى من يرضعون من القارورة.
خامساً: تثير بعض الدراسات الحديثة فرضيات لتفسيرات أخرى تتعلق بأن نمو الغدة الصنوبرية في الدماغ لم يكتمل بعد عادة لدى الأطفال الرضع إلا عند بلوغ سن ثلاثة أشهر، وهو الوقت الذي تزول الحالة فيه لدى غالبية الأطفال. ولذا يقولون إن المشكلة تشتد عند حلول المساء، وهو الوقت الطبيعي الذي يجب أن تبدأ فيه الغدة الصنوبرية إفراز هرمون ميلاتونين لتسهيل استرخاء الجسم والخلود إلى النوم، وحيث أن تلك الغدة غير قادرة على إفراز هرمون ميلاتونين بشكل طبيعي إلا بعد سن ثلاثة أشهر، فإن المشكلة تظهر.
ويُدللون على صحة الفرضية هذه بتغيرات النظام اليومي للأم في الثلث الأخير من أشهر فترة الحمل، وبمدى معاناتها من التوتر النفسي وممارسة التدخين كعوامل تُسهم في إصابة أطفال ذلك الحمل بالمشكلة في أول ثلاثة أشهر بعد الولادة.
* الأم وبكاء الرضيع كون أنه لا تُوجد إرشادات طبية محددة لمعالجة حالات بكاء مغص الأطفال الرضع، لا يعنى إلا أمراً واحداً من الناحية العلاجية التطبيقية التي تهم الأم، بالدرجة الأولى في نهاية المطاف، في تخفيف معاناة رضيعها، وهو أن مهارة الأم في ملاحظة الطفل والعناية المستمرة به، وفي تعاونها مع الطبيب، وفي حُسن استخدامها للنصائح والوسائل المُقترحة كحلول علاجية، هو أهم الوسائل لديها للنجاح في تخفيف معاناة الطفل الرضيع، وفي تخفيف معاناتها هي وبقية أفراد الأسرة من هذه الحالة. وتقول الأكاديمية الأميركية لأطباء الأسرة في الولايات المتحدة إن بإمكان الأم محاولة استخدام وسائل شتى في تهدئة الطفل وتخفيف المعاناة لديه. وتشمل الوسائل تغير طريقة تغذيته أو رعايته من حمله أو وضعه أو غير ذلك. وتقترح العناصر التالية:
ـ هز الطفل في المهد أو الكرسي الهزاز.
ـ وضع الطفل في أرجوحة، مع التأكد من توفير سند للظهر والرأس.
ـ استحمام الطفل بماء فاتر.
ـ إعطاء الطفل المصَّاصة.
ـ تدليك البطن برفق.
ـ لف الطفل ببطانية ناعمة.
ـ وضع الطفل في عربة المشاية للأطفال والذهاب به في مشوار. ـ أخذ الطفل في مشوار بالسيارة، مع الاهتمام بوضعه في المقعد المخصص له فيها.
وتقترح في جانب تغيرات التغذية، أن تُرضعه بعد ساعتين من فراغ إعطائه آخر رضعة. والمهم إعطاؤه رضعات متكررة في مدد زمنية قصيرة. وربما احتاج الأمر تغير نوعية الحليب الذي يُقدم للطفل، مع الاهتمام بتدفئة حليب الرضعة قبل تناول الطفل لها، أو استخدام حلمة ذات ثقب أصغر لو كانت الرضاعة لا تستغرق أقل من عشرين دقيقة، إذ المهم ألا يتم إرضاع الطفل بعجلة. وعلى الأم اللجوء إلى الطبيب وأخذ مشورته حينما تشعر بأن من الصعب عليها التحكم في الحالة باتخاذ هذه الوسائل، أو أن الأمر أثر على نمو وزن الطفل أو كان هناك ارتفاع في حرارة الطفل.
كما أن اللجوء إلى استخدام «ماء غريب» أو شاي الأعشاب أو غيره من العلاجات البديلة أو أدوية المغص أو تخفيف الغازات، كله يجب أن يتم بإشراف الطبيب.
* تناول الأطفال لماء غريب.. جدال علمي واستخدامات مختلفة > تلجأ كثير من الأمهات في كثير من دول العالم، وبتوجيهات من كثير من الأطباء، نحو إعطاء الأطفال جرعات قليلة من «ماء غرْيب» Gripe water. وثمة اختلافات علمية طبية حول جدواه وأمان تناول الأطفال له، وهو بالأصل عبارة عن أحد المستحضرات العشبية العلاجية، المتوفرة بهيئة سائلة، أي ترياق خال من أي مركبات دوائية صيدلانية، ظهر لأول مرة عام 1851 في بريطانيا، وهو يُستخدم لتخفيف نوبات بكاء مغص الأطفال الرضع وغيرهم، وتخفيف المعاناة بينهم من غازات البطن، وتخفيف ألم التسنين وظهور الأسنان، وغيرها من الأعراض المزعجة في الجهاز الهضمي للأطفال. كما أن ثمة من البالغين من يتناوله، بكميات أكبر من تلك التي تُعطى للأطفال عادة، في تخفيف ألم مغص الأمعاء أو الغازات أو غيرها من شكوى الجهاز الهضمي.
وهناك بالأسواق في مناطق شتى من العالم أنواع مختلفة من ماء غريب بأسماء تجارية عدة. ويحتوي في غالب أنواعه على مركبات فاعلة مستخلصة من الزنجبيل ginger، والشبت dill، والشمر fennel، والبابونج chamomile. وتتفنن الشركات اليوم في إنتاج أنواع مختلفة من ماء غريب تحتوي المواد المذكورة بخلطات مختلفة، لكن النوع الإنجليزي الأصلي والشائع Woodward's Gripe Water يحتوي على زيت الشبت وبيكربونات الصوديوم وسكر وماء.
وعلى الرغم من الاستخدام الواسع له في كافة أنحاء العالم منذ مدة تزيد على 150 سنة، إلا أن المصادر الطبية العالمية تؤكد أنه لم يخضع للدراسات العلمية الطبية الجادة، أي انه وبالرغم من عدم وجود أدلة علمية علي جدوى استخدامه في معالجات اضطرابات الأمعاء والهضم لدى الأطفال، إلا أن الكثيرين من أطباء العالم يسمحون وينصحون باستخدامه في معالجة الأطفال! ولذا حينما منعت إدارة الغذاء والدواء في الولايات المتحدة استيراد أي منتجات ماء غريب عام 1993 التي تُعرّف بأنها أدوية، قامت الشركات بتسويقها علي أنها ملحقات غذائية. وهو ما يعني أنها لا تحتاج إلى موافقة إدارة الغذاء والدواء باعتبارها مُعرّفة بأنها منتجات غير دوائية.
وتتوفر لذلك حتى في متاجر المواد الغذائية. ومع هذا فإن ثمة أنواعاً مُنتجة في الولايات المتحدة وتخضع لضوابط إدارة الغذاء والدواء في إجراءات أمان الإنتاج والتعبئة والفاعلية.

nosa_aic
08 - 01 - 2012, 17:16
الموز بالحليب يفيد معدة المدخنين

تشير الأبحاث العلمية التي درست أسباب قرحة المعدة الى ان للتدخين دورا أساسيا في حدوث هذا المرض الذي يؤثر على الصحة حيث للتدخين بأنواعه سواء السجائر أو الشيشة ارتباط بالتأثير على أغشية المعدة حيث يحتوي على مواد ضارة تؤدي إلى التأثير على سلامتها.

وللحد من تأثير التدخين على سلامة الاغشية التي تبطن المعدة فانه ينصح بتناول وشرب الحليب والموز حيث إنها تحتوي على بعض المواد والتي تساهم في حماية انسجة المعدة من ارتفاع الحموضة كما أن للتركيز القلوي للحليب دورا مهما في حماية المعدة ولذلك فانه ينصح بشرب الحليب لحماية المعدة والحد من حدوث القرحة وخاصة عند الذين يدخنون والذين يحتاجون إلى شرب الحليب.


ولزيادة الفائدة من تأثير الحليب على سلامة المعدة ينصح بالامتناع عن التدخين في العام الأول وإذا لم يستطع الشخص ذلك فانه يمكن أن يستهلك ويتناول الحليب ويفضل كذلك لزيادة الفائدة بتناول الموز معه أو عمل خلطة (ملك شيك) مع الحليب والموز وشربه وخاصة للمدخنين للحد من قرحة المعدة.

nosa_aic
09 - 01 - 2012, 07:15
فترة القيلولة تؤثر على مزاج الأطفال الصغار


أثبتت دراسة طبية حديثة أجراها باحثون أمريكيون بجامعة "كولورادو" بالولايات المتحدة الأمريكية أن الأطفال دون الثالثة الذين يحرمون من النوم فى فترة القيلولة التى تلى الظهيرة تتأثر حالتهم المزاجية فيما
بعد ويعانون من نوبات الغضب والتصرف بعدوانية على المدى البعيد.
وقال الباحثون أن الاطفال الصغار يشعرون بالتعب والتعاسة ويتعرضون لمشاكل نفسية ويصبحون أكثر عرضة للقلق والتوتر العصبى فى مرحلة البلوغ بسبب حرمانهم من النوم فى فترة قيلولة النهار التى لها الكثير من الفوائد الصحية التى تنعكس عليهم فى المستقبل.
وأضافوا أن الحرمان من النوم لفترات كافية يؤثر سلبا على صحة الأطفال والكبار على حد سواء..لافتين إلى أن الأطفال فى مرحلة النمو يحتاجون لفترات نوم كافية وطويلة وحرمانهم منها يجعلهم حانقين ويغير من حالتهم المزاجية بصورة واضحة إذا تعرضوا لأقل إجهاد ويصبحون أقل حماسة للأحداث السعيدة والمثيرة التى تدور حولهم.
وأجريت الدراسة على مجموعة من الأطفال التى تراوحت أعمارهم مابين (2-3 أعوام) تم قياس فترات نومهم من خلال بعض الأجهزة الخاصة لذلك وكان الآباء والأمهات مشاركون أيضا فى التجربة الطبية وتمت ملاحظة التغييرات التى تظهر على ملامح الأطفال الذين أخذوا الغفوة النهارية المعتادة والاطفال الذين حرموا منها.
وأظهرت الدراسة أن الاطفال الذين حرموا من غفوة النهار سجلوا تجاوبا مع الاخرين بنسبة أقل من الأطفال الذين حظوا بقسط وافر من النوم فى النهار بمقدار الثلث أو ما يعادل 34 فى المائة.
وأشاروا إلى أن النوم حاجة أساسية مثل الحاجة الى تغذية سليمة وأن حاجة الطفل للنوم تجعله غير قادر على التجاوب والتفاعل مع الاخرين داخل الحضانة أو المدرسة بالاضافة إلى أن الطفل قد يتعرض لنوبات الغضب والاحباط فى مرحلة البلوغ.

nosa_aic
09 - 01 - 2012, 07:33
تمارين للعيون بعد تصفح الانترنت


كثير منا يحس بالم في العين بعد الاستخدام الطويل للكمبيوتر ويهمل الاعتناء به ...هذه تمارين جدا

بسيطه ماراح تاخذ من وقتكم غير القليل وراح تفيد عيونكم ان شاء الله...




( أولا )

اجلسوا على كرسي مسندين ظهوركم صح وبطريقه مستقيه ثم إنظرو بجهة اليمين وعدوا للعشره وبعدين انظروا لجهة اليسار وعدوا للعشرة طبعا بدون تحريك الراس فقط العين....


http://www.othetheh.com/imgcache/13497.imgcache.gif


( ثآنيآ)

بنفس الطريقة السآبقه حركوا عيونكم لفوق وعدوا للعشره وبعدين لتحت وعدوا للعشره..

http://www.othetheh.com/imgcache/13498.imgcache.gif


( ثآلثآ)

ركزوا النظر للأنف كأنكم محوليين وعدوا للعشره ثم حركوا عينكم بحركه دائرية من اليمين لليسار ومن اليسار لليمين مع وعكس عقارب الساعه...

http://www.othetheh.com/imgcache/13499.imgcache.gif


(رابعـا)

غطوا أعينكم براحة كفكم بعد فرك الكفين لتدفأتهما وعدوا للعشرين..

http://www.othetheh.com/imgcache/13500.imgcache.gif

nosa_aic
09 - 01 - 2012, 23:54
ما هو اجهاد العينين


الكثير ممن يستخدمون الكمبيوتر يعانون من إجهاد بالعينين

خاصة إذا استخدم لفترات طويلة..


فما هو إجهاد العينين؟


" إن إجهاد العيون يعني أن الشخص يجد صعوبة في تبديل تركيز النظر ، بين الشاشة والمستندات الموضوعة على المكتب ، وقد يشاهد الشخص أهدابا أو صورا ملونة عند النظر بعيدا عن شاشة الكمبيوتر، إضافة إلى أعراض أخرى متفاوتة الدرجة حول العينين ، وخلف محجر العين ، وكذلك فوق الجفون ، وأعراض مصاحبة مثل : الحرقان ، والإحساس بجفاف العيون ".

فما هو الحل؟


كل تلك الأعراض ، رغم كونها مزعجة ، لكنها لا تفضي إلى عواقب طويلة الأمد . أما الحل ، فيمكن - بإذن الله - التخفيف من إجهاد العين الناجم عن الكمبيوتر، أو تفاديه كليا ، وذلك من خلال تغيير بعض العادات وسلوكيات العمل

وإليك بعض النصائح :

امنح عينك استراحة :

انظر بعيدا عن الشاشة ، وإلى شيء بعيد عنك لمدة عشر ثوان ، وذلك كل عشر دقائق تقريبا ، أو دع عينك من دون تركيز بكل بساطة .


انحن إلى الخلف - عندما يمكنك - بين الحين والحين ، وأغلق عينك بضع لحظات.


تعلم أن ترمش باستمرار:

العديد من الأشخاص الذين تطرف أعينهم أقل من المعتاد أثناء العمل أمام الكمبيوتر، قد يعانون من عدم انسيابية الدمع على العين ، وعلى القرنية بصفة خاصة ؛ مما يؤدي إلى جفاف بالعينين وتهيجهما .


لذلك ينصح الشخص - أحيانا - باستخدام قطرات الدموع الصناعية المرطبة للعين ، كحل لهذه المشكلة ، كما ينصح بالتعود على الإرماش المستمر ، أو حتى غسل عينيه بالماء البارد عقب كل فترة من العمل.



اعدل وضع الشاشة :

ضع شاشتك على مسافة من 50 إلى 70 سنتيمترمن عينك أي على مسافة ذراع تقريبا ، وإذا وجدت أنك تنحني إلى الأمام لقراءة الأحرف الصغيرة ، فقم بتغيير الحروف للحجم الأكبر، أو غير معاينة الصفحة ، من خلال تكبير حجمها الحالي .


تأكد من الحافة العلوية لشاشتك على مستوى عينك، أو أدني منهما ، بحيث تنظر إلى الأسفل قليلا أثناء العمل .


حافظ على نظافة شاشتك ؛ حيث أن الغبار يخفف من تباين الصورة ، وقد يزيد من الوهج.


عدل لوحة مفاتيحك:

ضع لوحة المفاتيح أمام الشاشة مباشرة ، أما إذا كانت اللوحة في زاوية أو على جانب الشاشة ، فقد يجهد ذلك عينك من كثرة التحرك ، وإعادة التركيز بشكل دائم.

استعمل النظارات الملائمة عند الضرورة:

إذا كنت من مستعملي النظارات أو تضع العدسات اللاصقة ، تأكد من ملاءمتها لعمل الكمبيوتر، ومسافة القراءة بوضوح على سطح الشاشة .

nosa_aic
10 - 01 - 2012, 00:00
من الأخطاء الشائعة تناول الفاكهة بعدالوجبات الغذائية‏

لذلك يجب مراعاة أصول التغذية السليمة في تناولها ‏,‏ كما يقول أحد مستشاري التغذية والصحة العامة والمناعة لأن تناول الفاكهة في نهاية الوجبة أشبه بتناول جرعة من السم لأنها تدمر إنزيم بتيالين وهو إنزيم أساسي لإتمام عملية هضم النشويات‏ كذلك ذكرت جريدة الأهرام : فكما أن الفاكهة تحتاج إلى مرور بطئ إلي المعدة حتي تهضم بطريقة طبيعية ‏,‏ولكنها عندما تلتقي باللحوم تتخمر في المعدة وقد تتحول إلي كحول يعوق عملية الهضم‏,‏ وفي الوقت نفسه‏ ‏ تفقد الفاكهة كل ما تحتويه من فيتامينات وتضطرب عملية التمثيل الغذائي للبروتين‏,‏ بالإضافة إلي أن التحلل غير العادي للبروتينات ينتج عنه إنتفاخ في المعدة‏.‏


وينصح أحد مستشاري التغذية والصحة العامة والمناعة بتناول الفاكهة بعد نحو ثلاث ساعات من تناول وجبة الغذاء أوساعة قبل تناول العشاء‏,‏ أو تناول وجبة كاملة من الفاكهة‏

nosa_aic
10 - 01 - 2012, 07:53
استخدامها عشوائيا يعرض الجسم لميكروبات مستعصية (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/146099-%D8%A7%D9%84%D9%85%D8%B6%D8%A7%D8%AF%D8%A7%D8%AA-%D8%A7%D9%84%D8%AD%D9%8A%D9%88%D9%8A%D8%A9-%D8%B3%D9%84%D8%A7%D8%AD-%D8%B0%D9%88-%D8%AD%D8%AF%D9%8A%D9%86)

المضادات الحيوية.. سلاح ذو حدين (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/146099-%D8%A7%D9%84%D9%85%D8%B6%D8%A7%D8%AF%D8%A7%D8%AA-%D8%A7%D9%84%D8%AD%D9%8A%D9%88%D9%8A%D8%A9-%D8%B3%D9%84%D8%A7%D8%AD-%D8%B0%D9%88-%D8%AD%D8%AF%D9%8A%D9%86)




http://www.alwafd.org/images/news/1679571737sg4fd56h6gf.jpg


تعتبر المضادات الحيوية من أشهر الأدوية استخداماً، وقلما نجد منزلاً لا يوجد به بعض المضادات الحيوية
سواء أكانت جديدة أو قد استخدم نصفها والباقي تم تخزينه للطوارئ، أو يتطوع أحد أفراد العائلة فيقوم بدور الطبيب ويقدم العلاج للمريض أو يقوم المريض بنفسه باختيار المضاد الحيوي الذي يظن أنه ملائم له.
ويقول الدكتور أحمد الموصلي - استشاري الأنف والأذن والحنجرة -: أدى سوء الاستعمال والعشوائية في استخدام المضادات الحيوية إلى كثير من المشاكل الصحية والمضاعفات بالإضافة إلى أنها أدت لظهور أجيال جديدة من الميكروبات لم تكن معروفة لنا من قبل ولا تستجيب لأغلب المضادات الحيوية المعروفة، والمضاد الحيوي هو دواء قاتل للبكتيريا أو يقوم باعاقتها عن النمو أو التكاثر ويمكن تقسيم المضادات الحيوية الى مجموعات حسب طريقة كل مجموعة في القضاء على البكتيريا أو اعاقة نموها وتكاثرها حتى يستطيع الجهاز المناعي للجسم القضاء عليها، وعلى سبيل المثال تقوم بعض الأنواع بالتعامل مع الجدار الخارجي الواقي للبكتيريا فتصبح البكتيريا هدفاً سهلاً للجهاز المناعي أو تتفاعل بعض الأدوية مع بعض الأنزيمات الضرورية لحياة البكتيريا أو بعض الانزيمات اللازمة لنمو وتكاثر البكتيريا، وفي كل الحالات يقوم الجهاز المناعي للجسم باستكمال المهمة عن طريق بعض أنواع خلايا الدم البيضاء التي تبتلع البكتيريا وتهضمها وتقوم بعض الخلايا الأخرى بالتخلص من السموم التي أفرزتها البكتيريا، ولا تستطيع المضادات الحيوية القضاء على الفيروسات لأن الفيروسات هي بروتينات حية وليست خلية بالمعنى المفهوم وهي بالتالي لا تعيش وتتكاثر الا داخل خلية الجسم الحية لذلك لا يستطيع المضاد الحيوي القضاء على الفيروس إلا إذا قضى على خلية الجسم نفسها بالاضافة لقدرة الفيروس الطبيعية على تغيير تركيبه الجيني من فترة لأخرى وهذا يفسر فشل الطب حتى الآن في القضاء على فيروسات البرد والالتهاب الكبدي والايدز، ويضيف الدكتور أحمد الموصلي: مظاهر الاستخدام العشوائي للمضادات كثيرة ومتنوعة ومنها أن البعض يتناول مضاداً حيوياً لا لزوم له فمثلاً المريض بحساسية الأنف يعاني من عدة أعراض قد يوجد بعضها أو كلها مثل انسداد الانف ورشح مائي من الأنف، نوبات من العطاس، حكة داخل الأنف والحلق وهى تحتاج الى بعض الأنواع من الأدوية مثل مضادات الهستامين بالكورتيزون، وكذلك عند اصابة المريض بالزكام أو نزلة البرد فهو يعاني من رشح أنفي واحمرار بالأنف والعين وارتفاع في درجة الحرارة وآلام بالجسم والمفاصل والسبب في هذه الأعراض هو فيروس البرد وبالتالي لا تحتاج في العلاج لأي مضاد حيوي بل نكتفي بالمسكنات والسوائل الدافئة ونقط الأنف وفيتامين «ج» ويلاحظ هنا أنه في بعض الأحيان يكتب الطبيب مضاداً حيوياً للوقاية من او لعلاج بعض المضاعفات التي تحدث فمثلاً نزلات البرد قد يعقبها التهاب حاد بالجيوب الأنفية والحصبة مثلاً قد ينتج عنها التهاب رئوي، ومن أشهر الأخطاء في استخدام المضاد الحيوي أن يأخذ المريض النوع المتوافر بالمنزل بغض النظر عن مدى ملاءمته للالتهاب الذي يعاني منه فتعطي الأم ابنها بقية الدواء الموجود عندها من المرة السابقة فيأخذ جرعة قليلة أو دواء انتهى مفعوله أو فسد من الجو، ويرى الدكتور أحمد الموصلي ان هذا الاستخدام العشوائي للمضادات الحيوية يحمل في طياته الكثير من الأخطاء على المريض نفسه وعلى البشرية عامة فقد نتج عنه ظهور أجيال جديدة من البكتيريا المتوحشة فإذا اعطى نوع معين من المضاد الحيوي بجرعة أقل من المفروض أو كان استخدامه بطريقة غير منتظمة فسيعطي ذلك الفرصة للميكروب الموجود لمقاومة من العلاج وينتج من تكاثر الميكروبات الموجودة في ظهور جيل جديد تتميز جيناته الوراثية بالقدرة على مقاومته هذا النوع من المضاد الحيوي، ومن أخطاء المضادات الحيوية تأثيرها على الكبد والكلى والكبد وظيفته مقاومة السموم الناتجة عن أي عقار والكلى وظيفتها التخلص من هذه السموم بمعنى أن الجرعات الزائدة او المتكررة من المضاد الحيوي يمكن أن تؤذي الكبد أو الكلى أو كليهما لهذا يجب على الطبيب توخي الحذر في كتابة المضاد الحيوي إذا دعت الحاجة لتكرار واختيار أنواع معينة تكون مأمونة لمرضى الفشل الكبدي أو الكلوي هذا بالنسبة للطبيب أما المريض فيجب عليه استشارة طبيبه قبل تناول أي دواء.

nosa_aic
10 - 01 - 2012, 08:59
الكل يحتاجة لمحاربة الانفلونزا


فوائد الليمون

قد ذكر الدكتور ميلون في أحدى المؤتمرات الطبية لأطباءالأسنان في الولايات المتحدة أن شراب الليمون الحامض هو دواء فعال وجيد لمنع ومعالجة الأسنان وتساقطها وقد ذكر أيضا رئيس مؤسسة الفيزيولوجي لجامعة ميلان أن الليمون الحامض مفيد جدا.
كما ذكر مؤلف كتاب(لكي تتمتع بنوم مريح) وهو من كبار الأساتذة الألمان، عليك باستعمال الليمون الحامض أو شرابه خصوصا لأصحاب المزاج لعصبي.
وأعلم أن ماء الليمون الحامض مع الماء الخالص هو من أحسن وأسلم وأنفع المشروبات الطبيعية في العالم أجمع علما أن الكثير منا أصبح يستعمل المشروبات الغازية المضرة صحيا. وشراب الليمون هو أحسن علاج لمكافحة أكثر أنواع الصداع.

إليكم بعض فوائد الليمون الحامض وهذه النصائح المفيدة

نقدمها لكم متمنين للجميع الصحة والأمان(نعمتان مجهولتان.. الصحة والأمان) والله ولي التوفيق وهو الشافي والواحد الأحد...
الفوائد-
عند اصابتك بزكام شديد أخلط ماء الليمون الحامض مع قليل من العسل وماء مغلي(حار) واشربه قبل الفطور(على الريق ).

رفع كافة أنواع الحمى الفايروسية أستعمل ماء الليمون الحامض كشراب أو مع أوراق اللهانة أوالشلغم أو الخضروات.

من المفيد إستعمال ماء الليمون الحامض مع مختلف أنواع(السلاطة) بدلا من الخل الطبيعي أو الكيمياوي وهو مضر للدم كذلك الذين يعانون من مرض الكلى بإمكانهم الإستفادة من ماء الليمون الحامض.

لمعالجة ومكافحةاليرقان وأمراض الكبد. إستعمال الليمون الحامض مفيد جدا.


لمعالجة غلظةالحليب لدى الأم المرضعة من المفيد جدا إستعمال ماء الليمون الحامض.

إنماء الليمون الحامض يزيد من ترشحات غدد اللعاب في الفم ويقتل المكروبات وهو معقم جيد للفم

أن ماء الليمون الحامض يكثر من الإدرار ويقضي على ترسباتالكلية والكبد ويزيل أوجاع وآلام العمود الفقري مع المساج.

الليمون الحامض لن يضعف المعدة والأمعاء بل يكون عاملا لتقوية جدار المعدةوالأمعاء.

الليمون الحامض يمنع من النزيف الدموي للبواسير ويمنع من عدم جريان الدم

الليمون الحامض مفيد جدا لطرد السموم من الدم والقضاء علىنسبة الكلسترول(الدهون) ولإزالة البثور من الجسم ومن فروة الرأس والشعر .

الليمون الحامض عامل مساعد على فتح الشهية للأكل ويساعد على عمل الجهاز الهضمي بصورة جيدة وكثير من الأطباء يوصون بإستعماله لمعالجة عدم الشهية.

لعلاج عدم التعرق أو الذين يصابون بحبيبات حمراء على بشرة الجسم أو ظهور بعض الشامات الصغار في الجسم أو بعض البقع يمكنهم علاجها بشراب الليمون الحامض يخلط مع العسل فهو أحسن شراب طبيعي وجيد.


لجمال لون جلد الجسم من المفيد إستعمال نصفين من الليمون الحامض كمساج على الجسم صباحا قبل أخذ(دوش حمام) وقبل أخذ حمام الشمس فإذا ما عملنا بهذه النصائح فستعيد الحياة لمسامات الجسم لتعمل بإنتظام وبصورة جيدةوبذلك سنطرد سموم كثير من أجسامنا.

nosa_aic
10 - 01 - 2012, 09:03
إستعمال الليمون الحامض يزيل الإسهال والإسهال الدموي والنزيف الرئوي(نزف الدم).


إستعمال الليمون الحامض يمنع من تساقط الشعر والصلع ويقوي الشعر بإستعماله كمساج.


الليمون الحامض غذاء بارد وشراب طبيعي من أحسن المشروبات صيفا وشتاء وأفضل وأنفع من المشروبات الغازية والصناعية المنتشرة بين الناس نتيجة الإعلانات والدعايات علما أنهامضرة


المصابون بآلام المفاصل وتصلب الشرايين إذا إستعملوا يوميا اللمون الحامض فسيشفون إن شاء الله.

أن الليمون الحامض خير علاج للدوخة(الدوار ) وحالات التهوع(التقيء).

الذين يشكون من أمراض القلب ورماتيزم القلب ليهم بإستعمال الليمون الحامض فهو مفيد لهم.


إستعمال الليمون الحامض يمنع من بعض الأمراض التناسلية لدى الرجال والنساء ويساعد على تقوية المواد المنوية(النطفة)


الذين يستعملون كثيرا اللحم والسمك يجب عليهم إستعمال الليمون الحامض أو عصيره قبل الفطور صباحا(على الريق).

الليمون الحامض علاج مفيد لقلة النوم والإحتلام الليلي


ماء الليمون الحامض نافع لرفع ضيق التنفس وآلام الظهر وعرق النساء ويمنع من الشيخوخة المبكرة وهو مصفي للدم.

إذا وضعت قطرة واحدة من ماء الليمون الحامض كل ليلة في عينيك،سيزداد بريقها ويزيد في جلاء ناظريك.


لقد إستعمل الليمون الحامض كعلاج أكثر من300 مورد من الحمى المروبية داخل معسكرات أسرى الحرب الداخلية في أسبانياوقد تم شفائهم.

الليمون الحامض فاكهة طبيعية تساعد على عملية التنفس وتجعله طبيعيا لأن وجود الأكسجين الكيمياوي في ماء الليمون الحامض عند إستعماله ودخوله إلى خلايا أجسامنا تزيد من عملية التنفس الطبيعي وتمنحنا الحياةالجديدة.


أبرش الليمون الحامض(قشره الخارجي) مع العصير أو اللباب واخلطه مع(سلطة الخضروات) فهو مفيد ونافع.

ورد الكتاب القديم(طب الفقراء) يوصيب معالجة المرضى بالليمون الحامض وأن يبدأ بليمونة واحدة إلى أن تصل إلى عشرين ليمونة، على أن يعيد الكرة عدة مرات لفوائده المتعدده.

هذه فوائد الليمون لكن من وجهة نظري لا يجب الاكثار منه فكل شيء زاد عن حده انقلب الى ضده لأنه يقال أن شرب عصير الليمون حامض على الريق أو تكون جائع أو لم تأكل جيدا يضر المعدة و يضعف القلب

nosa_aic
11 - 01 - 2012, 16:51
ماهو سر مواعيد الدواء.....؟


* - كثيرا ما نلاحظ في [ روشَتة الطبيب ] عبارة قبل الاكل وبعد الكل مكتوبة بعد اسم الدواء

ويجب على المريض الا يتهاون في تنفيذ هذا الكلام المكتوب

لانه على اساس علمي سليم ويؤدي الاخلال بتنفيذه الى حدوث بعض الاضرار للمريض

او التقليل من فاعليته او عدم الاستفادة منه ،,

اما لماذا قبل الاكل ولماذا بعد الاكل ؟

فالسبب هو :

{ هناك الكثيرمن الادوية اذا دخلت المعدة وهي فارغة ( قبل الاكل )

فانها تسبب التهابات زيادة الحموضة واحيانا الغثيان والقيىء

وفي حالة الاستمرار في ذلك تؤدي الى حدوث قرحة بلمعدة .

ومن هذه الادوية : اقراص السلفا - والكورتيزون - ادوية الرومتزيم... الخ .. }

لذلك يجب الالتزام بضرورة تناول هذا الدواء[/URL] بعدالاكل .


وهناك بعض الادوية الهاضمة او التي تستعمل في علاج اضطرابات الجهاز الهضمي.


وهنا يكتب الطبيب عبارة ((اثناء الاكل او بعد الاكل )) لماذا؟


فالسبب هو :

{ نقول كيف تاخذ دواءا هاضما على معدة ليس فيها ما يهضم ..

لا تقل اني ساتناول طعامي بعد نصف ساعة .. لان الدواء[URL="http://www.libyanyouths.com/vb/t20701.html"] (http://www.libyanyouths.com/vb/t20701.html) لا ينتظر داخل معدتك

ولكنه سيتحرك الى اماكن بعيدة لا يجدي فيها مفعوله .

اما الاقراص التي تعالج مرض السكر اذا تم تناولها قبل الاكل بفترة طويلة

فانها تحدث نقصا في [معدل السكر] في الدم يؤدي في بعض الحالات الى [الاغماء] }

لذلك يجب ان تؤخذ هذه الاقراص اثناء الاكل او بعده.



والادوية الفاتحة للشهية لا بد من تناولها قبل الاكل

لان اخذها بعد الاكل لن تكون له فائدة ...

لكل دواء سبب في تحديد موعد تناوله

((قبل او اثناء او بعد الاكل )) يجب الالتزام به مهما كانت الظروف

مع تمنياتي لكم بدوام الصحه والعافيه..

nosa_aic
11 - 01 - 2012, 17:00
http://im20.gulfup.com/2012-01-09/1326120580491.jpg (http://www.gulfup.com/show/xb65oqm782xa)


السلام عليكم ورحمة الله وبركاته

الى كل ام واب واخ واخت .. لا تقذفوا الاطفال في الهواء
كثيرا ما يعمد بعض الأباء الى قذف الرضيع في الهواء
كنوع من انواع التدليل ويكرر الأب ذلك كلما تعالت ضحكات الصغير
وعلا ضجيجه... ويعيد قذفه الى ارتفاعات اكبر وبقوة اكبر
ولكن الطب يحذر من هذا النوع من التدليل .
ويقول أحد اطباء الأطفال :
يجب ان نكون حذرين عند تدليل الطفل بهذا الشكل ونحرص
على سنده بأيدينا من تحت ابطيه وهو يرتفع فى الهواء
وأكثر ما نخشاه هو السقوط المفاجئ والقوي للطفل
حتى ان كان هذا السقوط على ذراعي الأب .فقد اكتشفنا عدة حالات مصابة باورام دموية
بين الأغشية الدماغية ويصاب الأطفال عادة بهذه الأورام بعد السقوط اثناء ممارسة هذه الألعاب العنيفة
او بسبب الأهتزازات القوية التي تحدث للطفل بسبب هذه الألعاب
فالطفل يظل هشا حتى يبلغ العام الأول من عمره كما انه يظل
حساسا للانخفاض السريع في الضغط ,لذلك ننصح بتجنب مثل
هذه الألعاب العنيفة مع الطفل حتى يشتد عوده.
اذا فلنجد طريقة اخرى ندلل بها اطفالنا.

اميره اميره
11 - 01 - 2012, 18:45
الزبيب يمنع من تسوس الاسنان ووقوعها



http://www.news-all.com/up/2006/upload/news-all.com_1785510.jpg
وجد باحثون أميركيون بديلاً صحياً عن الوجبات الخفيفة الغنية بالسكريات، وهو الزبيب الذي يقولون إنه قد يقي الأسنان من التسوّس. وقال الباحثون إنه بالإضافة إلى ما يحتويه الزبيب من حامض الكربوليك والحديد والفلافونويد (مجموعة مركبات عضوية قابلة للانحلال في الماء)، فهو يحتوي أيضاً على مضادات للجراثيم يمكن أن تقضي على أمراض الأسنان.
وأوضحوا أن حمض الأوليانوليك الموجود في الزبيب أظهر فعالية في القضاء على أمراض غشاء الأسنان.
ووجد الباحثون أن الزبيب يساهم بشكل إيجابي في إعادة المعادن إلى جذور الأسنان المتضررة ومن الممكن أن يكون عاملاً طبيعياً في علاج التسوّس. وافترض الباحثون أن الزبيب يحتوي على مواد كيميائية مضادة للميكروبات قادرة على التخلص من الجراثيم الموجودة في الفم، والتي لها علاقة بالتسوس أو بأمراض اللثة وبالتالي فهو مفيد لصحة الفم. يشار إلى أن نتائج الدراسة مفصلة في ملحق خاص في مجلة "التغذية".

kot
11 - 01 - 2012, 19:44
https://lh5.googleusercontent.com/-7W3AtvELxNc/TnwpPLVwRqI/AAAAAAAAVmc/ovPm44tcq9g/s400/462-www.ward2u.com-Glitter-Arabic.gif (https://lh5.googleusercontent.com/-7W3AtvELxNc/TnwpPLVwRqI/AAAAAAAAVmc/ovPm44tcq9g/s400/462-www.ward2u.com-Glitter-Arabic.gif)

nosa_aic
11 - 01 - 2012, 20:44
دراسة: الأطفال الذين يرضعون طبيعيًا أقل فرحًا (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/147262-%D8%AF%D8%B1%D8%A7%D8%B3%D8%A9-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84-%D8%A7%D9%84%D8%B0%D9%8A%D9%86-%D9%8A%D8%B1%D8%B6%D8%B9%D9%88%D9%86-%D8%B7%D8%A8%D9%8A%D8%B9%D9%8A%D9%8B%D8%A7-%D8%A3%D9%82%D9%84-%D9%81%D8%B1%D8%AD%D9%8B%D8%A7)



http://www.alwafd.org/images/news/923299086agggg.jpg





أظهرت دراسة جديدة أن الأطفال الذين يتناولون غذاءهم عن طريق الرضاعة الطبيعية يبكون أكثر ويضحكون ويبتسمون أقل، ويصعب تهدئتهم وجعلهم ينامون، مقارنة بأقرانهم الذين يتناولون غذاءهم عن طريق زجاجة الحليب الخاصة بالأطفال.
وذكرت صحيفة بريطانية أن الباحثين في جامعة كامبريدج وجدوا أن هذه الحدة في الطباع المرتبطة بالرضاعة الطبيعية هي طبيعية، ولا تشكل مؤشراً على الإجهاد النفسي أو حتى بالضرورة على الجوع، لكنها هي طريقة للطفل لاستقطاب الإنتباه والشعور بالأمان.
وتبيّن أن الأطفال الذين يتناولون الحليب عن طريق الزجاجات الخاصة، يبدون أكثر فرحاً فهم قد يكونون تناولوا الكثير من الغذاء، كما يشعر الراشدون بالراحة والإسترخاء بعد الأكل كثيراً.
وراقب العلماء أكثر من 300 رضيع في عمر 3 أشهر، وسُئلت أمهاتهم عن ردات فعلهم أثناء الإستحمام أو لبس الثياب وسهولة نومهم.
وظهر اختلاف بسيط بين الإناث والذكور، والوضع الإقتصادي والإجتماعي للأهل وسن الأم، لكن تبيّن رابط واضح بالنسبة لسهولة النوم وردات فعل الأطفال، وطريقة الرضاعة.
وقال الباحث المشارك في الدراسة كين أونج، إن بكاء الطفل الذي يرضع طبيعياً لا يعني بالضرورة أنه جائع، لكنه قد يكون بكل بساطة يسعى للراحة وليكون أكثر قرباً من أمه.
وأضاف أن الشيء الذي قد يحدث فارقاً بالنسبة للأطفال الذين يرضعون عن طريق الزجاجات الخاصة، قد يكون تناولهم كميات غذائية أكثر مما يعد نموذجياً.

nosa_aic
12 - 01 - 2012, 23:02
علاج جديد لمرض تصلب شرايين الأرجل


http://www.myelaph.com/elaphweb/Resources/images/Health/2010/12/week4/img%282%29.jpg (http://www.libyanyouths.com/vb/t126040.html)

يعتبر تصلب الشرايين (atherosclerosis) مرض يصيب الشرايين الكبيرة والمتوسطة الحجم، عادة. وهو يحدث عند تجمع بعض المواد، مثل المواد الدهنية والكولسترول وفضلات الخلايا، على الجدار الداخلي للشرايين ويجعلها أكثر سمكاً. يسمى هذا التجمع بالصفائح التي يمكن أن تنمو بصورة تجعل الشريان أكثر سمكاً من الطبيعي، وأقل مرونة أي متصلب. ما يقلل من معدل سريان الدم داخل الشرايين، ومن ضمنها تلك المغذية للأرجل التي يتطلب الأمر بترها، في بعض الحالات، لتفادي الاصابة بالغرغرينا المميتة.
في الوقت الحاضر يقود باحثون من أميركا وسويسرا تقنية اختبارية علاجية جديدة، واعدة جداً ومحدودة الجراحة، يمكن للمسنين، كما الشباب، الخضوع لها، تدعى "ديب" (Deb) أي (drug eluting balloon). تعتمد هذه التقنية على ادخال كرة(بواسطة القسطرة) الى شريان الرجل المسدود أي الذي لا يصله الدم المغذي بما فيه الكفاية. هذا ويتم "طلي" هذه الكرة الطبية الصغيرة بدواء يدعى "باكليتاكسيل" (Paclitaxel). يعمل الجراح على تمرير هذه الكرة، المغلفة بالدواء، على جدار الشريان المسدود لمدة عشر ثواني تقريباً. هكذا، يمتص جدار الشريان هذا الدواء بالكامل.
يلعب دواء "باكليتاكسيل"، الذي يمتصه جدار الشريان، دوراً مضاداً لتكاثر الخلايا الموجودة عل جدار الشريان المسدود. اذ بعد أن تتمكن الكرة الطبية من توسيع قطر الشريان، تبدأ خلايا الأخير، عادة، بالتكاثر والهجرة الى منطقة أخرى في الرجل. ما يعني أن الشريان، الذي تم توسيعه بواسطة القسطرة، سيعود الى الانغلاق مجدداً. بيد أن هذا الدواء يشل عملية التكاثر هذه. كما لا يجد الجراح ضرورة في زرع دعامة معدنية "ستينت"، داخل الشريان المسدود، كما كان يحصل في السابق. وهذا من شأنه مؤازرة العلاجات التي تستند على إعطاء المرضى الأدوية المذيبة لتراكم الصفائح على جدار شرايين الأرجل.

nosa_aic
13 - 01 - 2012, 06:41
ما الأخطاء الشائعة لدى مريض فيروس سى ؟

http://img.youm7.com/images/NewsPics/large/s8201120164256.jpg

يوضح الدكتور مدحت الشافعى أستاذ المناعة والروماتزم بطب عين شمس، أن هناك العديد من الأخطاء الشائعة التى يقع فيها مريض فيروس سى منها

1- عدم الالتزام فى العلاج.
2- ممارسة بعض العادات الخاطئة كالتدخين أو شرب الخمور أو تناول أدوية بدون استشارة الطبيب.
3- الرفض لأخذ عنيه من الكبد لو أنها ضرورية لتقييم الخلل الخلوى ودرجة التليف والالتهاب المزمن.
4- الحالة الاقتصادية للمريض قد ترغمه على التوقف عن الاستمرار على العلاج أو يغير نوع الانترفيرون، بحيث يرفض الاستمرار فى العلاج أو أن هناك عدم استجابة للعلاج.
وعلى الجانب الآخر، يشير دكتور مدحت إلى أن هناك بعض

الأخطاء التى يجب أن يتجنبها الطبيب عند علاج مريض التهاب الكبدى الوبائى من بينها:

- عليه أن يختار المريض المناسب للعلاج بالإنترفيرون.
- أن يعطى الجرعة المناسبة من الريبافيرين طبقاً لوزن المريض ويتجنبه فى حالة الفشل ويتابع أى تكسير فى كرات الدم الحمراء.
- أن يتابع مريضه ويتابع استمراره على العلاج.
- يتابع العوامل الخطرة التى تزيد من تفاقم حالة المريض مثل السمنة والسكر والكتلة الجسدية والاكتئاب وغير ذلك.
– ولابد من استعادة وزن المريض المثالى قبل بدء العلاج بالإنترفيرون.
- يتابع صورة الدم فى صورة الاينميا ونقص كرات الدم البيضاء، ويعطى عوامل البناء والنمو المناسبGrourh Falters ولا يعنى حدوث ذلك التوقف عن العلاج، بل يجب أن يستمر بعد تحسن صورة الدم.
- يعطى الجرعة المناسبة من الانترفيرون بعيداً عن العوامل الاقتصادية.
- لابد من الالتزام بفترة العلاج ومن ثم يحدد مدى استجابة المريض.
- قد يتطلب الأمر اللجوء لنوع آخر من الإنترفيرون فى حالة عدم الاستجابة للنوع الأول، مثلاً فى حالة عدم استجابة المريض عليه أن يبدأ محاولة العلاج مرة أخرى.
- لابد من تقييم جماعى لمراكز العلاج لمدى استجابة نوعية معينة للإنترفيرون فى العلاج ومن ثم يعمم الاستخدام من عدمه.
- الحرص على نقل الإنترفيرون بصورة آمنة وكذلك تخزينه وتلاحظ تاريخ الصلاحية.
- يبتعد الطبيب عن استعمال الإنترفيرون المغشوش ويجب علية أن يكون متابعا لأى خلل مناعى، خاصة من الغدة الدرقية.
- لايستبعد الريبافيرين من خطة العلاج، لأنه مع الإنترفيرون يعطى نتائج عالية.

اميره اميره
13 - 01 - 2012, 08:40
http://www.3thra.com/imgcache/67660.imgcache.gif

boomakady
13 - 01 - 2012, 14:48
http://im15.gulfup.com/2012-01-13/1326458750741.jpg (http://www.gulfup.com/show/Xb7z4zybqtm3)

nosa_aic
13 - 01 - 2012, 16:15
http://www.3thra.com/imgcache/67660.imgcache.gif


http://im15.gulfup.com/2012-01-13/1326458750741.jpg (http://www.gulfup.com/show/Xb7z4zybqtm3)


جمعة مباركة ان شاء الله

و بارك الله فيكم



:cgiving:

nosa_aic
13 - 01 - 2012, 18:49
استخدام الاعشاب لعلاج التهاب المفاصل لا تدعمه الادلة الطبية (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/147918-%D8%A7%D8%B3%D8%AA%D8%AE%D8%AF%D8%A7%D9%85-%D8%A7%D9%84%D8%A7%D8%B9%D8%B4%D8%A7%D8%A8-%D9%84%D8%B9%D9%84%D8%A7%D8%AC-%D8%A7%D9%84%D8%AA%D9%87%D8%A7%D8%A8-%D8%A7%D9%84%D9%85%D9%81%D8%A7%D8%B5%D9%84-%D9%84%D8%A7-%D8%AA%D8%AF%D8%B9%D9%85%D9%87-%D8%A7%D9%84%D8%A7%D8%AF%D9%84%D8%A9-%D8%A7%D9%84%D8%B7%D8%A8%D9%8A%D8%A9)



http://www.alwafd.org/images/news/1521327590ubtobdkr.jpg


شددت دراسة طبية على أنه لا توجد دلائل طبية كافية على الاستعانة بطب الاعشاب فى علاج إلتهاب المفاصل .
ويعد مرض التهاب المفاصل وهشاشة العظام من الامراض التى تصيب العظام والمفاصل وتسبب آلما كبيرا للمرضى بسبب تلف المادة الجيلاتينية بالمبطنة للغضاريف والمفاصل والتى تصبح الاشد ألما فى أطراف المفاصل والاصابة ومنطقة الركبة.
واوضح الباحثون أنه على الرغم أن التحسن الوقتى الذى يسهم فيه طب الاعشاب لآلام بين مرضى إلتهاب المفاصل وهشاشة العظام إلا أنه لم يثبت فاعلية طب الاعشاب فى شفاء مثل هذه الامراض بصورة فعالة .

Osama_720
13 - 01 - 2012, 21:10
"حبة البركة".. علاج جديد يتصدى لتليف الكبد والتسمم الكلوي (http://www.klmty.net/2012/01/blog-post_2062.html)
13/01/2012
نجح فريق علمي مصري في التوصل إلى علاج جديد مستخلص من زيت حبة البركة لمواجهة تليف الكبد والتسمم الكبدي الكلوي.
وقالت د. منال عبد العزيز أستاذ الكيمياء العلاجية بالمركز القومي للبحوث في القاهرة وأحد أعضاء الفريق العلمي في تصريحات لموقع mbc.net: "نجحنا بالتجارب في التوصل إلى أن زيت حبة البركة الخالي من أى إضافات يساعد في علاج كثير من الأمراض المتعلقة بالكبد والكلى، خاصة الناتجة عن تسمم العضويين المهمين".
http://3.bp.blogspot.com/-QB6_JLWBnHU/Tw8UJ-wG40I/AAAAAAAACZ8/03t-E14BQ28/s320/d9b8898e17e3affe05786789b762515c_lm.jpg (http://3.bp.blogspot.com/-QB6_JLWBnHU/Tw8UJ-wG40I/AAAAAAAACZ8/03t-E14BQ28/s1600/d9b8898e17e3affe05786789b762515c_lm.jpg)


وأوضحت د. منال: "فقد قمنا بدراسة قدرة الزيت على مواجهة الضرر الناتج على كبد وكلى فئران التجارب بعد تعرضها للتسمم ببروميد البنزين.. وتم تقدير أنزيمات وظائف الكبد، كما تم قياس مؤشرات وظائف الكلى ومؤشرات انتقال الأملاح عبر الخلايا، وكذلك الدهون الفوسفاتية".
واستطردت قائلة: "وخلصنا من التحارب إلى أن العلاج بزيت حبة البركة يعمل على تحسين مضادات الأكسدة وأنزيمات وظائف الكبد والكلى، كما خفض نسبة التليف وحدث تحسن في تراكيب الكبد والكلى.. كما ساعد الزيت في الإسراع من عملية حماية الكبد والكلى من مضاعفات المرض وتأخير تطوره".
وأشارت إلى أنه: "من المقرر في الخطوة المقبلة أن يستخلص فريق البحث المواد الفعالة في زيت حبة البركة حتى يتسنى للصيادلة تحويلها إلى دواء متوفر في الصيدليات في صورة حبوب أو سائل".
وعن أسباب اختيار حبة البركة بالذات، قالت: "قررنا إجراء البحث على حبة البركة لوردها في السنة النبوية عن أنها دواء عام لكل الأمراض، ولكونها تستخدم بالفعل في علاج كثير من الأمراض مثل الصداع والنزلة الأنفية وألم الأسنان والديدان المعدية، وغيرها الكثير والكثير من الأمراض".
المصدر/http://www.klmty.net/2012/01/blog-post_2062.html

nosa_aic
14 - 01 - 2012, 11:58
رائحة التفاح تخفف من حالات التوتر


أكدت الابحاث الطبيه أن بعض الروائح الطبيعية تساعد في تخفيف حالات التوتر ..
التي يعاني منها الكثيرون وأفاد الباحثون في مؤسسة شيكاغو لبحوث الرائحه والتذوق ..

ان أهم هذه الروائح وأكثرها فاعليه عند الاصابة بالتوتر هي رآئحــة التفـآآح الأخضر أو الأحمر وإضافة إلى الفيتامينات والعناصر الغذائية المهمة في رآئحـة التفـآآح ..
فأنه يتميز بأن رآئحـته تزيد من نشاط موجات الانف فتخفف من حدة القلق والتوتر وتقلل حالات الاصابه بالصداع النصفي ..

وقال الخبـرآء : ان تناول التفاح وإستنشاق رائحتة او إستعمال أنواع الصابون و الشامبو التي تحتوي على هذه الرائحة تشعر الفرد بالراحة النفسيـة و المعنوية ..

nosa_aic
14 - 01 - 2012, 12:09
إدمان الانترنت يعطل إداء الروابط العصبية بالمخ (http://www.alwafd.org/%D8%B9%D9%84%D9%88%D9%85-%D9%88%D9%86%D9%83%D9%86%D9%88%D9%84%D9%88%D8%AC%D 9%8A%D8%A7/147916-%D8%A5%D8%AF%D9%85%D8%A7%D9%86-%D8%A7%D9%84%D8%A7%D9%86%D8%AA%D8%B1%D9%86%D8%AA-%D9%8A%D8%B9%D8%B7%D9%84-%D8%A5%D8%AF%D8%A7%D8%A1-%D8%A7%D9%84%D8%B1%D9%88%D8%A7%D8%A8%D8%B7-%D8%A7%D9%84%D8%B9%D8%B5%D8%A8%D9%8A%D8%A9-%D8%A8%D8%A7%D9%84%D9%85%D8%AE)



http://www.alwafd.org/images/news/13867607825tr4uxo5.jpg




أظهرت دراسة طبية حديثة أن الاشخاص الذين يعانون بمايعرف من بظاهرة"إدمان الانترنت" خاصة من المراهقين هم الاكثر عرضة للمعاناة من تعطل واختلال روابط المخ العصبية بالاضافة إلى تعرض "المادة البيضاء" بالمخ إلى تغيرات غير طبيعية .
وأوضح "جونثان واليس"أستاذ المخ والاعصاب بجامعة"كاليفورنيا والمشرف على تطوير الابحاث أنه مايزال غير واضح ما إذا كانت هذه التغيرات السلبية التى تطرأ على روابط المخ العصبية عن إدمان الانترنيت
أو بفعل عوامل عصبية أخرى حيث تظل هذة النظرية محل جدل وبحث بين العديد من العلماء فى الوقت الذى لم تتوصل فيه العديد من الابحاث الطبية التى أجريت فى هذاالصدد إلى علاج فعال للادمان الانترنت فى ظل تضارب التشخيص.
يأتى ذلك فى الوقت الذى يرى فيه الكثير من الباحثين وأطباء المخ والاعصاب على صحة ودقة الابحاث فى هذاالصدد حيث أن مناطق المخ موضع الدراسة هى نفسها المناطق المسئولة عن الادمان والسلوكيات الاندفاعية والتى يزيد فيهاالنشاط عند قضاءالشخص لساعات طويلة أمام الانترنت.
وكان الباحثون قد قاموا بإخضاع نحو 17 متطوعا من البالغين ومدمنى الانترنت للاشعة المقطعية للمخ والذين عانوا من الاكتئاب وسرعة الانفعال وسعوا بشتى الطرق الاقلاع عن أدمان الانترنت والبقاء لساعات طويلة أمام الكومبيوتر ولم ينجحوا.
وأشارت صورة الاشعة المقطعية إلى وجود اختلافات متبانية فى المادة البيضاء فى المخ لدى مدمنى الانترنت بالمقارنة بالاشخاص الذين لايعانون من هذة العادة السلبية وهو ما قد يتسبب فى خلل فى وظائف الروابط العصبية بالمخ .

nosa_aic
15 - 01 - 2012, 05:48
احذروا .. التهابات المعدة مرتبطة بالتغيرات المناخية (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/148264-%D8%A3%D8%AD%D8%B0%D8%B1%D9%88%D8%A7-%D8%A7%D9%84%D8%AA%D9%87%D8%A7%D8%A8%D8%A7%D8%AA-%D8%A7%D9%84%D9%85%D8%B9%D8%AF%D8%A9-%D9%85%D8%B1%D8%AA%D8%A8%D8%B7%D8%A9-%D8%A8%D8%A7%D9%84%D8%AA%D8%BA%D9%8A%D8%B1%D8%A7%D 8%AA-%D8%A7%D9%84%D9%85%D9%86%D8%A7%D8%AE%D9%8A%D8%A9)

ربطت دراسة طبية بين التهابات وأمراض المعدة وبين التغيرات المناخية حيث تشير البيانات إلى معاناة ما يقرب من 4ر1 مليون أمريكى من أمراض المعدة المختلفة. وأوضحت الأبحاث أن التغيرات المناخية قد تعمل على إصابة الانسان بنوبات إسهال وآلام فى المعدة يصاحبها ارتفاع فى الحرارة فى بعض الأحيان ونزيف شرجى قد يتطلب معه التدخل الجراحى.
وكانت الأبحاث قد اعتمدت على مراجعة وتحليل بيانات نحو 238 ألف سيدة تراوحت أعمارهن ما بين الخامسة عشرة والثلاثين عاما تم تتبعهن منذ عام 1976 حيث أشارت المتابعة إلى أن 52 % منهن كانوا من عدد من أمراض المعدة المختلفة مع تعاقب الفصول فى الوقت الذى عانت فيه نحو 38 % منهن بأمراض قرحة المعدة.

nosa_aic
16 - 01 - 2012, 16:15
علماء يحددون حاسة سادسة لدى البشر لتذوق الدهون (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/149338-%D8%B9%D9%84%D9%85%D8%A7%D8%A1-%D9%8A%D8%AD%D8%AF%D8%AF%D9%88%D9%86-%D8%AD%D8%A7%D8%B3%D8%A9-%D8%B3%D8%A7%D8%AF%D8%B3%D8%A9-%D9%84%D8%AF%D9%89-%D8%A7%D9%84%D8%A8%D8%B4%D8%B1-%D9%84%D8%AA%D8%B0%D9%88%D9%82-%D8%A7%D9%84%D8%AF%D9%87%D9%88%D9%86)



http://www.alwafd.org/images/news/219386590fghfghf.jpg





وجدت دراسة جديدة أن بعض البشر قد يتمتعون بحاسة ذوق سادسة هي للدهون عدا عن تلك المتعلقة بالمالح والحلو والمر والسائغ، وأن الذين يفتقرون لها هم أكثر عرضة لزيادة الوزن.
وذكر موقع علمي بريطاني أن علماء أميركيين بجامعة واشنطن للطب استطاعوا تحديد مستقبِل بشري يمكنه تذوّق الدهون.
وتعد هذه الدراسة الأولى من نوعها التي تعطي دليلاً يظهر أن البروتين CD36 الموجود على سطح كثير من أنواع الخلايا لدى البشر والفئران وحيوانات أخرى، مرتبط بتذوق الدهون.
ووجدت الدراسة أن التنوع في جين CD36 يمكن أن يجعل الأشخاص أكثر أو أقل تحسساً تجاه تذوق الدهون.
وقالت الباحثة المسؤولة عن الدراسة ندى بو مراد إن الهدف الأساسي هو فهم كيف أن إحساسنا بالدهون في الطعام يؤثر على الطعام الذي نأكله وكميات الدهون التي نستهلكها.
وطُلب من21 شخصاً يعانون من الوزن الزائد تذوق سوائل من 3 أكواب، والإشارة إلى السائل المختلف.
واحتوى احد الأكواب على كمية صغيرة من الزيت الدهني، فيما الآخران لم يحتويا على الدهون.
وتبيّن أن الأشخاص الذين كان لديهم كميات أكثر من البروتين CD36 كانوا أكثر تحسساً لوجود الدهون بمعدل ثماني مرات، مقارنة بمن لديهم نصفا الكمية.

nosa_aic
16 - 01 - 2012, 16:21
تقليل مرضى القلب من تناول الملح قد يضر بهم




http://www4.0zz0.com/2011/12/28/22/199310170.jpg (http://www.libyanyouths.com/vb/t123761.html)

أوضحت دراسة كندية أن امتناع مرضى القلب من تناول الملح قد يفاقم حالتهم، وأنه يجب الإكثار من تناوله وفق المعايير المعتدلة.

وقال الأستاذ المساعد في جامعة "ماك ماستر" بمدينة تورنتو الكندية مارتن أودونيل إنه قام بفحص بيانات عائدة لأكثر من 28 ألف شخص يعانون من أمراض القلب، أو من وجود خطر مرتفع للإصابة بها، واكتشف أن نسبة كبيرة منهم كانت في الأساس تستهلك كميات قليلة من الملح.

وشرح أودونيل بالقول إن النسبة المتوسطة لكميات الملح المستهلكة لدى الأشخاص الذين قام بمراجعة بياناتهم تصل إلى 4.8 ميغلرام يومياً، واتضح لديه أن خطر الوفاة جراء مشاكل القلب يرتفع بواقع 10% لدى من يستهلكون أكثر من 7 ميلغرام يومياً.

وبينت الدراسة أيضا أن من يتناول ما بين 2 إلى 3 ميلغرام يومياً من الملح يرتفع لديهم خطر الوفاة جراء مشاكل القلب بواقع 7%، وفقا لشبكة "سي ان ان" الأمريكية أمس السبت.

ورجح أودونيل أن جسم الإنسان بحاجة إلى كميات لا بأس بها من الملح، وأن خطر نقص تلك المادة في الجسم قد يعادل خطر وجودها بشكل يفوق المعدلات المطلوبة.

ونصحت دوائر الصحة الأمريكية بتناول ما لا يزيد عن 2.3 ميلغرام من الملح يومياً، كما نصحت كبار السن والأطفال والمرضى بعدم تناول أكثر من 1.5 مليغرام يومياً، في حين تشير منظمة الصحة العالمية إلى ضرورة ألا تزيد كميات الملح يومياً عن 2 مليغرام.

nosa_aic
17 - 01 - 2012, 11:18
معلومات طبية


زيت الزيتون يرفع نسبة الكولسترول المفيد في الدم ويخفض نسبة الضار

البرقوق والتفاح يستخدمان في علاج الروماتيزم.

مرض البول السكري مرض وراثي.

الليمون المغلي يفيد في علاج النحافة.

الزعتر يعالج آثار لدغة الحشرات.

زيادة نسبة البوليك في الدم قد تكون بداية الإصابة بالروماتيزم.

الإجهاد العصبي والتوتر النفسي أحد مسببات الإسهال.

تصلب الشرايين يؤدي إلى ارتفاع ضغط الدم وحدوث الجلطات الدموية.

يؤثر أكل البصل بالسلب على القدرة الجنسية.

نقص الفوسفور في الجسم يسبب إجهاداً ذهنياً ويقلل القدرة على التركيز.

يعالج ضعف الشهية بالبصل والثوم

استهلاك زيت الزيتون بكثرة يسبب الإصابة بالسرطان

البدانة نوعان غذائية وهرمونية

الإفراط في تناول البرتقال قد يؤدي إلى الإصابة بقرحة المعدة

يستخدم زيت الخروع في معالجة الثآليل

الأشعة فوق البنفسجية تحمي من الإصابة بسرطان الجلد

ارتفاع ضغط الدم يؤدي أحيانا إلى حدوث نزيف بالأنف

تؤدي زيادة نسبة الكحول في الجسم إلى ضعف نبضات القلب

التهاب الكبد مرض غير معد

التهاب المفاصل المزمن يصيب الركبتين فقط

الثوم يحمي من الإصابة بالأنفلونزا

كثرة تناول القهوة مضر لمرضى القلب والنقرس

لبن الأبقار أفضل لبن يؤخذ من الحيوانات بصفة عامة

يعالج الإصبع الداحس بأن يوضع رأس الإصبع في حبة ليمون مفتوحة.

يساعد عسل النحل على سرعة التئام الجروح

تضخم البروستات بسبب احتباس البول

الكمون ضار للمرأة المرضع

يستخدم زيت الريحان في علاج الربو والسعال الديكي

عسر الهضم يزيد من آلام الروماتيزم

مهمة الغدد الليمفاوية الدفاع عن الجسم ضد الغزو الميكروبي.

تزيد حالات الصداع النصفي بتقدم السن

يحتوي اللبن على جميع الفيتامينات.

يحدث النقرس نتيجة زيادة حمض البوليك في الدم ولا شأن له بالوراثة.

يساعد الموز على خفض ضغط الدم

التدليك بزيت الخروع يفيد في علاج التواء القدم أو الرسغ

لصق قشر البرتقال على الرأس يفيد في علاج الصداع

زيت الزيتون يعالج تساقط الشعر

لا يوجد علاج حاسم لالتهاب المفاصل

الضوضاء وارتفاع الأصوات تؤثر بالسلب على الأذن فقط

التهاب المثانة لا صلة له بالتهاب مجرى البول

انخفاض نسبة البولينا في الدم يسبب الإصابة بالفشل الكلوي

أهم الأيام في الرضاعة أول يومين لاحتواء لبن الأم فيهما على الأجسام المضادة للأمراض والبكتريا.

التمر يحافظ على النظر و يقوي الأعصاب البصرية

تساعد الرضاعة الطبيعية في عودة الرحم إلى حالته الطبيعية بسرعة.

لا ينصح بتناول اللبن مع الأطعمة البروتينية القوية

البقدونس يعالج الضيق التنفسي والتهيج العصبي.

كمية النيكوتين الموجودة في 2 سيجارة تكفي لقتل الإنسان

يعمل التمر كمنبه لحركة الرحم وقوة انقباضه أثناء الولادة

الأرق يسبب الإجهاد

التهاب اللوزتين من الممكن أن يسبب التهاب الكلي

كرات الدم الحمراء هي المسؤولة عن حمل الأكسجين لخلايا الجسم وطرد ثاني أكسيد الكربون

المشي المنتظم ينشط الغدد ويخلص الجسم من كثير من الشحوم والدهون

النزلة المعوية تصيب الكبار أكثر من الصغار

الحليب المغلي مع فصوص الثوم تميت الديدان الموجودة في الأمعاء.

البهاق عبارة عن بقع صغيرة ملونة تشبه السمسم تنتشر في الوجه

الصراخ المستمر يصيب الحلق بالالتهاب

الكتاركتا هي الاسم العلمي لمرض المياه البيضاء

الحمى أو ارتفاع درجة الحرارة ليست مرضاً في حد ذاتها إنما قناع لأمراض أخرى عديدة

قد يحتقن ورم الغدد الليمفاوية تلقائيا

القلق يزيد من حموضة المعدة ويعمل على ضعف الشهية

الموز والفراولة يساعدان في علاج النقرس

يحدث ارتفاع ضغط الدم نتيجة اتساع الأوعية الدموية

التهاب الحنجرة يكون مصحوبا دائما بالتهاب في الأنف أو البلعوم

فيتامين أ هو أهم الفيتامينات للعين

بكتيريا الشيجيلا تسبب الإصابة بالدوسنتاريا الأميبية

منقوع براعم شجرة الصفصاف يعالج النزلة الشعبية

من الممكن أن يصل طول الدودة الشريطية إلى 6 أمتار

التمر والتفاح يعالجان الضعف الجنسي

الكركديه يفيد ضعاف الكلى

الدمامل عبارة عن خراريج صغيرة

الإيدز يدمر جهاز المناعة ولكن ضعف جهاز المناعة شيء آخر ينتج عن الإجهاد الجسدي أو الفكري

التهاب الكبد يعطل وظائف الكبد

النزلة المعوية تصيب الكبار أكثر من الصغار

الكركديه والكمثرى والثوم تساعد في علاج ارتفاع ضغط الدم

قد يتأخر ظهور أعراض التسمم الغذائي بميكروب السالمونيلا إلى48 ساعة

قد يظهر حب الشباب على الظهر والصدر

الأسبرين والنوفالجين يستخدمان كمسكنات لعلاج آلام اللثة والأسنان

الأنيميا تسبب الصداع المستمر وسقوط الشعر

يحتوي اللحم على الأحماض الأمينية الأساسية التي تتكون منها أنسجة الجسم وعضلاته

استنشاق بخار الماء المغلي بالقرفة طارد للبلغم

زيادة إفراز الصفراء تسبب الإمساك

مرض ضغط الدم يمكن أن يصيب الأطفال الرضع

الثوم والبصل يعالجان قمل الرأس وبمضغ البصل أو الثوم لمدة أربع دقائق كاف لقتل جميع الميكروبات التي توجد في الفم لدرجة التعقيم

يفقد اللبن جزءا من قيمته الغذائية إذا أضيف إلى البرتقال

السواك يعالج أمراض الأسنان فقط وليس له شأن باللثة

العامل النفسي قد يكون السبب في الإصابة بالربو

لا ينصح الحوامل بالإكثار من أكل السمك أثناء فترة الحمل

الكتاركتا (المياه البيضاء)تذهب بالإبصار تماما بمجرد إصابة عدسة العين بها

يزيد الفول الأخضر من نسبة السكر في الدم

nosa_aic
17 - 01 - 2012, 11:44
سلبيات مضغ العلكة


http://sphotos.ak.fbcdn.net/hphotos-ak-snc4/hs018.snc4/34242_409033418210_177076138210_4248186_7274890_n. jpg (http://www.libyanyouths.com/vb/t43507.html)


مضغ العلكة"أكثر العادات" انتشارا التي تزيد عن عادة التدخين الضار بالصحة
والتي أصبحت جزءا من الظواهر الاجتماعية في كل أنحاء العالم".
قد حذر الاطباء من الآثار السلبية لمضغ العلكة المستمر على الفك رغم الاعتقاد السائد
...لدى الجميع بأن له فوائد سواء للهضم أو تعطير الفم أو تقوية عضلات الفك.
حيث يتم استخدام عضلات ومفاصل الفك تلقائيا في الأكل والكلام وبلع الريق اكثر من 1500 مرة يوميا و يتضمن ذلك
انقباض عضلات الفك حتى تنطبق الاسنان العلوية
والسفلية على بعضها فيما أثبتت الأبحاث أن قوة العضة الواحدة المتولدة من إطباق الأسنان
تعادل تسعة كيلو غرامات من القوة.
اما في حالة مضغ العلكة فان كمية الضغط المتولدة من هذه العضلات تكون كبيرة لدرجة
أنها تصيب الفك بالتضخم والإجهاد وعدم الراحة والشد العضلي حيث أن الأبحاث الحديثة
أثبتت أن لدى عضلات الفك ذاكرة قوية للغاية.
أن ذلك يعنى "انه إذا تم التعود على مضغ العلكة لفترة طويلة فان العضلات تستمر في
الانقباض حتى من دونها مما يتسبب عنه الجز على الأسنان حتى من دون وجود العلكة
وبالتالي تنعدم فترة راحة العضلات والمفاصل الصدغية".
هناك عدة أعراض معروفة نتيجة الجز على الأسنان تتمثل في حدوث نوبات الصداع وآلام
الرأس في أجزاء مختلفة وآلام في منطقة العنق والأكتاف بالناحية الخلفية للرقبة.
وأوضح أن من بين هذه الأعراض أيضا انقباض عضلات الفك وتضخيمها وحدوث طرقعة
بالفك أثناء مضغ الطعام وحدوث ضغط مستمر على الأذن وتغير شكل الوجه نتيجة تضخم
العضلات مع تآكل الأسنان وتفتتها وإصابتها بموجات من حساسية الأسنان للبارد والساخن
وكذلك تآكل العظام المثبتة لجذور الأسنان.
غير انه يوجد فائدة لمضغ العلكةفي بعض الأحيان كأن يوصف المضغ لعدة أيام في
حالات علاج انسداد قناة استاكيوس بالأذن أو في حالات تقوية الفك عند الإصابة بالشلل الوجهى

nosa_aic
17 - 01 - 2012, 19:44
العنب يقي من العمى (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/149679-%D8%A7%D9%84%D8%B9%D9%86%D8%A8-%D9%8A%D9%82%D9%8A-%D9%85%D9%86-%D8%A7%D9%84%D8%B9%D9%85%D9%89)



http://www.alwafd.org/images/news/1149334814b4nsojm.jpg




أظهرت أبحاث طبية حديثة أن الاكثار من تناول العنب يعمل على تأخيرالاصابة بأمراض ضعف شبكية العين والتى قد تؤدى فى كثير من الاحيان إلى فقدان البصر بسبب التقدم فى العمر، وهى الحالة المرضية التى تصيب الملايين من كبار السن حول العالم.
وأوضح باحثون بجامعة نيويورك أن أمراض شبكية العين تعد من الاعراض المرضية الاكثر انتشارا فى العالم والسبب الرئيسى لفقدان البصر بين كبار السن.
وشدد الباحثون على أن العنب الغنى بمضادات الاكسدة يتمتع بخواص الحماية والتغلب على الاثار الجانبية السلبية والضارة لأمراض الشبكية فى الكبر.
وقال الباحثون إنه فى حال استهلاك الاشخاص فى مقتبل العمر للعنب بمعدلات معقولة فسوف يساعدهم على الوقاية من مشكلات الابصار وأمراض شبكية العين فى مراحل متقدمة من أعمارهم حيث كشفت التجارب الاولية التى أجريت على فئران التجارب فى هذا الصدد فاعلية العنب فى وقايتهم من الاصابة بالعمى.

nosa_aic
18 - 01 - 2012, 05:18
"عين الجمل" منجم غنى بمضادات الاكسدة


أظهرت أحدث الابحاث أن عين الجمل يعد من أهم المصادر الغنية بمضادات الأكسدة الهامة لصحة الإنسان والتى تشكل درعا واقيا للكثير من امراض هذا العصر.
فقد توصل الباحثون إلى أن عين الجمل يعد من أكثر المكسرات فائدة لصحة الإنسان لاحتوائه على نسبة عالية من مضادات الاكسدة ليصبح أحد أفضل الاختيارات الصحية فيما يتعلق بالوجبات الخفيفة لفاعليته فى خفض مستوى الكوليسترول فى الدم .
وأوضحت الابحاث أن عين الجمل يحتوى على كميات وفيرة من مادة "بوليفينول" وهى أحد أنواع مضادات الاكسدة التى تعمل على خفض فرص الاصابة بأمراض القلب .
وتشير البيانات إلى احتواء عين الجمل على 15 ضعفا من مضادات الاكسدة وفيتامين"هـ" المتواجدة فى الأنواع الأخرى من المكسرات .

nosa_aic
18 - 01 - 2012, 23:51
http://img.youm7.com/images/NewsPics/large/s120121672729.jpg
ما هو السن المناسب لبداية النطق عند الطفل، ومتى يبدأ القلق من تأخر الكلام، ومتى يقرر الطبيب ضرورة خضوع الطفل لجلسات تخاطب؟

يجيب الدكتور طلعت حسن سالم أستاذ طب الأطفال جامعة الأزهر، وعضو الجمعية المصرية لصحة وسلامة الطفل، وعلاج سلوك الأطفال، قائلا: "بالطبع يختلف كل طفل عن الآخر بالنسبة لاكتساب جميع المهارات، ومنها المهارات اللغوية، ولكن من الممكن أن نضع بعض المعايير والمقاييس العامة، والتى يمكن من خلالها التأكد من أن الطفل يسير على الخطى السليم بالنسبة لنموه اللغوى".

فالطفل ذو التسعة أشهر يمكنه نطق كلمتين مثل "بابا وماما"، وعند إتمامه العام يتمكن من نطق خمسة كلمات، وعند العامين يتراوح قاموس كلماته من 40:20 كلمة، ومن المفضل أن يبدأ التأكد من سلامة النطق عند الطفل مبكراً، بمعنى أنه فى حالة تجاوز الطفل عامه الأول، ولم يتمكن من النطق نهائيا، فيفضل الكشف عليه والتأكد من سلامة السمع واللسان، وكذلك نموه العقلى والبدنى، وذلك لعلاج أى مشكلة تظهر مبكراً حتى لا نؤخر فرصة علاجه، وفى حال عدم وجود أى عائق، مما سبق ذكره يكون تأخره طبيعيا، ولا يستدعى القلق، وكل ما يمكن أن نقدمه له من مساعدة هو التحدث معه كثيراً، وتشجيعه على النطق.

وفى بعض الأحيان يكون تأخر الكلام مصاحباً لأمراض أخرى، مثل التوحد أو فرط الحركة أو الكهرباء الزائدة، وفى هذه الحالة يتم إتباع العلاج بجلسات التخاطب بجانب علاج هذه الأمراض.

nosa_aic
19 - 01 - 2012, 00:10
حركتين يستحيل عليك تنفيذهم .....من غرائب الدماغ




http://www2.0zz0.com/2011/12/24/17/508516463.jpg (http://www.libyanyouths.com/vb/ext.php?ref=http://www.0zz0.com)

*دائما مايحيرنا الجسم البشري في قدراته ولكن في بعض الحالات الخاصة جدا يعجز عن تنفيذ بعض الحركات البسيطة

*والأن حاول ان تخدع عقلك وجرب تنفيد هاتين الحركتين:

-الحركة الاولى :

هي عند وضع كف اليد على النضدة وثني الاصبع الوسطي تحته فيستحيل تحريك اصبع البنصر ويرجع
ذلك الى انه غيرب مستقل عصبيا بل مرتبط بالاصبعين اللذين بجواره وخصوصا اصبع الوسطى

-الحركة الثانية:

عند رفع القدم اليمنى عن الأرض والبدء بتحريكها حركة دائرية مع عقارب الساعة فأتناء التحريك قم برسم دائرة في الهواء بإصبع يدك اليمنى بإتجاه عكس عقارب الساعة أي لليسار.
لا حظ ان قدمك اليمنى بدأت تدور عكس عقارب الساعة

إذا لم تستطع تنفيذ هاتين الحركتين فلا تنزعج وآطمئن فهذا دليل على ان نصفي الدماغ
عندك يعملان بشكل سليم

nosa_aic
19 - 01 - 2012, 08:43
القهوة تساعد على التركيز والانتباه (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/150508-%D8%A7%D9%84%D9%82%D9%87%D9%88%D8%A9-%D8%AA%D8%B3%D8%A7%D8%B9%D8%AF-%D8%B9%D9%84%D9%89-%D8%A7%D9%84%D8%AA%D8%B1%D9%83%D9%8A%D8%B2-%D9%88%D8%A7%D9%84%D8%A7%D9%86%D8%AA%D8%A8%D8%A7%D 9%87)



http://www.alwafd.org/images/news/1438060988s80.jpg





قال باحثون امريكيون: إن القهوة تساعد على التركيز وتصفية الذهن، لكنها قد تسبب ألماً في الرأس.
وقال الدكتور جيمس بيب، البروفيسور المساعد في جامعة تكساس الطبية :ان الكافيين هو أقدم المحفّزات المعروفة لدى الإنسان.
وأضاف الكافيين أثبت انه دواء مفيد، ولكن في جميع الأحوال الاعتدال مطلوب كي نحصل على فوائد هذه المادة.
وأشارت الدراسة إلى أن الكافيين تحفّز الناس بطريقتين: تسهّل إطلاق مادة أستيل كولين الكيميائية التي تمنع النعاس وأيضاً تحجب نوعاً من مادة الأدينوزين المتلقّية الموجودة في جزء من الدماغ الذي يتحكّم بالتعلّم الذي يقوم على المكافأة.
ومن خلال حجب هاتين المادتين وإبقاء الدماغ منتظراً المكافأة، تبقي مادة الكافيين الناس متنّبهين،غير ان الكافيين يمكن أن ترفع ضغط القلب ما يسبب برعشة في العضلات وتزيد ضغط الدم وتدرّ البول وتجفف الماء من الدم وهو ما قد يؤثر على الأعصاب الحسية في الأم الجافية في الدماغ وهي الطبقة الرقيقة من الأنسجة التي تحيط بالدماغ وقد تسبب الصداع.
وقال بيب إن :كمية قليلة من الكافيين يمكن أن تكون مفيدة وتساعدنا على العمل بتركيز وانتباه والبقاء متيقّظين، ولكن الكثير منها قد يكون غير صحي.

nosa_aic
19 - 01 - 2012, 08:52
المضادات الحيوية... سوء استخدامها يؤدي لآثار جانبية خطيرة



http://www.mediall1.com/images/Contents/1/2147.jpg

يمتلك جسم الإنسان وسائل دفاع عديدة يكافح بها العدوى دون حاجة إلى أدوية، وذلك عبر جهازه المناعي وجلده وافرازاته المخاطية، ما يمكّنه من قهر الالتهابات، لكن حالات معينة تتطلب تناول المضادات الحيوية التي باتت شائعة جدا ومتوفرة بأكثر من 200 نوع تختلف تسمياتها باختلاف جهات تصنيعها.

وهذه المضادات مركبات كيميائية قادرة على قتل البكتيريا أو إيقاف نموها وازديادها، وتُستخرج من إفرازات بعض الفطريات والبكتيريا أثناء النمو ويمكن تحضيرها صناعياً كما يجري في الوقت الراهن.

أنواع متعددة:

ويبين الدكتور ثائر ماضي اختصاصي طب الأسرة أن للمضادات الحيوية أنواعاً من حيث قوة المفعول، فمنها واسع المفعول يستخدم لقتل أنواع كثيرة مختلفة من الجراثيم، ومنها ما يستخدم ضد أنواع خاصة قليلة من الجراثيم. أما من حيث التأثير على الميكروبات فهناك مضادات توقف نمو الميكروب وأخرى تقتله، وهناك مضادات للبكتيريا إيجابية الغرام وأخرى مضادة للبكتريا سلبية الغرام ومضادات حيوية فعالة ضد النوعين.

ومن حيث الاستخدام يلفت إلى أن بعض المضادات تؤخذ عن طريق الفم، وهو أكثر الطرق انتشاراً وتكون على شكل كبسولات وقطرات، في حين تؤخذ بعض المضادات عن طريق الحقن وهو أسلوب يتم اللجوء إليه في حالة الإصابة بالتهاب بكتيري شديد وفي حال تعذر تناول المضاد عن طريق الفم أو في حالة عدم الاستجابة بتناوله عن طريق الفم، كما أن هناك مضادات حيوية تؤخذ موضعياً كالمراهم وقطرات تعطى في حالة إصابة الجلد من الخارج أو إصابة أحد فتحات الجسم كالعين والأذن بالتهاب بكتيري.

سلبيات وآثار جانبية:

ويضيف الطبيب إنه رغم الفوائد الكبيرة للمضادات الحيوية إلا أنها تسبب كباقي الأدوية آثاراً جانبية بين الطفيفة والخطيرة حسب طبيعة جسم الإنسان وخصائص الدواء والجرعة المتناولة.

ومن الآثار السلبية للمضادات وخاصة البنسلين يقول ماضي: إنها تتمثل بالتحسس والإسهال والإقياء وحرقة المعدة والحكة والطفح الجلدي، وقد تصل المضاعفات إلى تهديد حياة المريض من خلال الهبوط الحاد بالدورة الدموية وصعوبة التنفس ما يستوجب الإسعاف السريع.

ومن سلبيات بعض المضادات الحيوية أيضاً أنها تقتل البكتيريا النافعة للجسم التي تحميه من استيطان البكتريا الممرضة، ما يضعف المناعة ويعرض الجسم لهجمات بكتيرية تؤدي لعدوى جديدة.

كما تسبب بعض المضادات ضرراً للحامل والمرضع، ومنها ما يضر بالعصب السمعي كمضاد الستريبتومايسين وقد يؤدي استعماله على المدى الطويل إلى الصمم، في حين تسبب أنواع أخرى تلون الأسنان عند الأطفال كمضاد التتراسيكلين، وتؤدي انواع كالكلورمفينيكول إلى تثبيط نقي العظم وبالتالي إلى فقر الدم ونقص الكريات البيضاء، فيما يضر بعضها بعمل الكبد والكلى، لذا ينصح المرضى في حال إحساسهم بآثار جانبية بعد تناول المضادات الحيوية بإعلام الطبيب المعالج فوراً.

سوء استخدام المضادات الحيوية:

وعن سوء الاستخدام يبين الدكتور ماضي خطورة استخدام المضادات الحيوية دون حاجة أو دون وصفة طبية، مشيراً إلى أن بعض الأطباء يصفون المضادات الحيوية لعلاج الإصابات ذات المنشأ الفيروسي كالانفلونزا رغم أن هذه المضادات ليس لها أي تأثير على الفيروسات.

كما أن عدم الانتظام في استخدام المضاد الحيوي كتعاطيه ليومين أو ثلاثة ثم إيقافه بعد الشعور بالتحسن، أو تناول جرعات زائدة من تلقاء النفس يعتبر من نماذج سوء استخدام المضادات الحيوية.

ويحذر الطبيب من استخدام المضاد الحيوي لفترات طويلة متكررة دون عمل الاختبارات اللازمة للتأكد من حساسية الميكروب للمضاد المستخدم، كما حذر من اختيار المضاد غير المناسب لافتاً إلى أنه في أغلب الأحيان يتم تعاطي المضاد عشوائياً دون إجراء اختبار يحدد الدواء الأنسب للميكروب المسبب للمرض.

ويلفت الدكتور ماضي إلى أن دولاً عديدة حظرت الاستعمال غير العلاجي للمضادات الحيوية لأغراض ذات علاقة بتسريع نمو النبات والحيوانات والطيور.

وأضاف أن الاستخدام السيئ للمضادات الحيوية أدى لظهور أنواع جديدة من البكتيريا المقاومة للأدوية، والتي أسرف المريض في استخدامها دون إشراف طبي حيث باتت البكتيريا تتعرف على آلية عمل المضادات وتعمل على تفادي مفعولها لتبدأ مساراً جديداً للنمو والتكاثر بوجود المضاد الحيوي ما يؤدي إلى فقدان السيطرة على العدوى بسبب عدم فعالية المضادات.

نصائح:

ويشير إلى بعض النصائح حول الاستخدام الأمثل للمضادات الحيوية كالالتزام بالجرعة الموصوفة وأوقاتها وإتمام مدة العلاج الكافية، وتناول كمية مناسبة من السوائل عند استخدام الأدوية عموماً والمضادات الحيوية خصوصاً ولاسيما اللبن الذي يوصى به أثناء فترات العلاج للتقليل من الآثار الجانبية على الجهاز الهضمي، مبيناً أنه عند تعاطي المضاد على شكل كبسولات يجب بلعها كاملة وعدم فتح محتوياتها أو مضغها لأن هذا يؤثر على امتصاص الدواء وفعاليته.

وعن المضادات الحيوية الخاصة بالأطفال يوضح ماضي أنها تكون على هيئة شراب أو مسحوق يضاف إليه الماء ليصبح جاهزاً للشرب، مشيراً إلى أن مثل هذه الأدوية يجب حفظها في البراد مع ملاحظة أن مدة صلاحيتها لا تتعدى الأسبوعين.

إضافة الى وجوب الحذر عند تعاطي المضادات في حالات مرض السكري وكبر السن ولدى الأطفال ومرضى القلب وارتفاع ضغط الدم ومرضى الكبد والكلى، حيث أن الجرعات في هذه الحالات تحتاج إلى ضبط من قبل الطبيب المختص، وعند وجود حساسية سابقة من أحد المضادات الحيوية يجب على المريض إخبار الطبيب وإجراء اختبار الحساسية قبل تناوله.

وينبه إلى أنه من الأفضل عند العلاج بالمضادات الحيوية عدم تعريض الجلد للشمس كثيراً، وعند تناول المضاد مع أدوية أخرى يجب إخبار الطبيب لأن تناول أكثر من دواء في الوقت نفسه قد يزيد في تأثير أحد الأدوية على الآخر مؤدياً إلى آثار جانبية خطيرة، كما قد يتسبب في إبطال أو تقليل فعالية الدواء الآخر، في حين أن استعمال أكثر من دواء يؤدي لإنتاج مركب له تأثيرات عكسية للدواء الأصلي.

nosa_aic
19 - 01 - 2012, 08:59
كيفية التعامل مع حب الشباب في الشتاء

برلين: جبهة مليئة بالبثور، أنف لامع تعلوه حبة مؤلمة، جلد الوجه والرقبة والظهر يبدو مشدودا على نحو كريه، أغلب الناس يعرفون هذه الأعراض لحب الشباب الشائع المعروف طبيا بـ"العُــد الشائع".
وأشار بيرتهولد راتساني وهو طبيب جلدية في مستشفى جامعة شاريتيه ببرلين إلى ان "حب الشباب يظهر للجميع تقريبا بين سن الـ12 والـ17.. بمعدل أكثر من 80 بالمئة، وفي نحو عشرة بالمئة من الحالات يستمر حب الشباب إلى ما بعد سن الـ25". ولكن نوعه وخطورته يختلفان اختلافاً كبيراً.
السبب:
وأوضح هانز-جيورج داور وهو عضو في رابطة أطباء أمراض الجلدية الألمانية أن السبب الرئيسي في حب الشباب هو هرمون الاندروجين "الذكوري" الذي يزداد بشدة في الأولاد والفتيات في سن البلوغ، فهو يحفز الغدد الدهنية لإفراز المزيد من زيوت الجلد.
وفي غضون ذلك، يفرز سطح الجلد المزيد من الكيراتين، الذي يقوم بسد قنوات الغدد الدهنية ليظهر بعد ذلك في الطبقة الخارجية من الجلد على هيئة زوائد بيضاء صغيرة. وتجد البكتريا التي تسكن الجلد مثل "الفلورا الطبيعية" ظروفا معيشة مثالية، ويمكن ان تتضاعف كثيرا وتؤدي إلى التهابات بينها دمامل صغيرة ومليئة بالصديد.
تأثير الشتاء:
وتحدث هذه الزوائد في الشتاء أكثر منها في الصيف لبعض الذين يعانون من حب الشباب، وعادة ما تتفاقم أمراض الجلد في الشتاء، بحسب اندريا شلوبه من جمعية الأمراض الجلدية ومقرها كولونيا.



وأوضحت ان السبب يرجع إلى ان البشرة المهتاجة من حب الشباب تتعرض لإجهاد إضافي، حيث الهواء الدافئ والجاف في الغرف الحارة، بينما الهواء البارد في الخارج والفروق الكبيرة في درجات الحرارة.





كما أن الجو البارد يفسد التوازن الطبيعي للبشرة. وقال داور "عندما تنخفض درجات الحرارة في الهواء الطلق في الشتاء إلى أقل من سبع وثماني درجات مئوية تتوقف قدرة الجلد على تشكيل حاجز وقائي كاف، فيتشقق بما يسمح للبكتريا والجراثيم باختراق فتحات الجلد الدقيقة ويزيد من حجم البثور الموجودة".





وقالت شلوبه إن أشعة الشمس، التي تسيطر على حب الشباب على نحو ضئيل على الأقل في الصيف، تكون كميتها قليلة في الشتاء، "فنحن نعرف أن أشعة الشمس الطبيعية والضوء المرئي لهما تأثير إيجابي على تطور حب الشباب".





ورغم قصر النهار في الشتاء فإن الناس تقضي وقتا أقل في الخارج. لذا فالسير لمسافات طويلة في الشتاء يمكن أن يساعد في تهدئة أعراض حب الشباب. وأشار راتساني إلى أن "الضوء المرئي يستخدم أيضاً في العلاج، ولكن يمكن فقط توقع نتائج متوسطة".





وحذرت شلوبه "يجب التعامل مع المصابيح في مراكز التسمير (تغيير لون البشرة إلى السمرة) بالضوء بحذر، حيث ان هذه المراكز تستخدم في المقام الأول أشعة (ايه) فوق البنفسجية التي لها تأثير عكسي على حب الشباب".





العناية بالبشرة:



ومن المهم للغاية التنظيف والعناية بالبشرة التي تعاني من حب الشباب. وفي هذا الشأن يقول داور "ما يهم أكثر هو ان يكون مكتوباً على منتجات العناية بالبشرة أنها لا تتسبب في تكوين حبوب، وكلما قل ما في منتجات العناية بالبشرة من مواد استحلاب ومواد وقاية كان ذلك أفضل".





أما المواد القابضة الحادة والصابون والكريمات الدهنية والفازلين ودهن البط وشبيهاتها فهي من الممنوعات.





وحذر داور "هذه المواد تسد المسام وتغطي البكتريا وتسمح لها باحداث مشاكل تحت طبقة الدهون".



نصائح مفيدة:



ومن المهم أيضا عدم لمس الحبوب لأن الجراثيم الموجودة على الأيدي يمكن ان تزيد من أعراض حب الشباب. ورغم ذلك هناك ما يعد مصدراً للمواساة وهو أن أغلب المرضى لن يعانوا من حب الشباب الشائع لعدة فصول شتاء كثيرة.



ويمكن لبعض العلاجات المنزلية تخفيف أعراض حب الشباب. وقالت شلوبه "عمل حمام بخار بنبات الأقحوان كعلاج تكميلي يمكن أن يفيد". حيث يعمل البخار على فتح المسام، وللأقحوان تأثير مقاوم للالتهابات، فهو لا يحسن البشرة فحسب ولكن أيضا الممرات التنفسية التي عادة ما تهتاج في فصل الشتاء.



كما ان "أقنعة الزنك والسيليكون" وكذا "زيت شجر الشاي" أو "الخميرة الطبية" يمكن أن تقدم علاجاً، فهي تفيد في كبح نمو أنواع الجراثيم المختلفة وفي تقوية الجهاز المناعي.

اميره اميره
20 - 01 - 2012, 09:46
القهوة تساعد على التركيز والانتباه (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/150508-%D8%A7%D9%84%D9%82%D9%87%D9%88%D8%A9-%D8%AA%D8%B3%D8%A7%D8%B9%D8%AF-%D8%B9%D9%84%D9%89-%D8%A7%D9%84%D8%AA%D8%B1%D9%83%D9%8A%D8%B2-%D9%88%D8%A7%D9%84%D8%A7%D9%86%D8%AA%D8%A8%D8%A7%D 9%87)



http://www.alwafd.org/images/news/1438060988s80.jpg





قال باحثون امريكيون: إن القهوة تساعد على التركيز وتصفية الذهن، لكنها قد تسبب ألماً في الرأس.
وقال الدكتور جيمس بيب، البروفيسور المساعد في جامعة تكساس الطبية :ان الكافيين هو أقدم المحفّزات المعروفة لدى الإنسان.
وأضاف الكافيين أثبت انه دواء مفيد، ولكن في جميع الأحوال الاعتدال مطلوب كي نحصل على فوائد هذه المادة.
وأشارت الدراسة إلى أن الكافيين تحفّز الناس بطريقتين: تسهّل إطلاق مادة أستيل كولين الكيميائية التي تمنع النعاس وأيضاً تحجب نوعاً من مادة الأدينوزين المتلقّية الموجودة في جزء من الدماغ الذي يتحكّم بالتعلّم الذي يقوم على المكافأة.
ومن خلال حجب هاتين المادتين وإبقاء الدماغ منتظراً المكافأة، تبقي مادة الكافيين الناس متنّبهين،غير ان الكافيين يمكن أن ترفع ضغط القلب ما يسبب برعشة في العضلات وتزيد ضغط الدم وتدرّ البول وتجفف الماء من الدم وهو ما قد يؤثر على الأعصاب الحسية في الأم الجافية في الدماغ وهي الطبقة الرقيقة من الأنسجة التي تحيط بالدماغ وقد تسبب الصداع.
وقال بيب إن :كمية قليلة من الكافيين يمكن أن تكون مفيدة وتساعدنا على العمل بتركيز وانتباه والبقاء متيقّظين، ولكن الكثير منها قد يكون غير صحي.



http://a6.sphotos.ak.fbcdn.net/hphotos-ak-ash4/s320x320/251099_168705659858765_130901410305857_425114_5518 349_n.jpg (http://www.facebook.com/photo.php?fbid=168705659858765&set=a.168705543192110.46137.130901410305857&type=1&ref=nf)

ابو مالك
20 - 01 - 2012, 10:34
تناول الغذاء المحتوى على الحديد يحمى من الزهايمر
http://img.youm7.com/images/NewsPics/large/S1201115174047.jpg

كشفت دراسة أمريكية حديثة عن أن المواظبة على تناول الأطعمة التى تحتوى بكثرة على عنصر الحديد، والتمتع بمستويات جيدة من هذا العنصر الحيوى فى سن الشباب، يساعد على حماية المخ فى الكبر من الإصابة بالأمراض المختلفة مثل الزهايمر، وذلك حسبما نشر بدورية "Proceedings of the National Academy of Sciences" فى عدد شهر يناير الجارى.

وأشارت الدراسة إلى أن انخفاض مستوى الحديد بالجسم له علاقة أيضاً بتغيير تركيب وشكل المخ، وذلك بعد أن قاموا بقياس مستوى بروتين "ترانسفيرين"، وهو المسئول عن نقل عنصر الحديد بجسم الإنسان- عند عدد المراهقين، وكشفوا عن أن مستويات هذا البروتين والتى تزيد عند نقص مستوى الحديد بالجسم، لها علاقة واضحة بتغيير تركيب وشكل المخ.

وفسر الباحثون الآلية التى يعتمد عليها الحديد لوقاية المخ من الأمراض المختلفة ومن أهمها الزهايمر، حيث قاموا بفحص تركيب المخ لحوالى 635 من الشباب باستخدام أشعة الرنين المغناطيسى، وكشفت لهم عن أن مستويات الحديد الجيدة تلعب دوراً هاماً فى إنتاج الميالين بالمخ، وهو غلاف دهنى يحيط بالمحاور العصبية للمخ ويسمح بتوصيل النبضات العصبية بكفاءة عالية، وهو ما يحمى من الإصابة بالزهايمر عند الكبر .

وخلصت الدراسة إلى أن التكوين المنظم لغلاف الميالين بشكل جيد فى سن الشباب بامتلاك مستويات جيدة من عنصر الحديد فى سن الشباب، يساعد على حماية الإنسان عندما يطعن فى السن من أمراض المخ المختلفة من أهمها الزهايمر.

ويؤكد دكتور جورج يواقيم استشارى أمراض النساء والتوليد، أن نقص الحديد يعنى نقص الأوكسجين، لأنَّه يستخدم فى تركيب الهيموجلوبين بالدم، وهو أحد البروتينات الهامة التى تحمل الأكسجين فى الدم، مشيراً إلى أن نقص الهيموجلوبين يؤدى إلى نقص فى تزويد الإنسان بالأوكسجين الكافى لإجراء العمليات الحيوية التى تحدث للإنسان.

أما عن أعراض نقص الحديد (فقر الدم)، فهى الشعور بالتعب، شحوب اللون، قصر النفس، الصداع، ضعف المناعة ضد الجراثيم، وعدم القدرة على التركيز.

ويمكن علاج نقص الحديد بتناول عدد من الأطعمة التى تحتوى على الحديد كاللحم الأحمر، وخصوصا لحم العجل الأحمر، الكبد، الأسماك، والطيور، والقشريات، التونة، البيض، والبقول، والفواكه المجففة، السلمون، الخضروات الورقية الغامقة.

وتعتبر الأطعمة الحيوانية أفضل مصادر الحديد، وذلك لسهولة امتصاصه منها لكنه يصعب على الجسم امتصاص الحديد من العائلة النباتية.

وكشف الدكتور يواقيم عن أن ما يزيد الأمر سوءاً هو تناول الشاى الداكن اللون مع الأطعمة النباتية، لأنه يعوق امتصاص الحديد أكثر، أما الجمع بين الأطعمة الحيوانية التى تحتوى على الحديد والأطعمة النباتية التى تحتوى على الحديد فسوف يؤدى إلى زيادة امتصاص الحديد من الأطعمة النباتية إلى جانب امتصاصه من الأطعمة الحيوانية، ولزيادة امتصاص الحديد يستحسن تناول الأطعمة التى تحتوى على فيتامين ج (C) أو تناول هذا الفيتامين على شكل أقراص.

ahmednour
20 - 01 - 2012, 11:01
السلام عليكم ورحمة الله وبركاته
الاخت الفاضلة الاستاذه ايناس المتألقه فى المواضيع والمشاركات
تحية طيبه مباركه منى الى شخصكم الكريم
ارغب فى الحصول على معلومات عن جراحات الليزك للعيون
من حيث الطريقه وهل توجد مضاعفات ؟؟ والسن المناس
ولكى جزيل الشكر

اميره اميره
20 - 01 - 2012, 11:48
لازم تخسي << تعالى اعرفى ليه >>



http://forum.khleeg.com/imgcache/2/111789khleeg.JPG

دراسة: وزن المرأة مؤشر لاحتمال إصابتها بالسكر



وجد باحثون استراليون أن وزن المرأة في أواخر الأربعينات من عمرها يعتبر أقوى مؤشر لخطر إصابتها بمرض السكر خلال السنوات الثماني المقبلة. وعلى الجانب الآخر لم توجد صلة بين تغير الوزن في السنوات التالية واحتمال الإصابة بالسكر.



وتابعت الدراسة أوزان سيدات تتراوح أعمارهن بين 45 و50 عاما لمدة ثمانية أعوام. ووجد الباحثون إن أكثر المعرضات لخطر الإصابة بالنوع الثاني من السكر هن النساء اللاتي كن بدينات في بداية الدراسة، وقد بلغت احتمالات إصابتهن بالسكر 12 ضعفا مقارنة بنظيراتهن ذوات الأوزان العادية.

http://knol.google.com/k/-/-/loz82mf6jtbl/dc4sh0/pic-1.jpg (http://knol.google.com/k/-/-/loz82mf6jtbl/dc4sh0/pic-1.jpg)




ويقول الباحثون إن مبادرات الصحة العامة يجب أن تستهدف الوقاية من زيادة الوزن قبل وخلال الفترة الأولى من بلوغ المرأة في خطوة للحد من مسببات الإصابة بالسكر والأمراض الأخرى المتعلقة بالبدانة. كما أوضح الباحثون أن إجراء تغييرات بسيطة في النشاط البدني وعدد السعرات الحرارية التي يتم تناولها يساعد في منع زيادة الوزن.

nosa_aic
20 - 01 - 2012, 12:29
السلام عليكم ورحمة الله وبركاته
الاخت الفاضلة الاستاذه ايناس المتألقه فى المواضيع والمشاركات
تحية طيبه مباركه منى الى شخصكم الكريم
ارغب فى الحصول على معلومات عن جراحات الليزك للعيون
من حيث الطريقه وهل توجد مضاعفات ؟؟ والسن المناسب
ولكى جزيل الشكر

و عليكم السلام و رحمة الله و بركاته

مرحبا بحضرتك اخى الفاضل الدكتور رامى

اتفضل بعض المعلومات الخاصة بهذا الموضوع

مع تمنياتى بالشفاء ان شاء الله


عمليات الليزر للعينين ( الليزك )


تعنى كلمة الليزك تعديل شكل القرنية باستعمال الليزر فتستعمل أداة دقيقة تسمى الميكروكيراتوم لإزالة طبقة رقيقة من سطح القرنية عدا جزء صغير منها يبقيها متصلة بالعين ويتم إبعاده للخلف، ويستعمل بعد ذلك الإكزايمر ليزر لا زالة جزء من النسيج الداخلي للقرنية (يتم تقديره حسب نوع ودرجة عيب الإبصار) ويتم بعد ذلك إعادة الطبقة السطحية للقرنية لوضعها الطبيعي لتلتحم بدون الحاجة لأية غرز جراحية.


http://upload.wikimedia.org/wikipedia/commons/f/fc/Eye_hemorrhage.jpg

من الاعراض الجانبية الشائعة بعد عملية الليزك نزيف مؤقت
تحت الملتحمة



النجاح الجراحي في ثواني باستعمال الليزك

* الخطوة الأولى: رغم إنك ستظل مستيقظاً طوال جراحة الليزك إلا أنك لن تشعر بأي ألم, فبعد وضع محلول مخدر بالعين يتم إبعاد الجفون عن بعضها برفق باستعمال أداة طبية.

* الخطوة الثانية: توضع حلقة صغيرة ماصة حول القرنية لتعمل كقاعدة لجهاز الميكروكيراتوم.

* الخطوة الثالثة: يفصل سطح القرنية الخارجي باستعمال الميكروكيراتوم، ويتم ثنيه للأعلى.

* الخطوة الرابعة: سيطلب الطبيب منك النظر لضوء متقطع احمر بينما يقوم الإكزيمر ليزر بتعديل شكل القرنية الداخلي وتستمر هذه الخطوة من ثوان إلى دقيقتين حسب درجة التعديل الضرورية.

* الخطوة الخامسة: يعاد سطح القرنية الخارجي إلى مكانه الطبيعي ويترك ليجف لعدة دقائق.

* الخطوة السادسة: قد ينصح الطبيب باٍستعمال بعض أنواع القطرات أو تغطية العين لحمايتها.

وقد تشعر بعدم وضوح الرؤية بشكل بسيط ولذلك يفضل أن يكون معك أحد أقاربك أو أصدقائك ليصطحبك للمنزل. وسينصحك الطبيب بالاسترخاء لبقية اليوم. وكما ترى فإن تصحيح النظر بالليزك إجراء فعال وسريع وغير مؤلم أبدا.

أنواع قصور الإبصار المختلفة

* قصر النظر
* طول النظر
* الأستجماتزم


أسئلة وأجوبة شائعة عن عملية الليزك


* هل عملية الليزك تؤلم؟

معظم المرضى لا يشعرون بألم أثناء العملية بسبب استخدام مخدر سطحي عبارة عن قطرة توضع بالعين لتخدير سطح القرنية.

* متى يمكن الرؤية بوضوح بعد إجراء العملية؟

معظم المرضى يستطيعون مشاهدة التلفزيون بعد 4 ساعات من إجراء العملية، أما تحسن قوة الإبصار بصورة كاملة فتحدث خلال أسبوع إلى 3 أسابيع ويختلف ذلك من مريض إلى أخر.

* هل من الممكن تحسن قوة الإبصار إلى درجة 6/6 أو 20/20؟

معظم المرضى يشعرون بتحسن قوة الإبصار مما يمكنهم من النجاح في اختبار قيادة السيارات بدون ارتداء النظارة الطبية أو العدسات اللاصقة. ونسنتنج من ذلك ان التحسن يكون لدرجة عودة البصر بكشل طبيعي.

* ما هي مزايا عملية الليزك على عملية الليزر السابقة؟

عملية الليزر السابقة تعالج سطح القرنية مباشرة بالإكزيمر ليزر بعد إزالة طبقة الخلايا السطحية بينما عملية الليزك الحالية تعالج الأنسجة الداخلية للقرنية ولهذا السبب تتميز عملية الليزك بالألم البسيط، وسرعة الرؤية بعد 4 ساعات فقط من إجراء العملية، وعدم حدوث عتامات على سطح القرنية، كما أنها تستخدم لعلاج مقاسات ضعف النظر الكبيرة.

* ما هي المخاطر الممكن حدوثها أثناء عملية الليزك؟

عملية الليزك مثل أي عملية جراحية أخرى لها بعض المخاطر مما يتطلب خبرة جراحية كبيرة لدى الطبيب المعالج، ويسر الطبيب المعالج أن يعطى للمريض المعلومات الكاملة المتعلقة بالعملية ومشاكلها حسب درجة قصر النظر.

* هل سبق لأي شخص على الإطلاق إصابته بالعمى بعد عملية الليزك؟

هذا الاعتقاد غير صحيح بالمرة وهذه شائعات، وليس لها أي أساس علمى ولم يثبت أن هناك حالة واحدة أصيبت بمثل هذه الأضرار في العالم.

* هل من الممكن إجراء عملية الليزك للعينين في نفس الوقت؟

في معظم المرضى (98%) نقوم بإجراء عملية الليزك بالعينين في نفس الوقت والحالات المتبقية (2%) تجرى العملية بكل عين على حدة حسب رغبة المريض.

* ما هي نتائج عملية الليزك؟

في حالات قصر النظر البسيطة تصل نسبة النجاح إلى (98%) أما حالات قصر النظر أكثر من ناقص 6 درجات فتصل نسبة النجاح إلى (95%).

* كم من الزمن سيبقى أثر العملية وهل سيعود النظر للنقصان في المستقبل؟

من واقع المتابعة الدقيقة للمرضى الذين أجروا العملية منذ أكثر 12 عاماً تأكد لنا ثبات نتيجة الجراحة مما يؤكد نجاحها على مر السنين.

* في حالة إذا لم تؤد العملية لتصحيح كامل للنظر هل من الممكن تكرراها لتصحيح الباقي من قصر النظر؟

نعم يمكن إعادة تصحيح الباقي من قصر النظر ولكن يفضل الانتظار فترة 2 إلى 3 شهور بعد العملية الأولى لضمان ثبات قصرالنظر ويجرى المريض عملية تكميلية لتصليح بقايا قصر النظر بعد العملية الأولى.

* هل جفاف العين يؤثر على نتيجة الليزك؟

من واقع الدراسات التي أجريت على المرضى وجد أن جفاف العين يؤثر على قوة الإبصار النهائية بعد عملية الليزك بسبب تأثيره على سطح القرنية ولذا يجب استعمال القطرات اللازمة لتعويض نقص إفراز الدموع قبل وبعد العملية.

* هل من الممكن استعمال عدسة أو نظارة بعد العملية إذا دعت الحاجة لذلك؟

من الممكن إذا لم يرغب المريض في تصحيح الباقي من النظر أن يستعمل نظارة أو عدسة لاصقة.

* كيف يعالج من هم في الأربعينيات ليستطيعوا القراءة؟

معظم المرضى بعد سن الأربعين يحتاجون نظارة عند القراءة فقط بعد إجراء عملية الليزك أو يمكن لعين بتصليح كامل لرؤية البعيدة وإجراء العملية للعين الأخرى بتصحيح أقل للقراءة.

* ماذا يمكن أن يحدث لعيناي بعد عشرين عاماً من إجراء عملية الليزك؟

لا يتوقع أن يحدث أي تغيير في مقاسات النظر وقوة الأبصار بعد إجراء عملية الليزك الشيء الوحيد هو احتياج الشخص لنظارة قراءة بعد سن الأربعين.

* هل عملية الليزك تم الموافقة عليها من قبل اللجنة الأغذية والأدوية الأمريكية؟

نعم وافقت منظمة الأدوية والأغذية العالمية على إجراء هذه العملية منذ أكثر من 12 سنة وأن كانت تجرى في أوروبا وأمريكا اللاتينية ومعظم بلدان العالم منذ أكثر من 17 عاماً.

* من هو الشخص الذي يصلح لعملية الليزك؟

تصلح عملية الليزك للشخص الذي ليس لديه عيوب خلقية أو امراض في القرنية وخاصة القرنية المخروطية.

* من هو الشخص الذي لا يصلح لعملية الليزك؟

لا تصلح عملية الليزك لمن لديهم أمراض في القرنية أو عيوب خلقية لا تسمح بإجرائها ويجب أن يقرر ذلك الطبيب المختص.

* متى أستطيع قيادة السيارة؟

يستطيع المريض أن يقود سيارته بعد مرور يوم على الأكثر من إجراء العملية.

* متى أستطيع العودة للعمل؟

معظم المرضى يستطيعون مزاولة أعمالهم وحياتهم الطبيعية بعد مرور يوم أو أثنين على الأكثر من إجراء العملية.

* ما النصائح التي تقدمها للمريض قبل إجراء عملية الليزك؟

إذا كان المريض يستعمل العدسات اللاصقة فيجب أن يوقف استعمالها لمدة 4 ايام قبل الكشف أو أسبوعين في حالة استعمال العدسات الصلبة ويجب على المريض كذلك الاستعلام عن كل ما يتعلق بالعملية ومدى نجاحها بالنسبة لحالته شخصياً من الطبيب المعالج.

* هل أجريت هذه العملية لأطباء عيون؟

أجريت عملية الليزك لأكثر من ثلاثمائة طبيب منهم ستة وثلاثون من أطباء العيون كما تعلم أنه لن يقدم عليها الأطباء إلا إذا كانوا متأكدين من نتائجها الممتازة.

* هل يقبل الشباب على هذا النوع من الجراحة؟

نعم، يقبل الشباب عليها وهي في ازدياد مستمر، خاصة بين من يرغبون في الالتحاق بالكليات العسكرية، إضافة إلى الفتيات اللاتي لا يرغبن في ارتداء النظارات أو العدسات اللاصقة.

* هل يمكن إجراء الليزك للسيدة الحامل؟

لا ينصح بإجراء العملية للحامل أو أثناء الدورة الشهرية.

* هل مرض السكر أو الجلوكوما ما يمنعان إجراء هذه العملية؟

لا يمنع، ولكن يجب تنظيم السكر والجلوكوما قبل إجرائها.

* هل الليزك هو العملية الوحيدة المتاحة حالياً لتصحيح ضعف النظر؟

يعتبر الليزك هو الحل الأمثل لتصحيح درجات قصر النظر حتى 12 درجة وحالات طول النظر حتى موجب 3 درجات، كما يمكنه تصحيح الأستجماتزم حتى 4 درجات، أما الدرجات الكبيرة بالنسبة لقصر النظر (أكثر من ناقص 12 درجة) أو طول النظر (أكثر من موجب 6 درجات) فيفضل زرع العدسات داخل العين وهي عملية آمنه ونسبة النجاح فيها تصل إلى (95%).

nosa_aic
21 - 01 - 2012, 06:24
افحص نظرك الان مجاناً**


فحص نظر (اون لاين)**



هنا ستجد رابطًا لموقع متخصص؛ وهو عيادة مجانية لفحص النظر للتأكد من أن نظرك سليم أو ضعيف**

وإذا كنت ممن يستخدم نظارة أو عدسة طبية فاخلعها؛ للتأكد من أن نظرك ستة على ستة**



والطريقة هي :

اضغط على الرابط. أدناه .. واضغط على TAKE THE TEST من القائمة في أعلى الصفحة**


ثم تختار Color test


ثم اضغط على Take the color test »


ستظهر لك دائرة مكتوب فيها أرقام، ما عليك إلا أن تكتب الرقم الذي تراه في الدائرة في المستطيل الفاضي**

ثم اضغط Answer


ستكرر العملية 12 مرة بعدها ستظهر لك النتيجة..

ويظهر لك الأرقام الخاطئة**




افحص نظرك مجانا بالضغط هنا**
http://www.freevisiontest.com/ (http://www.freevisiontest.com/)

nosa_aic
21 - 01 - 2012, 15:53
مع بدء موسم عدوى "الإنفلونزا والرشح".. احرص على المواد الغذائية التي تخفف من أعراضهما


http://www.mediall1.com/images/Contents/1/2032.jpg
مع بدء موسم عدوى الإنفلونزا والرشح يجب التأكد من احتواء المطبخ على المواد الغذائية الضرورية للحد من أعراضِها, وتزويد الجسد بالقوة المنشودة لمكافحة الفيروسات.


وحيث إن الخريف قد عاد ومعه موسم الرشح والإنفلونزا، وبغياب علاج يشفي تماماً من الإنفلونزا، فمن المفيد الالتفاتُ إلى المطبخ للاستفادةِ من محتوياتهِ الغذائية، التي يمكن أن تقدم حلاً طبيعياً يخفف أعراض الرشح والإنفلونزا ويسرِّع عملية الشفاء.


ففيتامين "c" الموجودُ بكثرة في البرتقال والكيوي يمكن أن يقصّر مدةَ الإنفلونزا.


وأظهرت دراسةٌ حديثة أن 1000 ملغ من فيتامين "c" كلَّ ستّ ساعات يمكن أن توقفَ أعراضَ الانفلونزا. كما للكيوي قدرةٌ على علاج التهابات الجهازِ التنفسي العلوي.


وللعسلِ أيضاً خصائصُ علاجيةٌ مذهلة, فإضافةً لكونه محفزاً قوياً لجهازِ المناعة، يمكن الاعتماد عليه كثيراً للتخفيف من السعال.


والثوم هو الآخر يتمتع بخصائص مطهرة مضادة للبكتيريا وللفيروسات, كما يوصف بأنه منبّهٌ لجهاز المناعة.

أما الخردل فيساعد في تخفيض الحرارة المرتفعة وفي التخلص من السموم كما يُسهم في التئام الأغشية المخاطية في الرئتين.

وعصيرُ الليمون فعال جداً في التخفيف من التهاب الحَلْق، كما أنه يسهّل تحريرَ المخاط.

وأخيراً فتناولُ شايٍ بنكهة النعناع مفيد لمكافحة أعراض الرشح وهو يسهّل التعرُّقَ الضروري للتغلب على الحمى.

ahmednour
21 - 01 - 2012, 22:29
و عليكم السلام و رحمة الله و بركاته


مرحبا بحضرتك اخى الفاضل الدكتور رامى

اتفضل بعض المعلومات الخاصة بهذا الموضوع

مع تمنياتى بالشفاء ان شاء الله


عمليات الليزر للعينين ( الليزك )


تعنى كلمة الليزك تعديل شكل القرنية باستعمال الليزر فتستعمل أداة دقيقة تسمى الميكروكيراتوم لإزالة طبقة رقيقة من سطح القرنية عدا جزء صغير منها يبقيها متصلة بالعين ويتم إبعاده للخلف، ويستعمل بعد ذلك الإكزايمر ليزر لا زالة جزء من النسيج الداخلي للقرنية (يتم تقديره حسب نوع ودرجة عيب الإبصار) ويتم بعد ذلك إعادة الطبقة السطحية للقرنية لوضعها الطبيعي لتلتحم بدون الحاجة لأية غرز جراحية.


http://upload.wikimedia.org/wikipedia/commons/f/fc/eye_hemorrhage.jpg

من الاعراض الجانبية الشائعة بعد عملية الليزك نزيف مؤقت
تحت الملتحمة



النجاح الجراحي في ثواني باستعمال الليزك

* الخطوة الأولى: رغم إنك ستظل مستيقظاً طوال جراحة الليزك إلا أنك لن تشعر بأي ألم, فبعد وضع محلول مخدر بالعين يتم إبعاد الجفون عن بعضها برفق باستعمال أداة طبية.

* الخطوة الثانية: توضع حلقة صغيرة ماصة حول القرنية لتعمل كقاعدة لجهاز الميكروكيراتوم.

* الخطوة الثالثة: يفصل سطح القرنية الخارجي باستعمال الميكروكيراتوم، ويتم ثنيه للأعلى.

* الخطوة الرابعة: سيطلب الطبيب منك النظر لضوء متقطع احمر بينما يقوم الإكزيمر ليزر بتعديل شكل القرنية الداخلي وتستمر هذه الخطوة من ثوان إلى دقيقتين حسب درجة التعديل الضرورية.

* الخطوة الخامسة: يعاد سطح القرنية الخارجي إلى مكانه الطبيعي ويترك ليجف لعدة دقائق.

* الخطوة السادسة: قد ينصح الطبيب باٍستعمال بعض أنواع القطرات أو تغطية العين لحمايتها.

وقد تشعر بعدم وضوح الرؤية بشكل بسيط ولذلك يفضل أن يكون معك أحد أقاربك أو أصدقائك ليصطحبك للمنزل. وسينصحك الطبيب بالاسترخاء لبقية اليوم. وكما ترى فإن تصحيح النظر بالليزك إجراء فعال وسريع وغير مؤلم أبدا.

أنواع قصور الإبصار المختلفة

* قصر النظر
* طول النظر
* الأستجماتزم


أسئلة وأجوبة شائعة عن عملية الليزك


* هل عملية الليزك تؤلم؟

معظم المرضى لا يشعرون بألم أثناء العملية بسبب استخدام مخدر سطحي عبارة عن قطرة توضع بالعين لتخدير سطح القرنية.

* متى يمكن الرؤية بوضوح بعد إجراء العملية؟

معظم المرضى يستطيعون مشاهدة التلفزيون بعد 4 ساعات من إجراء العملية، أما تحسن قوة الإبصار بصورة كاملة فتحدث خلال أسبوع إلى 3 أسابيع ويختلف ذلك من مريض إلى أخر.

* هل من الممكن تحسن قوة الإبصار إلى درجة 6/6 أو 20/20؟

معظم المرضى يشعرون بتحسن قوة الإبصار مما يمكنهم من النجاح في اختبار قيادة السيارات بدون ارتداء النظارة الطبية أو العدسات اللاصقة. ونسنتنج من ذلك ان التحسن يكون لدرجة عودة البصر بكشل طبيعي.

* ما هي مزايا عملية الليزك على عملية الليزر السابقة؟

عملية الليزر السابقة تعالج سطح القرنية مباشرة بالإكزيمر ليزر بعد إزالة طبقة الخلايا السطحية بينما عملية الليزك الحالية تعالج الأنسجة الداخلية للقرنية ولهذا السبب تتميز عملية الليزك بالألم البسيط، وسرعة الرؤية بعد 4 ساعات فقط من إجراء العملية، وعدم حدوث عتامات على سطح القرنية، كما أنها تستخدم لعلاج مقاسات ضعف النظر الكبيرة.

* ما هي المخاطر الممكن حدوثها أثناء عملية الليزك؟

عملية الليزك مثل أي عملية جراحية أخرى لها بعض المخاطر مما يتطلب خبرة جراحية كبيرة لدى الطبيب المعالج، ويسر الطبيب المعالج أن يعطى للمريض المعلومات الكاملة المتعلقة بالعملية ومشاكلها حسب درجة قصر النظر.

* هل سبق لأي شخص على الإطلاق إصابته بالعمى بعد عملية الليزك؟

هذا الاعتقاد غير صحيح بالمرة وهذه شائعات، وليس لها أي أساس علمى ولم يثبت أن هناك حالة واحدة أصيبت بمثل هذه الأضرار في العالم.

* هل من الممكن إجراء عملية الليزك للعينين في نفس الوقت؟

في معظم المرضى (98%) نقوم بإجراء عملية الليزك بالعينين في نفس الوقت والحالات المتبقية (2%) تجرى العملية بكل عين على حدة حسب رغبة المريض.

* ما هي نتائج عملية الليزك؟

في حالات قصر النظر البسيطة تصل نسبة النجاح إلى (98%) أما حالات قصر النظر أكثر من ناقص 6 درجات فتصل نسبة النجاح إلى (95%).

* كم من الزمن سيبقى أثر العملية وهل سيعود النظر للنقصان في المستقبل؟

من واقع المتابعة الدقيقة للمرضى الذين أجروا العملية منذ أكثر 12 عاماً تأكد لنا ثبات نتيجة الجراحة مما يؤكد نجاحها على مر السنين.

* في حالة إذا لم تؤد العملية لتصحيح كامل للنظر هل من الممكن تكرراها لتصحيح الباقي من قصر النظر؟

نعم يمكن إعادة تصحيح الباقي من قصر النظر ولكن يفضل الانتظار فترة 2 إلى 3 شهور بعد العملية الأولى لضمان ثبات قصرالنظر ويجرى المريض عملية تكميلية لتصليح بقايا قصر النظر بعد العملية الأولى.

* هل جفاف العين يؤثر على نتيجة الليزك؟

من واقع الدراسات التي أجريت على المرضى وجد أن جفاف العين يؤثر على قوة الإبصار النهائية بعد عملية الليزك بسبب تأثيره على سطح القرنية ولذا يجب استعمال القطرات اللازمة لتعويض نقص إفراز الدموع قبل وبعد العملية.

* هل من الممكن استعمال عدسة أو نظارة بعد العملية إذا دعت الحاجة لذلك؟

من الممكن إذا لم يرغب المريض في تصحيح الباقي من النظر أن يستعمل نظارة أو عدسة لاصقة.

* كيف يعالج من هم في الأربعينيات ليستطيعوا القراءة؟

معظم المرضى بعد سن الأربعين يحتاجون نظارة عند القراءة فقط بعد إجراء عملية الليزك أو يمكن لعين بتصليح كامل لرؤية البعيدة وإجراء العملية للعين الأخرى بتصحيح أقل للقراءة.

* ماذا يمكن أن يحدث لعيناي بعد عشرين عاماً من إجراء عملية الليزك؟

لا يتوقع أن يحدث أي تغيير في مقاسات النظر وقوة الأبصار بعد إجراء عملية الليزك الشيء الوحيد هو احتياج الشخص لنظارة قراءة بعد سن الأربعين.

* هل عملية الليزك تم الموافقة عليها من قبل اللجنة الأغذية والأدوية الأمريكية؟

نعم وافقت منظمة الأدوية والأغذية العالمية على إجراء هذه العملية منذ أكثر من 12 سنة وأن كانت تجرى في أوروبا وأمريكا اللاتينية ومعظم بلدان العالم منذ أكثر من 17 عاماً.

* من هو الشخص الذي يصلح لعملية الليزك؟

تصلح عملية الليزك للشخص الذي ليس لديه عيوب خلقية أو امراض في القرنية وخاصة القرنية المخروطية.

* من هو الشخص الذي لا يصلح لعملية الليزك؟

لا تصلح عملية الليزك لمن لديهم أمراض في القرنية أو عيوب خلقية لا تسمح بإجرائها ويجب أن يقرر ذلك الطبيب المختص.

* متى أستطيع قيادة السيارة؟

يستطيع المريض أن يقود سيارته بعد مرور يوم على الأكثر من إجراء العملية.

* متى أستطيع العودة للعمل؟

معظم المرضى يستطيعون مزاولة أعمالهم وحياتهم الطبيعية بعد مرور يوم أو أثنين على الأكثر من إجراء العملية.

* ما النصائح التي تقدمها للمريض قبل إجراء عملية الليزك؟

إذا كان المريض يستعمل العدسات اللاصقة فيجب أن يوقف استعمالها لمدة 4 ايام قبل الكشف أو أسبوعين في حالة استعمال العدسات الصلبة ويجب على المريض كذلك الاستعلام عن كل ما يتعلق بالعملية ومدى نجاحها بالنسبة لحالته شخصياً من الطبيب المعالج.

* هل أجريت هذه العملية لأطباء عيون؟

أجريت عملية الليزك لأكثر من ثلاثمائة طبيب منهم ستة وثلاثون من أطباء العيون كما تعلم أنه لن يقدم عليها الأطباء إلا إذا كانوا متأكدين من نتائجها الممتازة.

* هل يقبل الشباب على هذا النوع من الجراحة؟

نعم، يقبل الشباب عليها وهي في ازدياد مستمر، خاصة بين من يرغبون في الالتحاق بالكليات العسكرية، إضافة إلى الفتيات اللاتي لا يرغبن في ارتداء النظارات أو العدسات اللاصقة.

* هل يمكن إجراء الليزك للسيدة الحامل؟

لا ينصح بإجراء العملية للحامل أو أثناء الدورة الشهرية.

* هل مرض السكر أو الجلوكوما ما يمنعان إجراء هذه العملية؟

لا يمنع، ولكن يجب تنظيم السكر والجلوكوما قبل إجرائها.

* هل الليزك هو العملية الوحيدة المتاحة حالياً لتصحيح ضعف النظر؟

يعتبر الليزك هو الحل الأمثل لتصحيح درجات قصر النظر حتى 12 درجة وحالات طول النظر حتى موجب 3 درجات، كما يمكنه تصحيح الأستجماتزم حتى 4 درجات، أما الدرجات الكبيرة بالنسبة لقصر النظر (أكثر من ناقص 12 درجة) أو طول النظر (أكثر من موجب 6 درجات) فيفضل زرع العدسات داخل العين وهي عملية آمنه ونسبة النجاح فيها تصل إلى (95%).

السلام عليكم ورحمة الله وبركاته
اشكرك كثيرا اختى الفاضلة الاستاذه ايناس على هذه المعلومات وجعلها الله فى ميزان حسناتك بارك الله فيكى

nosa_aic
22 - 01 - 2012, 06:50
السلام عليكم ورحمة الله وبركاته
اشكرك كثيرا اختى الفاضلة الاستاذه ايناس على هذه المعلومات وجعلها الله فى ميزان حسناتك بارك الله فيكى
و عليكم السلام و رحمة الله و بركاته

الشكر لله اخى الفاضل

تحياتى

hanan desoky
22 - 01 - 2012, 22:29
مضار الأسبرين تفوق فوائده

http://www.elfagr.org/Portal_News/Big/2892012120492.jpg


توصلت دراسةٌ جديدةٌ الى أن مضار تناول حبة يومياً من الأسبرين للوقاية من الاصابة بالجلطات القلبية والدماغية تفوق منافعها، وذكرت هيئة الاذاعة البريطانية «بي بي سي» أن الدراسة التي أعدها باحثون من مستشفى سان جورج في جامعة لندن، وهي الأوسع من نوعها التي تشمل أشخاصاً ليس لهم تاريخ معروف بالاصابة بأمراض القلب، توصلت الى ان اي منافع لتناول الأسبرين للوقاية تقابلها مضار احتمال تسببه بنزيف داخلي.

وقال المسؤول عن الدراسة راو سيشاساي «أن منافع الأسبرين للأشخاص الذين لا يعانون من عوارضٍ قلبيةٍ معروفةٍ أقل بكثير ٍمما كان يعتقد سابقاً، بل أن الأسبرين قد يعود بضررٍ كبيرٍ نظراً لتسببه بنزيفٍ داخليٍ»، وتبيّن أنه بينما نجح تناول الأسبرين بتجنيب الاصابة بجلطةٍ قلبيةٍ واحدٍة لكل 120 شخصاً، أصيب واحد من 73 بنزفٍ معويٍ أو معديٍ خطيرٌ خلال الفترة نفسها.

يذكر أن العديد من الأطباء يوصون بتناول حبةٍ واحدةٍ من الأسبرين (75 ملغ) يومياً للوقاية بالنسبة للأشخاص الذين ليس لهم تاريخ سابق بالاصابة بالجلطات القلبية والدماغية، ولكنهم يعانون من عوامل ترجح الاصابة كارتفاع ضغط الدم او السمنة المفرطة.

وما يجدر ذكره أن الدراسة توصلت الى أن الأسبرين ليس له تأثيرٌ على معدلات الوفيات جراء الاصابة بالأمراض السرطانية.

nosa_aic
23 - 01 - 2012, 05:07
أمل جديد لمرضى فيروس "سى" (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/152137-%D8%A3%D9%85%D9%84-%D8%AC%D8%AF%D9%8A%D8%AF-%D9%84%D9%85%D8%B1%D8%B6%D9%89-%D9%81%D9%8A%D8%B1%D9%88%D8%B3-%D8%B3%D9%89)



http://www.alwafd.org/images/news/20224614851270386063.jpg



فى مؤتمر الجمعية الأمريكية الثانى الذى عقد فى مدينة سان فرانسيسكو بالولايات المتحدة الأمريكية
استعرض العلماء أكثر من 30 دواء فعالاً بالفم ضد تكاثر فيروس «سى» داخل الخلية الكبدية وهناك أكثر من دواء ثبت فاعليته ضد النوع الجينى الرابع الموجود فى مصر ليس هذا فقط، بل إن مرض فيروس «سى» سيكون هناك أمل قريب جداً فى السنوات القليلة المقبلة لعلاجهم بالأدوية التى تؤخذ بالفم فقط دون الحاجة إلى الإنترفيرون وبنسب شفاء تقترب من 95٪ وأبحاث هذا المؤتمر تعطى بشرة سارة لمرضى فيروس «سى» وتطمئنهم بأنه فى غضون السنوات الثلاث المقبلة، سيصبح العلاج بأقراص الفم القليلة الأعراض، دون الحاجة إلى الإنترفيرون ليس هذا فقط، بل بفترة علاج أقصر تتراوح بين 12 إلى 24 أسبوعاً.
يقول الدكتور هشام الخياط، أستاذ الكبد، بمعهد تيودوربلهارس للأبحاث، هذه الأدوية من الأجيال الحديثة التى أنهت الدراسات الإكلينيكية المرحلة الثانية وبدأت المرحلة الثالثة، مثل دكلاتو سفير واسنابروفير واليسوبوفيروميرافيرس ونالبيروفير وفانبيو مفيروب سى وتتميز هذه الأجيال الجديدة بقدرتها على منع تكاثر الفيروس فى مراحل تكاثره المختلفة ومنع استقبال الفيرس داخل الخلية الكبدية بغلق مستقبلات الفيروس، بالإضافة لقلة أعراضها الجانبية وفاعليتها الفائقة فى مقاومة الفيرس وإمكانية إعطائها بدون الإنترفيرون وقلة حدوث مقاومة لها من الفيروس خاصة إذا تم استخدامها مع بعضها وذلك عكس الجيل الأول من الأدوية التى تعطى بالفم مثل البوسيبرفير والتليبرفير اللذين تم طرحهما فى الأسواق الأمريكية والأوروبية هذا العام، والتى تعطى مع الإنترفيرون ولا تعطى بدونه ولها بعض الأعراض الجانبية ويتحور الفيروس ضدها فتفقد فاعليتها ونسب نجاحها مع إعطاء الإنترفيرون تصل إلى 80٪ فقط رغم أن هذا الرقم كان حلماً ولكن أصبح بالإمكان فى المستقبل القريب جداً إعطاء أدوية بالفم وأعراضها الجانبية قليلة تصل إلى 95٪، وهناك أكثر من دواء فعال يؤخذ بالفم وضد النوع الجينى الرابع مثل دكلاتوسفيرواسانوبرفير واليسوبرفيرميرافيرسن وناليبرفير وفانوبرفير وهذا يعطى أملاً كبيراً للمرضى المصريين بفرص شفاء عالية وأعراض جانبية أقل ودون الحاجة إلى الإنترفيرون مضاف إلى ذلك قصر فترة العلاج.

nosa_aic
23 - 01 - 2012, 05:10
الحزن و قطرات الكورتيزون تسبب المياه الزرقاء (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/152298-%D8%A7%D9%84%D8%AD%D8%B2%D9%86-%D9%88-%D9%82%D8%B7%D8%B1%D8%A7%D8%AA-%D8%A7%D9%84%D9%83%D9%88%D8%B1%D8%AA%D9%8A%D8%B2%D 9%88%D9%86-%D8%AA%D8%B3%D8%A8%D8%A8-%D8%A7%D9%84%D9%85%D9%8A%D8%A7%D9%87-%D8%A7%D9%84%D8%B2%D8%B1%D9%82%D8%A7%D8%A1)



http://www.alwafd.org/images/news/422572269fsdfff.jpg



يعتبر مرض المياه الزرقاء من أخطر أمراض العيون و تسمى ( حرامي العين)، وهي عبارة عن ارتفاع بضغط العين نتيجة انسداد فى مجرى تصريف السوائل المغذية للعين .
ويتسبب هذا المرض فى تراكم السوائل داخل العين، ويؤدى إلى ارتفاع ضغط العين، الذي بدوره يقوم بالضغط على الأوعية الدموية المغذية للعصب البصري، والعصب البصري نفسه, مما يتسبب فى ضمور خلايا العصب البصرى وموتها كما يقول الدكتور أحمد حتحوت استشاري طب وجراحة العيون ورئيس الجمعية المصرية لمكافحة العمى .
ويوضح" حتحوت" أن العصب البصري هو المسئول عن توصيل الصورة الواقعة على الشبكية، ومنها إلى مركز الإبصار فى المخ، والذي يعتبر المحطة النهائية للإبصار، وبدون وصول الصورة إلى مركز الإبصار لا تتم الرؤية إطلاقا .
ومن هنا تبرز الأهمية المطلقة للعصب البصري، الذي يعتبر ( ضفيرة) من مجموع جذوع خلايا الشبكية.
ويوضح الدكتور أحمد حتحوت ، كلما ارتفع ضغط العين كلما ماتت خلايا من العصب البصرى, وهذه الخلايا لا يمكن أبداً أن تعود إلى العمل مرة أخرى، لأن الخلايا العصبية التي تموت لا يمكن رجوعها إلى العين مرة أخرى, ومن هنا تبرز خطورة مرض المياه الزرقاء فى حين أن الجزء الذى يموت من العصب البصرى والذى يمثل جزءاً من الرؤية ومن مجال الإبصار لا يمكن رجوعه أبداً، وذلك على خلاف بعض أمراض العين مثل المياه البيضاء حيث إنها مهما تسببت فى ضعف الرؤية، فإنها بعد إجراء جراحة ناجحة يستطيع المريض الرؤيه مرة أخرى بنفس كفاءة الرؤية قبل إصابته بالمرض.
ويضيف الدكتور أحمد حتحوت ، تتنوع أسباب الإصابة بالمياه الزرقاء, منها الحزن والاكتئاب الذي يتسبب في ارتفاع ضغط العين وأيضا تداول قطرات الكورتيزون بكثرة لفترة طويلة يسبب ارتفاعاً في ضغط العين .
وأيضا بعد أجراء بعض الجراحات ، كمضاعفة يمكن أن يرتفع ضغط العين، وبعض الالتهابات المزمنة فى العين تسبب ارتفاع ضغط العين مثل التهاب القزحية.
وهناك مياه زرقاء خلقية يولد بها الطفل وتعتبر من أسوأ أنواع المياه الزرقاء، لأنها تسبب تلفا كبيراً فى العصب البصرى إن لم تتم معالجتها بالسرعة والكفاءة اللازمة.
ويشير الدكتور أحمد حتحوت إلى أعراض الإصابة، و هى مكمن الخطورة لأن اعراض المياه الزرقاء فى الغالب الأعم بسيطة وغير ملفتة. المريض يشكو من صداع بسيط وزغللة، وأحيانا رؤية دخان !! وهى أعراض بسيطة لا تتناسب مع خطورة المرض ويلجأ الجميع للتعامل معها عن طريق مسكنات الصداع وبالفعل تزول هذه الأعراض, فلا ينتبه لخطورة المرض.
ونؤكد على أن أفضل سبيل للاكتشاف المبكر للمرض هو الكشف الدورى خاصة لمن هم فوق سن الأربعين عاماً ، وعند الشعور بأى شكوى من صداع أو زغللة، يجب على الفرد الذهاب لطبيب العيون لقياس ضغط العين، وإن كان سليما يمكن تناول المسكنات لإزالة الصداع، أما إذا كان ضغط العين مرتفعاً, فيجب أن يعطى علاج فوراً لتخفيض ضغط العين بالقطرات، وعمل مجال إبصار لبيان مدى تأثر العصب البصري ، وإلى أى درجة لمتابعة هذا التأثير بالأشعة فيما بعد.
ويكون علاج المياه الزرقاء أولاً بالقطرات الطبية، مع ضرورة متابعة ضغط العين لدى طبيب العيون وإذا لم ينخفض ضغط العين بالعلاج، فإن الحل المناسب فى إجراء جراحة لعمل تصريف للسوائل من العين ويجب أيضا بعد الجراحة، أن يتابع المريض مع طبيب العيون ضغط العين ولفترة طويلة، حتى استقرار ضغط العين لأن هذه الجراحة التي تشمل فتح تصريف للسوائل يمكن أن تتعرض لانسداد بعد فترة . لذا يجب متابعة الجراحة وضغط العين حتى بعد التدخل الجراحي .
ويؤكد الدكتور أحمد حتحوت على أهمية الاكتشاف المبكر لمرض المياه الزرقاء، وأهمية علاجه أولاً بأول ومتابعته حتى لا تصاب العين بالعمى، الذي لا يرجى من شفائه أمل، إن أصيبت العين بضمور العصب البصري .

nosa_aic
24 - 01 - 2012, 16:17
المنجنيز أحدث علاجات بكتيريا "الإيكولاى"

كشفت دراسة حديثة أجراها باحثون من جامعة كارينجى ميلون الأمريكية أن عنصر المنجنيز قادر على الحد من سمية سلالات بكتيريا الإيكولاى القاتلة، والتى تسببت فى وفاة وإصابة المئات العام المنصرم، وذلك حسبما جاء فى دورية "Science" بعدد شهر يناير الجارى.

وأشارت الدراسة إلى أن المنجنيز، وهو أحد العناصر الموجودة بكثرة فى الطبيعة، يحد من خطورة بكتيريا الإيكولاى عن طريق إبطال مفعول أحد المواد شديدة السمية، التى تفرزها وتعرف باسم "شيجا توكسين"، وتحمى من الآثار المميتة التى تسببها البكتريا.

وقد تتسبب المواد شديدة السمية التى تفرزها بكتريا الإيكولاى فى إصابة الإنسان بالعديد من الأعراض المرضية المصاحبة، والتى تبدأ من النزلات المعوية الطفيفة وصولا إلى الإصابة بالفشل الكلوى، وهى تنتشر بشكل شائع فى الدول التى تشهد تلوثا فى مواردها المائية، وتعتبر الأطفال هى الشريحة العمرية الأكبر التى تصيبها البكتيريا، وتسبب لهم أعراضا خطيرة قد تصل إلى الوفاة.

وأضافت الدراسة بأن تلك النتائج مهدت الطريق للوصول إلى علاجات جديدة ورخصية الثمن لعلاج الأعراض المرضية التى تحدثها تلك البكتريا، وخصوصا أن هذه الإصابات التى تؤثر على حوالى ١٥٠ مليون شخص فى العالم، وتتسبب فى وفاة مليون منهم تقريبا لا يوجد لها علاج حتى الآن.

وكانت إحدى سلالات بكتيريا الإيكولاى شديدة السمية قد ضربت ألمانيا وعددا من دول غرب أوروبا الصيف الماضى، وتسببت فى إصابة ما يزيد عن ٣٧٠٠ شخص ووفاة ٤٥ حالة تقريبا.

nosa_aic
24 - 01 - 2012, 16:20
قريباً.. عدسة لاصقة لتزويد العين بالمسكنات عقب جراحات الليزر


عكف فريق من العلماء الأمريكيين على تطوير عدسة لاصقة تعمل على توصيل المسكنات إلى العين فى أعقاب جراحات الليزر، خاصة فيما يتعلق بقرنية العين.

وقد اعتمد الباحثون بجامعة كاليفورنيا الأمريكية فى تجاربهم الأولية للإنتاج هذه العدسة على تكنولوجيا "النانو" لتوصيل العقاقير الطبية والمسكنات إلى العين بواسطة هذه العدسات المتطورة.

وأكد الباحثون، فى معرض تجاربهم، أن هذه العدسات المطورة تحد من حاجة المريض للاستعانة بالقطرات الطبية لتقتصر على مرات قليلة.

وأوضحت الأبحاث أن العدسات اللاصقة الطبية الجديدة يتم وضعها فى محلول طبى به تركيزات عالية من فيتامين "هـ" لضمان استمرار نقائها وشفافيتها إلى جانب عدم تدخلها فى وظيفة إبصار العين فى الوقت الذى تعمل فيه العدسات على إفراز نحو 90% من مادة عقار "ليدوكين" فى العين فى غضون الساعتين من ارتدائها ليصبح بديلا عن القطرات الطبية.


[/URL] (http://www3.youm7.com/News.asp?NewsID=585184&SecID=245&IssueID=168#) [URL="http://www3.youm7.com/News.asp?NewsID=585184&SecID=245&IssueID=168#"]

nosa_aic
25 - 01 - 2012, 17:26
http://img186.imageshack.us/img186/4418/bismalh1wi2qb0.gif (http://www.dlu3at.net/vb/article56063.html)
الرشح والزكام وأمراض البرد بشكل عام مشكلة يعاني منها البعض في فصل الشتاء ولأننا حريصين في هذه الأيام على أن نبتعد بشتى الطرق عن جميع أنواع الأنفلونزا ومخاطر الإصابة بها ، يوصي الأطباء بضرورة تناول الغذاء الجيد الصحي لأنه ركن أساسي ومهم للوقاية من نزلات البرد والرشح والزكام.

هناك أطعمة معينة يمكنك إذا تناولتها عند الإصابة ببداية الرشح أن تكافح العدوى وتسرع عملية الشفاء
يميل أغلب الناس عند ظهور أول أعراض الرشح الإكثار من تناول المشروبات الساخنة الحلوة مثل الشاي والكاكاو والقرفة وتناول الأطعمة النشوية التي تجعلهم يشعرون بالارتياح غير أن هذه المأكولات والمشروبات المليئة بالسكر بدلا من المساعدة على الشفاء يمكن ن تضر الجهاز المناعي كما أنها تزيد الوزن
ومن المتعارف عليه إن السكر الأبيض أو الأسمر أو على شكل عسل لا يحتوي على أي عناصر مغذية بل يحتوي على الكثير من السعرات الحرارية والتي نطلق عليها سعرات حرارية فارغة وفي حين عدم استخدام الجسم لهذه السعرات يقوم بخزنها على شكل دهون ، أما السكر نفسه فيعمل على تغير عمليات الأيض ويضعف المناعة .
الجهاز المناعي القوي يعتمد على خلايا الدم البيضاء لقتل الجراثيم والسكر الذي نتناوله يمكن أن يقضي على قدرة خلايا الدم البيضاء على قتل الجراثيم مدة تصل 4 ساعات وذلك على أثر تنافس السكر وفيتامين ( ج ) في جزء داخل الجهاز المناعي .
الأطعمة الكاملة مثل الخضار والفواكه الطازجة والحبوب فهي تطلق ما تحتوي عليه من السكر ببطء في الجسم كما أنها تحتوي على نسبة عالية من فيتامينات أ – ج – هـ ؟إضافة للزنك والسيلينيوم التي تساعد جميعها على مكافحة فيروسات الرشح والإنفلونزا من دون أن تثقل الجسم بالسعرات الحرارية ...
أبرز الأطعمة التي تكافح الرشح

أ- الفجل الحار

http://up1.neilshare.com/2011-11/avm86514.jpg (http://www.dlu3at.net/vb/article56063.html)
يعتبر من أقدم العلاجات الطبيعية الفعالة لإزالة الاحتقان والانسداد في مجاري التنفس لذا يمكنك أن تأكل القليل من الفجل الحار المبشور مع القليل من عصير الحامض ( سلطة فجل ) أو يمكن إضافة ملعقة صغيرة من هذا الفجل المبشور وملعقة صغيرة من العسل لكوب من الماء المغلي ، اشرب هذا العلاج الطبيعي مرتين أو ثلاث مرات باليوم .

ب – الثوم

http://comps.fotosearch.com/comp/IMG/IMG330/04008304.jpg (http://www.dlu3at.net/vb/article56063.html)
إن مادة الألسين التي تكسب الثوم رائحته المميزة تكسبه أيضا خصائص مضادة للفيروسات والفطريات والجراثيم فهو بذلك يساعد على كبح أعراض الرشح قبل أن تتطور ويخفف من النزلات الشعبية وآلام الحنجرة والتهاب الصدر إذا ما أخذ بانتظام ونيئ ويكفي فصين أو ثلاثة يوميا لمكافحة العدوى كما يمكن هرس الثوم في السلطة أو إضافته لأطباق اليخنة أو الحساء أو تقطيعه وبلعه مع القليل من الماء وعصير الحامض .
ج – الزنجبيل

http://up1.neilshare.com/2011-11/o6c86514.png (http://www.dlu3at.net/vb/article56063.html)
ينشط الدورة الدموية ويدفئ الجسم ويساعد على التخلص من البلغم ويخفف أعراض النزلة والحمى والرشح قبل أن يتفاقم ، كما ويسهم في استعادة الحيوية عند الشعور بالاحباط لذا أضف نصف ملعقة صغيرة من مسحوق الزنجبيل أو قطعة صغيرة مبشورة من الزنجبيل الطازج لأطباق اللحوم والأسماك أو الخضار ، كذلك يمكن أن تبشر قطعة صغيرة من الزنجبيل الطازج وتضيف إليها كوب من الماء المغلي والقليل من عصير الحامض ونصف ملعقة صغيرة من العسل .
نقيع الزنجبيل
وصفة للتخلص من الالم و القشعريرة التي تصاحب الاصابة بالرشح
يبشر قطعة طولها 2 سم من الزنجبيل المقشر الطازج يضاف اليها حوالي 275 مللتر من الماء ( حوالي كوب كبير ) توضع على النار وبعد دقيقة من الغليان ترفع عن النار ويضاف اليها فصي ثوم مهروسين ومقدار ملعقتي طعام من عصير الحامض الطازج وملعقة عسل كبيرة ، دع المزيج يبرد قليلا ثم صفه واشربه على دفعات .

د – البصل

http://up1.neilshare.com/2011-11/zie86514.jpg (http://www.dlu3at.net/vb/article56063.html)
تؤكد الدراسات الطبية جميعها إن البصل مضاد حيوي قوي ويتمتع بخصائص كفيلة بتخليص الجسم من الحمى والنزلات وأعراض الرشح إضافة لكونه منشط يساعد في تسريع عملية الشفاء لذا يمكن تناول نصف بصلة يوميا ويجب أن تؤكل فورا بعد التقطيع ونيئة مع العلم أن البصل المطبوخ مفيد أيضا .

هـ – الفلفل

http://up1.neilshare.com/2011-11/4uy86514.png (http://www.dlu3at.net/vb/article56063.html)
يساعد على تخفيف الاحتقان الذي يسببه الرشح حيث تعمل مادة الكابسسين ( العنصر الحار) على تنشيط الدورة الدموية ومكافحة القشعريرة وتعزيز انسياب الدم لليدين والقدمين وهي موجودة ببذور الفلفل الطازج مما يجعلها أقوى جزء بالفلفل لمكافحة الجراثيم ، وللعلم كلما كان الفلفل حار انخفضت الكمية التي تحتاجها للمعالجة ، كما يمكنك استخدام مسحوق الفلفل أو الفلفل الطازج للأطباق المختلفة فملعقتين من الفلفل الطازج تكفي لتنشيط الدورة الدموية وإزالة الاحتقان من مجاري التنفس ..

و – البرتقال و الليمون الحامض

http://up1.neilshare.com/2011-11/uaz86514.jpg (http://www.dlu3at.net/vb/article56063.html)
الحمضيات غنية جدا بفيتامين ج الضروري لمكافحة العدوى كما يتمتع الحامض بفائدة إضافية تتجسد في قدرته على تنشيط خلايا الدم البيضاء مما يعزز من نشاط الجهاز المناعي وللعلم إن تناول برتقالة أو حامضة في اليوم يمكن أن تقوي مناعة الجسم ضد الرشح ويفضل تناول الثمرة ولا يكتفى بعصيرها ، كذلك يمكن إضافة قشور البرتقال المبشور لمختلف الأطباق فتكسبها نكهة لذيذة كما يمكن إضافتها للمشروبات فتغني عن إضافة السكر إليها ..

ز – حساء الدجاج

http://up1.neilshare.com/2011-11/w9i86514.jpg (http://www.dlu3at.net/vb/article56063.html)
لقد جاء أول إقرار جازم لمنفعة حساء الدجاج في التخفيف من أعراض الزكام والرشح في القرن الثاني عشر من الطبيب موسى بن ميمون فعندما طلب السلطان صلاح الدين القائد العسكري المسلم من موسى أن يعالج الرشح والزكام عند ابنه وصف له حساء الدجاج خصوصا مع الثوم حيث وجد أن هذا الحساء يتمتع بخواص دوائية حقيقية لاحتوائه على مادة السستين الذي يساعد على الشفاء من الرشوحات والانفلونزا والالتهابات التنفسية كما أنه يعمل كمحرك لمخاط الجهاز التنفسي مما يسهل طرحه ، كما ينصح بإضافة الثوم والبصل والفلفل والتوابل الحادة كالكاري والفلفل الحار لحساء الدجاج هذا على أن يرتشف منه ساخنا قدر زبدية يوميا

ملاحظه

http://up1.neilshare.com/2011-11/adx86514.gif (http://www.dlu3at.net/vb/article56063.html)
لا تشربوا الحليب
لقد وجد أن الحليب وخصوصا الكامل الدسم منه يسبب المخاط ويزيد من كثافة إفرازات الجهاز التنفسي والقصبات الهوائية مما يعرقل طرح مثل هذه السوائل خارج الجسم والتي غالبا ما تزداد أثناء الرشح والأنفلونزا وان زيادة كثافتها تعرقل التنفس الطبيعي وتعتبر بيئة مناسبة لنمو البكتيريا التي قد تؤدي لالتهاب القصبات والجهاز التنفسي فيما بعد ولهذا نجد أن الحليب يمارس تأثيرا مضادا لتأثير الأطعمة الحادة كالتوابل التي تخفف المخاط في المسالك التنفسية وتعجل بالشفاء.خلاصة القول لا تشربوا الحليب الساخن أو البارد خصوصا إذا كنتم تعانون من الرشح والزكام كما يفضل الابتعاد قدر الإمكان عن اللحوم والبروتينات ، كما إنه لا بد من الراحة وتهوية المكان بين الحين والآخر في المكان الذي تتواجدون به ..

واتمنى الجميع يستفيد من هذا الطرح
http://www.arabsyscard.com/pic/zkarf/12.gif (http://www.dlu3at.net/vb/article56063.html)
http://up.3dlat.com/uploads/12871115943.gif (http://www.dlu3at.net/vb/article56063.html)

nosa_aic
26 - 01 - 2012, 05:11
الحليب المقشود المدعّم يخفف آلام النقرس (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/153707-%D8%A7%D9%84%D8%AD%D9%84%D9%8A%D8%A8-%D8%A7%D9%84%D9%85%D9%82%D8%B4%D9%88%D8%AF-%D8%A7%D9%84%D9%85%D8%AF%D8%B9%D9%91%D9%85-%D9%8A%D8%AE%D9%81%D9%81-%D8%A2%D9%84%D8%A7%D9%85-%D8%A7%D9%84%D9%86%D9%82%D8%B1%D8%B3)



http://www.alwafd.org/images/news/1902790091spbyvhqw.jpg



أظهرت دراسة أن تناول الحليب المقشود المدعّم قد يخفف وتيرة ظهور الأورام المؤلمة الناتجة عن مرض النقرس وهو أحد أنواع التهابات المفاصل.
وذكر موقع أميركي أن دراسة جديدة شملت 120 مريضاً عانوا من ظهور الأورام مرتين على الأقل في الأشهر الأربعة الماضية، وتم تقسيمهم إلى ثلاث مجموعات الأولى أعطيت حليب لاكتوز والثانية مسحوق الحليب المقشود والثالثة مسحوق حليب مقشود مدعّم بروتين الغليكوماكروبيبتايد ومستخرج دهن الحليب "جي 600".
والنقرس هو شكل من التهاب المفاصل يسببه تجمّع حمض البول (uric acid) في الدم، وغالباً ما يتأثر إصبع القدم الكبير بالمرض حيث يتورّم.
وسبق أن أظهرت الدراسات خطراً أكبر للإصابة بالنقرس بين الأشخاص الذين يتناولون منتجات من مشتقات الحليب.
وتبيّن من البحث أن 102 مريض ممن شربوا حليباً مقشوداً مدعّماً انخفضت لديهم وتيرة ظهور الأورام أكثر من غيرهم، كما انخفض مستوى حمض البول في الدم والآلام، وتلين مفاصلهم.

nosa_aic
26 - 01 - 2012, 05:16
الكافيين يقلل من الإصابة بسرطان الجلد (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/153664-%D8%A7%D9%84%D9%83%D8%A7%D9%81%D9%8A%D9%8A%D9%86-%D9%8A%D9%82%D9%84%D9%84-%D9%85%D9%86-%D8%A7%D9%84%D8%A5%D8%B5%D8%A7%D8%A8%D8%A9-%D8%A8%D8%B3%D8%B1%D8%B7%D8%A7%D9%86-%D8%A7%D9%84%D8%AC%D9%84%D8%AF)



http://www.alwafd.org/images/news/551805892e31.jpg



أثبتت دراسة امريكية حديثة ان الكافيين يساعد في منع الأشعة فوق البنفسجية من التسبب في سرطان الجلد. وقال مدير مركز أبحاث السرطان في جامعة روتجرز في نيوجيرسي آلان كوني أن الدراسة تعزز النظرية القائلة إن الكافيين يعتبر واقي ضد بعض سرطانات الجلد على المستوى الجزئي عن طريق تثبيط إنزيم البروتين في الجلد.
وقد أجريت الدراسة على بعض فئران التجارب المعدلة وراثيا، فعند تعرضها للأشعة فوق البنفسجية وجد أن الكافيين يعمل على تثبيت إنزيم ATR في الجلد مما يساعد على الحماية من الإصابة بسرطان الجلد. ونشرت نتائج هذه الدراسة في المجلة الدورية للأكاديمية الوطنية للعلوم.

nosa_aic
26 - 01 - 2012, 05:18
الشاى يساعد على خفض ضغط الدم (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/153637-%D8%A7%D9%84%D8%B4%D8%A7%D9%89-%D9%8A%D8%B3%D8%A7%D8%B9%D8%AF-%D8%B9%D9%84%D9%89-%D8%AE%D9%81%D8%B6-%D8%B6%D8%BA%D8%B7-%D8%A7%D9%84%D8%AF%D9%85)



http://www.alwafd.org/images/news/1721751205e13.jpg



وجدت دراسة جديدة أن الشاي الأسود يمكن أن يساعد على خفض ضغط الدم بشكل ملحوظ.
ونقل موقع استرالي عن الباحث المسئول عن الدراسة في جامعة غرب استراليا جوناثان هودغسان، أن ارتفاع ضغط الدم من شأنه أن يزيد خطر الإصابة بأمراض القلب.
وأضاف أنه هناك أدلة متزايدة على أن الشاي جيّد لصحتك القلبية، لكن هذا اكتشاف مهم لأنه يظهر رابطاً بين الشاي وعامل خطِر مهم للإصابة بأمراض القلب.
وقد طلب من 95 شخصاً بين 35 و75 من العمر تناول يومياً، إما 3 أكواب من الشاي أو سائل بالنكهة نفسها يحتوي على الكافيين لكن غير مستخرج من الشاي.
وبعد 6 أشهر وجد الباحثون أن من شربوا الشاي سجلت لديهم معدلات ضغط دم أقل.
وقال الباحث هودغسان إن الأمر لا يزال بحاجة الى مزيد من البحث من أجل فهم أفضل لكيفية خفض الشاي لضغط الدم، رغم أن دراسات سابقة كانت قد ربطت بين تناول الشاي وتحسّن صحة الأوعية الدموية.

nosa_aic
26 - 01 - 2012, 05:20
قلة النوم تزيد الشهية والوزن (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/153786-%D9%82%D9%84%D8%A9-%D8%A7%D9%84%D9%86%D9%88%D9%85-%D8%AA%D8%B2%D9%8A%D8%AF-%D8%A7%D9%84%D8%B4%D9%87%D9%8A%D8%A9-%D9%88%D8%A7%D9%84%D9%88%D8%B2%D9%86)



http://www.alwafd.org/images/news/2112558014uj1d31hz.jpg



حذّر باحثون سويديون من أن النوم ساعات قليلة قد يزيد من شهية المرء ويؤدي بالتالي إلى معاناته من زيادة الوزن، واستخدم الباحثون تقنية التصوير بالرنين المغناطيسي لمراقبة أدمغة 12 رجلاً أوزانهم طبيعية، فيما طلب منهم النظر إلى صور طعام.
وأشاروا إلى أن التصوير أجري مرتين، الأولى بعد ليلة نوم طبيعية والأخرى بعد ليلة من دون نوم.
وأظهرت النتائج أن نشاطاً أكبر سجل في منطقة محددة في الدماغ تلعب دوراً في تحديد الشهية عند رؤية صور الطعام بعد ليلة من دون نوم.
واعتبر الباحثون أن هذا يشير إلى أن عادات النوم السيئة تزيد خطر إصابة المرء بالبدانة على المدى الطويل.
وقال الباحث كريستيان بنديكت: بعد ليلة من دون نوم ظهر عند أولئك الرجال معدل مرتفع من النشاط في منطقة الدماغ المرتبطة بالرغبة في الأكل.
وأضــاف: إذا أخــذنا في الإعتبار أن قلة النوم هي مشكلة متنامية في مجتــمعنا المعاصر، فإن نتائج دراستنا تفسر لماذا يمكن أن تؤثر عادات النوم السيئة في زيادة الوزن على المدى الطويل.
وختم بالدعوة إلى النوم 8 ساعات ليلياً بغية الحفاظ على وزن مستقر وصحي.

nosa_aic
26 - 01 - 2012, 05:59
9 سلوكيات خاطئة تؤثر سلبيا على كفاءة عمل جهاز المناعة


أتثبت دراسة صادرة حديثاً عن مركز الوقاية والتحكّم في الأمراض في الولايات المتحدة الأميركية دور السلوكيات اليومية الخاطئة في التأثير على كفاءة عمل جهاز المناعة في الجسم.

تسبّب السلوكيات التالية ضعف المناعة، وتجعل مقترفها يصاب بجملة من الأمراض. وتشمل هذه السلوكيات:

1 تناول السكريات: يجهل كثيرون التأثير السلبي للسكر الأبيض (المكرّر) في الطعام وخصوصاً المذاب في المشروبات الساخنة أو العصائر المحلاة أو المستخدم في إعداد الحلويات والشوكولاتة على كفاءة عمل جهاز المناعة. وتفيد دراسة نشرت مؤخراً في "الدورية الأميركية للصحة العامة" أن الإفراط في تناول السكريات يسبّب هبوطاً في نشاط خلايا الدم البيضاء بنسبة 50% لمدّة تتراوح بين ساعة وساعات خمس بعد تناولها، ما يجعل المرء عرضة لضعف المناعة ومهاجمة الفيروسات والعدوى.

2 التدخين: يعدّ من بين مصادر السموم الخطرة في الجسم، فالسيجارة الواحدة تحتوي على كميّات جمّة من المواد الضارّة المسبّبة للأكسدة في الجسم والتي يطلق عليها اسم "الأيونات الشاردة".

3 تسخين الطعام في "المايكروويف": توصّل باحثون في "الجمعية الأميركية للصحة العامة" أن استخدام أفران "المايكروويف" في طهو الطعام قد يحدث تغييراً كيميائياً لمحتوى البروتين في الطعام المطهو، ما يقلّل من قيمته الغذائية، كما اكتشفوا أن الأواني التي يوضع في داخلها الطعام لتسخينه في هذه الأفران وخصوصاً المصنوعة من مادة البلاستيك أو الألومينيوم تنتج عناصر خطرة وجزئيات غريبة تنشط بالحرارة وتتسرّب للأطعمة لتختلط بها وتلوّثها.
وفي حال استخدام أفران "المايكروويف"، ينصح بـ:

- غطاء الطعام بورق القصدير.

- عدم تمليح الطعام قبل طهيه أو تسخينه، إذ توضح دراسة صادرة عن وزارة الزراعة الأميركية أن بكتيريا "السالمونيا" و"اللستيريا" تعيش وتحتمل حرارة الطهو العالية في حال تمليح الطعام قبل طهيه، علماً أن الإفراط في استخدام الملح لدى إعداد وطهو الطعام قد يمنع موجات "المايكروويف" الحرارية من اختراق كتلة الطعام وصولاً إلى مركزها، ما يجعل عملية التسخين لا تتم بالقدر الكافي، وبالتالي تصبح الأماكن الباردة في الطعام تحمل بكتيريا خطرة!
- التأكّد من أن التسخين يتمّ على حرارة عالية بما يسمح بتصاعد الأبخرة منه، ضماناً لقتل البكتيريا.
-الامتناع عن طهو اللحوم والدواجن فيها لأنها ملوّثة بالبكتيريا وينبغي طهيها بالطريقة التقليدية للقضاء على هذه البكتيريا.
- استخدام "المايكروويف" في تسخين الطعام وليس طهوه.

4 النوم في الضوء: تفيد دراسة صادرة عن "منظمة الصحة العالمية" أن تركيز هرمون "الميلاتونين" الذي تفرزه الغدة الصنوبرية في الجسم أثناء النوم يقلّ إذا تعرّض الإنسان للضوء، ويعزو الباحثون الأمر إلى أن الضوء الذي يصل للعين يحفّز بعض الأعصاب على منع الغدة الصنوبرية من إفراز هذا الهرمون بكميّات كافية، ما يؤثّر على كفاءة جهاز المناعة في الجسم. وتجدر الإشارة إلى أن هذا الهرمون يسيطر على الهرمونات الأخرى التي تنتجها الغدة النخامية الموجودة بالقرب من الغدة الصنوبرية، ويمنع عمليات الأكسدة الخطرة في الجسم، ويساعد في دعم جهاز المناعة ويعمل على تنظيم الساعة البيولوجية للجسم ويقاوم دخول أيّة مادة كيميائية غريبة على الجسم كالجراثيم المتأتّية من المبيدات الحشرية وملوثات الهواء والماء والمواد الحافظة والمضافة في الأطعمة ويعيق إفراز هرمون النمو الذي يقلّ إفرازه كثيراً عند السهر ليلاً أو النوم في الضوء.

5 استخدام الملح الجاوي: تحذّر مجموعة من الهيئات والمنظمات الصحية من مخاطر استخدام مادة "مونو صوديوم جلوتامات" Mono Sodium Glutamate (M.S.G) المعروفة بـ "الملح الجاوي" والمستخدمة في الأطباق الصينية بسبب تورّطها في إحداث تلف بالجهاز العصبي المركزي واضطرابات في الغدد الصماء وإجهاد واضح في القلب. وهي تستخدم أيضاً في بعض صنوف الحساء والمعلّبات والصلصات وإضافات السلطات وعدد كبير من الأطعمة المعلّبة والمجمّدة. ومن هذا المنطلق، يحذّر خبراء التغذية من استخدام الأطعمة التي تحتوي على "الملح الجاوي" تحت مسمّيات أخرى، كـ "بروتين نباتي محلل نباتياً" أو "نكهة طبيعية" أو "خميرة محلّلة ذاتياً" أو "خلاصة خميرة". وتتمثّل الآثار التي تنتج عن الإكثار من تناول هذه المادة، في: الإصابة بالصداع والغثيان والإسهال والتقلّبات المزاجية واضطرابات في النوم وكثرة التعرّق وحدوث ألم في الصدر واحمرار خفيف في الجلد وتشجّنات لصغار السن، وكلّها عوامل تؤثّر سلباً على مناعة الجسم الذاتية.

6 الإفراط في استهلاك الدهون المشبعة: يحذّر الباحثون في "الجمعية الأميركية للتغذية" من الإفراط في استهلاك الدهون المشبعة التي تحتويها الوجبات السريعة والجاهزة والمعروفة بـ "الدهون المتحوّلة"، وذلك بسبب تأثيرها السلبي على كفاءة عمل جهاز الهضم ما يجعل من إنتاجه للأجسام المضادة أقل فاعلية، فضلاً عن زيادة مستويات "الكوليسترول الضار" في الدم وبالتالي زيادة فرصة الإصابة بأمراض القلب والأوعية الدموية.

7 المثبطات النفسية: يثبت عدد من الأبحاث السيكولوجية الصادرة عن "الجمعية الأميركية لعلم النفس" مدى تأثّر كفاءة جهاز المناعة في الجسم بالصدمات النفسية المفاجئة والاكتئاب العاطفي المتواصل لفترات طويلة وحالات الحزن الشديدة إثر فقدان عزيز، حيث يبدو نقص واضح في عدد الخلايا اللمفاوية في الجسم من جرّائها، كما انخفاض واضح في مقاومتها وقت مهاجمتها بالجراثيم أو الفيروسات الضارة أو الخلايا السرطانية.

8 ضعف الأداء الحركي: يوضح باحثون في "المعهد الأميركي للطب الرياضي" أن قلّة النشاط البدني وضعف الحركة وعدم ممارسة الرياضة تثبط المناعة الذاتية في الجسم بسبب ضعف الأيض الغذائي في الجسم، وبالتالي ترتفع نسبة الشوادر الحرّة فيه. ويؤدي، في المقابل، الإفراط الشديد في ممارسة التمرينات الرياضية والنقص الغذائي الحاد والتعرّض المستمر للضوضاء ومجالات الطاقة الكهرومغناطيسية إلى ضعف جهاز المناعة وإصابة الجسم بالعدوى والأمراض المزمنة. ويؤكد خبراء اللياقة أن الرياضة لا تزيد من لياقة الجسم ومستوى الأيض فيه فحسب، بل إنها تزيد من كميّة الأوكسجين الذي يتخلّل الجسم ويصل إلى جميع خلاياه، ما يمنع عمليات التخمّر ويقلّل من فرص الإصابة بأنواع السرطان التي تكثر وتنتشر في الوسط الحماضي المفتقر إلى الأوكسجين.

9 تناول المضادات الحيوية: تذكر دراسة صادرة عن مركز الوقاية والتحكم في الأمراض بأميركا أن الإفراط في استخدام المضادات الحيوية أو استخدامها بشكل خاطئ قد يؤدي مع مرور الوقت إلى ظهور سلالات من البكتريا لا تتأثّر باستخدامها، كما تؤثّر هذه المضادات الحيوية بصورة سلبية على البيئة الداخلية للجسم (الأمعاء خصوصاً) وتدمّر البكتيريا المعوية النافعة.

nosa_aic
27 - 01 - 2012, 05:34
مبادئ الاسعاف الأولية


حياة الناس لا تخلو من الحوادث والإصابات . وكيفية التصرف عنه وقوعها ، قد تتوقف عليها حياة المصاب . لذلك كان الإلمام بالإسعافات الأولية لمواجهة أى إصابة ، فى المنزل ، فى الطريق ، فى السيارة ، واجباً على كل فرد طبعاً مع معرفة متى يتعين اللجوء لطبيب ، وما ينبغى عمله فى انتظار ذلك حتى لا تسوء الأمور . إيماناً منا بأهمية الوعى الصحى للأفراد بوجه عام وأهمية الإلمام ببعض الإسعافات الأولية التى قد يحتاجها الإنسان عند تعرضه للحوادث البشرية والنكبات الطبيعية .

التشخيص ..

1- تأكد أولاً من سلامتك الشخصية ، حتى لا تكون أنت الضحية التالية .
2- كن هادئا وتصرف بحكمة وعرف نفسك للمصاب ومن حوله وامنع تجمع الناس حول المصاب .
3- ابعد المصاب عن مصدر الخطر (حريق، غازات ، كهرباء، سقوط مبانى ) أو ابعد مصدر الخطر عن المصاب .
4- ابدأ فى تقييم حالة المصاب واجمع المعلومات الكافية عن سبب الإصابة وأعراضها من المصاب نفسه إذا كان واعياً أو من أهله أو المتواجدين فى مكان الحادث ، إذا كان فاقداً الوعى .

العــــــــــلاج

1- ابدأ الرعاية المناسبة حسب الأولوية وخطورة الإصابة وتكون الأولوية كما يلي:
- إنعاش القلب والتنفس فى حالة توقفها.
- العمل على وقف النزيف إن وجد.
-العمل على تثبيت الكسور .
- علاج الصدمة .
- معالجة وإزالة الألم .
2- ضع المصاب فى وضع سليم وصحيح. فى حالة الغيبوبة يوضع فى وضع الاستلقاء أو على جانبه أو ظهره ورأسه إلى جهة واحدة .
3- يجب تغطية الجروح المفتوحة حتى يمنع التلوث .
4- حل الملابس الضيقة وكذلك الملابس فوق الجروح ويتم نزع الملابس من الجزء السليم أولاً، وفى حالة تمزيق الملابس يراعى تمزيقها من مكان الحياكة .
5- لا تعطى أى شئ بالفم إذا كان المصاب فاقد الوعي، أو به جرح نافد فى البطن وكذلك فى حالة النزيف أو القيء .
6- إذا تقيئ المصاب فيجب أن تخفض رأسه مع إدارة الوجه على أحد الجانبين لمنع القيء من الوصول إلى الرئتين ، فإذا لم يكن المصاب فى تمام الوعى وهناك اضطراب فى التنفس ، يصبح من الضرورى إزالة القيء من الفم بالأصابع أو بقطعه من القماش مع نزع أى شئ غير ثابت
مثل الأسنان الصناعية .
7- يجب تغطية جسم المريض حتى يظل جسمه دافئاً .


فحص المصـــــــاب غير الواعي .

1- التنفس : استمع لحركة الهواء، وذلك بوضع اليد على عضلة الحجاب الحاجز ، لاحظ بسرعة العمق هل هو منقطع أو يتم بصعوبة، هل هو مندفع مع الإفرازات ؟

2- النزيف : افحص المصاب وما حوله بدقة للتأكد من وجود علامات نزيف ظاهرة وفى نفس الوقت لاحظ أى علامة أخرى على الملابس ، تحسس بسرعة ودقة براحة يدك جسم المصاب .

3- لون الوجه : إذا كان شاحباً عليك ملاحظة الشفاه فيما كانت شاحبة أيضاً ولاحظ وجود العرق البارد على الوجه أو الجبهة .

4- النبض : خد النبض لمدة 15 ثانية. لاحظ سرعة النبض وقوته علماً بأن المعدل الطبيعى 72 نبضة فى الدقيقة الواحدة .

5- الجلد : ضع يدك داخل الملابس ولاحظ درجة الحرارة وفيما إذا كان الجلد جافاً أو رطباً أو لزجاً.

6- الرائحة : لاحظ أى رائحة غريبة ولا تخطئ باستنشاق رائحة الكحول .

7- عمر المصاب : ملاحظة العمر التقريبى وبصورة خاصة إن وجدت علامات احتشاء عضلة القلب أو توقف القلب .




* * *


هذه بعض الاسعافات الاولــيه التي قـد نحتاجها يــوماً مــا :-

آلام البطن - الأختناق - الحروق ( وسوف نذكرها بالتفصيل أنواعها- الوقاية منها- العلاج) - آلام الصدر - الغص بالطعام - الجروح - نوبة السكري - الصدمة الكهربائية -
الصدمات - حوادث السيارات - ضربات الشمس - الغرق - التسمم - النزيف الخارجي ( النزيف الوريدي - النزيف الشرياني - النزيف الشعيري)
اصابات الكسور )



آلام البطن

أول الاعراض الرئيسية لالتهاب الزائدة الدودية هو شعور بالانزعاج في منطقة البطن. مدد الشخص المصاب في فراشه وضع كيساً من قطع الثلج على الناحية التي تؤلمه. لا تعطيه أي طعام أو شراب قبل استشارة الطبيب ، فذلك قد يزيد احتمال انفجار الزائدة الملتهبة ويخلق وضعاً أشد خطورة. ولا يجوز اطلاقاً اعطاء المصاب مسهلات لدى الشعور باي الم في البطن

الاختناق

تم انقاذ شخص من بيته الذي تلتهمه النار، وهو في حال غيبوبة من جراء الدخان الذي تنشقه. في حالات الاختناق، عملية الانعاش بالتنفس الاصطناعي من الفم الى الفم تتطلب اولا فتح مجرى التنفس لدى المصاب باحناء رأسه الى الخلف ورفع فكه الاسفل. بعد ذلك أقفل منخريه بسبابتك وابهامك وانفخ في فمه بقوة كافية ليرفع صدره، تابع الانعاش بمعدل 12 نفساً في الدقيقة. لا تيأس وتتوقف عن مهمتك بسرعة. فكثيراً ما أنتعش ضحايا اختناق بعد ساعات من مباشرة عملية التنفس الاصطناعي

الحروق :

يتعرض الأطفال إلى كثير من أنواع الحروق نتيجة لتعرض الجسم لنيران مباشرة أو الأجسام والسوائل الساخنة أو المواد الحارقة أو الأحماض والمواد الكيمائية أو نتيجة الأجهزة الكهربائية ، وتعتمد درجة خطورة الحروق على شكل الإصابة ومساحة وحجم المنطقة المعرضة للإصابة ونوع المادة المسببة في الحروق .

أنواع الحروق :هناك نوعان من الحروق :

أ - الأول : من ملامسة الطفل لأشياء ساخنة أو حارة جدا مثل إبريق الشاي أو مكواة أو أنآه الطبخ .

الثاني : وقوع مواد سائلة ساخنة أو حارة جدا على جزء من أجزاء جسم الطفل وكلا النوعين من الحروق يمكن أن يشكلا خطورة على الطفل حسب المساحة المصابة بالحروق أو مكان الإصابة بالحروق كالمناطق الغائرة تحت الجلد أو تكون في منطقة حساسة كالوجه أو الأحشاء .


أشكال الحروق :

هناك أشكال للحروق :
1 - الحروق المائية : وأسبابها السوائل السائلة أو البخار الساخن .
2 - الحروق الجافة : وأسبابها المصدر الناري المباشر أو ملامسة الأجسام الساخنة .
3 - حروق كيمائية : أسبابها تأثير بعض المواد الكيمائية الحارقة .
4 - حروق كهربائية : أسبابها التيارات الكهربائية .
5 - الحروق الباردة : أسبابها ملامسة الجسم للأجسام الباردة والمتجمدة ولفترات طويلة .
6 - حروق أشعة الشمس : أسبابها تعرض الجلد لأشعة الشمس لفترات طويلة .

درجات الحروق :

هناك (3) أنواع من الحروق هي :

1 - الحروق البسيطة :
يتغير لون الجلد إلى الاحمرار مع ظهور بعض الأورام وبدون ظهور الفقاعات المائية : الإسعافات الأولية : ــ بعد ظهور الإصابة مباشرة يستخدم الكمادات الباردة (الثلج) لتقليل الورم وذلك بوضع العضو المصاب في أناء أو وعاء الماء البارد .
ــ يتطلب من المصاب مراجعة المركز الطبي بعد إجراء الإسعافات الأولية الضرورية خاصة إذا ما كانت مساحة الإصابة كبيرة .

2 - الحروق المتوسطة :
تكوين الفقاعات المائية على سطح الجلد ، ويشعر الطفل المصاب بآلام شديدة عند ملامسة الجلد ، وقد تتعرض هذه الإصابة بالإلتهابات والتشوهات بسهولة ، لذا ومن الضروري جدا المحافظة على نظافة مكان الإصابة .

الإسعافات الأولية :

أ - إذا كانت الفقاعات المائية مفتوحة :

1 - يصب ماء بارد مستمر على مكان الإصابة .
2 - ترش مادة مطهرة على الإصابة .
3 - تغطى الإصابة بشاش معقم .
4 - تجنب أستخدام أي دهون أو مراهم كمعجون الأسنان أو الأدوية المنزلية أخرى ويحذر أيضا عدم فتح الفقاعات إلا إذا كانت كثيرة وبطريقة علمية .

ب - إذا كانت الفقاعات المائية غير مفتوحة :

1 - عدم غسل العضو المصاب .
2 - عدم فتح الفقاعات المائية .
3 - تغطى الإصابة بشاش معقم ونظيف ويحذر ملاصقة الشاش على الجرح مباشرة .
4 - يتطلب مراجعة المركز الطبي فورا وخاصة إذا كانت الإصابة على مساحة كبيرة أو تعرض العضو المصاب للإلتهابات أو إذا كان المصاب طفلا صغيرا .

ما يجب عمله :

أ - يبعد الطفل المصاب من مصدر الحروق أو إبعاد مصدر الحروق عن الطفل .
ب - يوضع العضو المحروق تحت الماء مباشرة أو في وعاء لمدة (10) دقائق بغرض تخفيف الألم والحرارة .
ج - عدم أستخدام المياه المثلجة .
د - يتم تخليص الطفل من الملابس الضيقة أو اللاصقة على الجسم وكذلك الأساور والخواتم والساعات خوفا من إحتمال الورم وعدم تمكن خلعها فيما بعد .
هـ - يتم تخليص الطفل من الملابس اللاصقة للجلد بعد سحبها وتخلع بطريقة (قصها أو قطعها) ويتطلب من المسعف أن يكون حذرا في حالات الحروق الكيميائية بأن لا يعرض نفسه والطفل المصاب إلى مخاطر التلوث والإصابة .
و - إذا كانت الإصابة بالحروق سطحية وتحتوي على أجزاء بسيطة من الجسم كالوجه والأصابع واليدين والرجلين بإمكان علاجها في المنزل ، أما في الحالات الأخرى فيجب نقل الطفل المصاب إلى أقرب مركز طبي متخصص أو يطلب الإسعاف .
ز - أثناء إجراء الإسعافات الأولية وحتى وصول الفريق الطبي (الإسعاف) يجب معالجة الصدمة والأنتباه لعلامات الصدمة التي تأتي تدريجيا .



كيفية علاج الحروق في المنزل :

أ - يغسل وينظف مكان الإصابة بالماء والصابون أو بالمحلول المطهر المخفف .
ب - تترك الفقاعات المائية التي تكونت وعدم فتحها وتخليص الماء منها كأستخدام أبره أو أدوات أخرى ، وإذا كانت هذه الفقاعات ممزقة من الأصل فيتطلب قص أطرافها (الجلد الزائد) حول الجروح .
ج - وضع كريم أو مرهم طبي على الجروح ثم يغطى الجزء المصاب بقطعة قماش نظيفة أو شاش طبي معقم أو الضمادات الطبية أو قطن طبي ، ويحذر بعدم وضع أي مواد أخرى كالمعجون أو الدهون .
د - يغسل مكان الجرح مرتين في اليوم بالماء الفاتر النظيف ثم يوضع كريم أو مرهم مضاد حيوي طبي .
هـ - توضع الضمادات الطبية على الحروق التي في اليدين والرجلين خوفا من التلوث والالتهابات ولا توضع على الحروق بالوجه والرقبة .
و - يعطى الطفل المصاب أسبرين عند الحاجة لتخفيف الآلم .


تحذير :

يحذر عدم أستخدام المواد الآتية : الزيوت والدهون والمراهم والزبدة والمعجون والرماد والصلصات في علاج وإسعاف الحروق حيث لهذه الأشياء القدرة على تخفيف الآلم مؤقتا بمنع وصول الأكسجين إلى مكان الإصابة إلا أن خطورتها أكثر وذلك بتعرض الجلد أو مكان الإصابة إلى التلوث والالتهابات وتغيير لون الجلد .

ما العمل إذا تعرض الطفل للحروق بملابسه :

في حالة تعرض الطفل للحروق بملابسه يتطلب الآتي :

أ- يطلب من الطفل الرقود على الأرض (أو المساعدة بوضعه في وضع الرقود) .
ب - تستخدم المياه كوسيلة للإطفاء وذلك لمنع وصول الأكسجين عن النار (إذا كان المسعف قريبا من المصدر المائي) .
ج - يغطى الطفل المصاب جيدا ببطانية أو سجادة أو ستارة أو جاكيت أو رداء ، وذلك لمنع وصول الأكسجين (الهواء) عن النار (إذا كان المسعف بعيدا عن المصدر المائي).
د - يحذر أستخدام المواد المصنوعة من النايلون والبلاستيك التي تساعد على زيادة الاشتعال .
هـ - عدم دحرجه الطفل المصاب بالحروق المشتعلة على الأرض مما تزيد مساحة الحروق.
و - تطلب المساعدة الطبية فورا وبسرعة .

3 - الحروق الخطرة :


يكون لون الجلد أبيض في البداية ويتغير اللون إلى الأسود والرمادي فيما بعد .
الإسعافات الأولية والعلاج :أ - عدم إزالة الملابس الملتصقة على الجلد أو مكان الإصابة .
ب - عدم وضع أي مادة طبية على مكان الإصابة .
ج - تغطية مكان الإصابة بشاش طبي معقم وجاف (ناشف) .
د - يعالج المصاب من الصدمة بوضعه في مكان دافئ وهادئ ويعطى كمية قليلة من الماء عند الطلب .

4 - الحروق الكيمائية :

عندما يتعرض الطفل للحروق الكيميائية يتطلب قراءة الإرشادات لكل نوع من أنواع المواد الكيمائية المكتوبة على العلبة التي تحتوي على هذه المادة لإتباع الخطوات الأولية للإسعافات والعلاج ، حيث يختلف تأثير المواد الكيمائية ، وفي حالة عدم وجود هذه الإرشادات والتعليمات يتطلب اتباع الخطوات التالية الآتي :
أ - يصب الماء بإستمرار من حنفية على مكان الإصابة ولمدة (10) دقائق لإزالة المواد الكيمائية .
ب - يغطى مكان الإصابة بشاش طبي معقم وجاف (ناشف) .
ج - عند دخول المواد الكيمائية بالعين يسكب الماء مباشرة أعلى العين بعد مسك رأس المصاب للجانب لمنع دخول الماء الملوث في العين الأخرى والأنف والفم .
د - يغطى العين بشاش طبي معقم ومنع حركتها واراحتها لفترة .
هـ - يجب مراجعة المركز الطبي لإجراء اللازم ، ومراجعة اختصاصي العيون .
تحذير :
يجب التأكد بعدم إزالة المواد الكيمائية باليد .

5 - الحروق الكهربائية :


بإمكان التيار الكهربائي أن ينتقل من شخص إلى آخر بالملامسة ، لذا يجب تعليم وتدريب وتزويد الأطفال بالمعلومات عند ذلك وعدم ملامسة أو الاقتراب لشخص مصاب بالصدمة الكهربائية ، لذا يتطلب إجراء الآتي :
أ - قطع التيار الكهربائي من المصدر الرئيسي وسحب التوصيلات الكهربائية .
ب - في حالة تعذر قطع التيار الكهربائي من المفتاح الرئيسي للكهرباء يتطلب تحريك المصاب من مكان اتصاله بالتيار الكهربائي ، وإزالة مصدر الخطر أو سحب المصاب من مصدر الخطر دون أن يتعرض المسعف للخطورة أو الإصابة .
ج - يتطلب من المسعف أن يقف على مكان جاف (ناشف) وعازل للكهرباء كالخشب أو ورق كرتون وأن يكون المسعف مرتديا قفاز وحذاء مصنوع من المطاط للوقاية من الإصابة بالصدمة الكهربائية) .
د - يفضل أستخدام المواد والأدوات المصنوعة من الخشب عند إسعاف وإزالة مصدر الخطر عن المصاب حيث الأدوات المصنوعة من الحديد والنحاس تعمل على الانتقال السريع للكهرباء ، لذا يحذر عدم استخدامها في إسعاف المصاب بالتيار الكهربائي .
هـ - التأكد من التنفس الطبيعي لدى المصاب وفي حالة عدم وجود التنفس الطبيعي يجب إجراء التنفس الاصطناعي (الفم بالفم) .
و - التأكد من أعراض الصدمة تدريجيا بين فترة وأخرى .
ز - مراجعة المركز الطبي وينقل المصاب للمركز التخصصي عند تعرضه إلى حروق الكهرباء حتى وأن كان لا يرغب الذهاب إلى المستشفى .


تحذير :

في حالة التعرض للإصابة بالكهرباء ذات التيارات الكهربائية العالية ، يحذر المساعدة والإسعاف والأقتراب من المصاب لأقل من (20) مترا وذلك لقدرة إنتقال الكهرباء لمن يقترب في حدود ذلك .

5 - حروق المطبخ :

كثير ما يتعرض الأطفال للحروق في المطبخ وخصوصا عند ملامسة الأجسام الساخنة وأدوات المطبخ (أواني – فرن 000 الخ) ، لذا يتطلب الآتي :
أ - أقفال فتحات الموقد .
ب - عدم ملامسة الأواني الساخنة .
ج - عدم أستخدام التيار المائي في إطفاء حرائق المطبخ .
د - إستخدام وسائل الإطفاء (سلندر الاطفاء) في إخماد النار في حرائق المطبخ ، أو تغطيه اللهب بأدوات المطبخ لمنع الهواء مثل ( القدور والأواني) .
هـ - ترك الإناء المحروق في مكانة حتى يبرد .
و - فتح الأبواب والشبابيك لخروج الدخان وعدم التعرض للأختناق وخاصة الأطفال الصغار .


6 - حروق أشعة الشمس :

التعرض لأشعة الشمس بكثرة ولفترات زمنية طويلة يؤدي إلى الإحمرار والتسلخات والفقاعات الجلدية ، لذا من الضروري جدا حماية الطفل من الإصابة بحروق أشعة الشمس وخاصة في فصل الصيف على الشواطئ .
ومن أهم أعراض حروق أشعة الشمس ما يلي :
ــ إحمرار وآلام بالجلد مع الرغبة للحك .
ــ ظهور الفقاعات المائية على الجلد .
ــ وجود الإصابات على سطح الظهر والكتفين والذراعين .
ــ تغير لون الجلد في حالة حروق أشعة الشمس تستمر ثلاثة إلى أربعة أيام .

nosa_aic
27 - 01 - 2012, 05:47
الإسعافات الأولية ،

وما يجب عمله :

1 - يغسل الجلد جيدا بالماء البارد (كمادات بالماء البارد )للطفل (كمادات ثلج على مكان الحروق) .
2 - استخدام المراهم الطبية الخاصة بالحروق على الجلد .
3 - يعطى للطفل المصاب سوائل بكثرة أو الماء البارد للشرب .
4 - عدم تعريض الجلد تلتئم الجروح ويزول الاحمرار .
5 - عدم فتح الفقاعات المائية على سطح الجلد .
6 - يجب استشارة الطبيب لإجراء اللازم .


الوقاية من الإصابة :

1 - التعرض لأشعة الشمس تدريجيا والبدء من (15 - 30) دقيقة في البداية وزيادة الفترة فيما بعد تدريجيا .
2 - عدم التعرض لأشعة الشمس في منتصف اليوم (وقت الظهيرة) .
3 - استخدام المظلات الواقية لأشعة الشمس وخاصة بعد الاستحمام في البحر .
4 - الاستحمام بالمياه المالحة أو العذبة من العوامل التي تساعد على حرق الجلد بعد تعرضه للشمس ، لذا يجب استخدام المراهم الواقية من أشعة الشمس .
5 - ارتداء الملابس الطويلة والواسعة لتغطية معظم أجزاء الجسم.
6 - ارتداء قبعات الرأس لحماية الرأس من أشعة الشمس .
7 - استخدام المظلات الواقية للحماية من أشعة الشمس وخاصة بعد الخروج من الماء (البحر) .
8 - استخدام المراهم والكريمات الواقية من الإصابة بحروق أشعة الشمس

آلام الصدر

أجلس في وضع منحن إلى الوراء بمقدار 45 درحة تقريباً . اذا كان الألم شديداً ومتواصلا، خصوصاً اذا امتد الى الكتفين او الذراعين او العنق ، فربما انت امام أزمة قلبية. استدع للحال سيارة اسعاف

الغص بالطعام

يغص احد الاشخاص بقطعة من اللحم. أسأله اذا كان يستطيع الكلام . اذا امكنه ذلك فمعناه ان الهواء يدخل الى رائتيه وبالتالي ففي وسعه ان يسعل ويقذف العائق الذي يغص به الى الخارج. اما اذا عجز عن الكلام، فأضربه بعقب يديك ضربات سرية وقوية على ظهره بين عظمتي الكتفين. لا تحاول ازاحة العائق باصبعك او دفع ماء او شراب في بلعومه. اذا بقي مجرى التنفس مسدوداً، استخدم " مناورة هيمليخ ". قف وراءه ولف ذراعيك حول خصره ، ثم اقبض احدى يديك وضع جانب الابهام على بطنه بين القفص الصدري والسرة . امسك بيديك الاخرى قبضة يدك الاولى واضغط بحركة سريعة مع دفع الى اعلى. كرر الحركة حتى ينزاح العائق

الجروح

جرح شخص يده فأخذت تنزف بغزارة. انزع من معصمه واصبعه الخاتم والساعة، وارفع ذراعه المصابة فوق مستوى القلب ثم اضغط الجرح مباشرة . اذا لم يكن احد الاوردة الرئيسية مقطوعاً، فان النزف يتوقف عادة بالضغط المباشر. اما اذا لم يتوقف، فاضغط على الوريد من الداخل ( في جروح الساق يكون الضغط على الوريد في اعلى الفخذ من الداخل ). لا تستعمل المرقأة (ضاغط لوقف النزف) الابعد اخفاق جميع الوسائل الاخرى، لأن هذه تمنع وصول الدم الى الطرف المصاب كله وربما سبب ذلك عطلا دائماً

نوبة السكري

شخص مصاب بدأ السكر في الدم بأ يتفصد عرقاً ويرتجف ويتصرف في حال من التشتت الفكري. لا تعطه حقنة انسولين او جرعة من العقاقير المضادة للسكري، اذ ربما تكون حالة ناجمة عن هبوط سريع في مستوى السكر في الدم ، وهذا ينتج عادة من تناول جرعة مفرطة من الانسلين. حاول ان ترفع مستوى السكر في دمه بان تدعه يتناول شرابا يحتوي على السكر او قطعة حلوى او يمص قطعة سكر

الصدمة الكهربائية

سلك كهربائي خارجي ينقل تياراً يسقط على شخص . قبل اي شيء يجب فصل جسد المصاب عن التيار الكهربائي . استخدم خشبة جافة او غصن شجرة لابعد السلك ، او اعقد بعض ثيابك حول المصاب و اجذبه بعيداً عن السلك. اذا امسكت بثيابه او حذائه، فربما عرضت نفسك للخطر لأن جسده قد يكون ناقلا للكرباء. تأكد من ان اي شيئ تستعمله هو جاف وغير ناقل للكهرباء وانك تقف على أرض جافة. اذا جست نبض صديقك وكان متوقفاً، فقد تضطر الى انعاشه بالتنفس الاصطناعي من الفم إلى الفم، وربما استدعت الضرورة اللجوء الى الانعاش القبي - الرئوي، وهذا يستوجب تدريباً خاصاً

الصدمات

احد المصابين بحادث يبدو جلده ممتـقعاً وندياً ونبضه متسارعاً وتنفسه سطحيا او سريعاً او غير منتظم. هذه الاعراض تدل على الصدمه التي تأتي غالباً نتيجة اصابة جسدية خطيرة. تأكد من بقاء المصاب دافئاً وممدداً عل ظهره ومن بقاء قدميه مرتفعتين نحو 30 سنتمتراً فوق مستوى رأسه. هذا الوضع يحافظ حرارة الجسم ويساعد الدورة الدموية حتى وصول الاسعاف

حوادث السيارات

انت اول الواصلين الى موقع حادث اصطدام خطير. لا تنقل المصابين من اماكنهم الا اذا كان ذلك ضرورياً لسلامتهم مخ خطر آت. حاول ان تهديء روعهم وتبقيهم في وضع مريح. اذا كان أحدهم ينزف من أذنيه أو انفه أو فمه، فقد تكون جمجمته متصدعة وبقائه بلا حراك تخفف من احتمال تفاقم النزف. اذا كان يحس بخدر او نمل في ساقه او احد اطرافه، فذلك يدل على اصابة خطرة في ظهره او رقبته، وفي هذه الحال فان اي حركة قد تسبب له شللا او حتى الموت. اذا لم يقم لديك شك في ان رقبته مصابة،حاول أن تخفف صعوبة تنفسه باحناء رأسه الى الوراء لفتح مجرى التنفس. حاول اذ تيسر ذلك ،معالجة النزف او الحرق او الصدمة او الغيبوبة بالاساليب التي سبق ذكرها

ضربة الشمس

شخص ظل ساعات تحت اشعة الشمس الحادة. وفجأة شعر بعياء ودوار واصبح جلده حاراً وجافاً. الجلد الحار والجاف المترافق مع بلبلة عقلية دلالة على ضربة شمس. اعط الشخص شراباً بارداً ولكن لا تعطه منبهات (شاي او قهوة ). اخفض حرارة جسمه بوضعه في مغطس ماء دافىء تبرده تدريجياً باضافة قطع الثلج. ان ضربة الشمس أو لفحة الحرارة قد تكون مميتة خلال ساعات. اما نهك الحرارة فهو حال اقل خطراً ويتميز بظاهرة الجلد البارد المندي بالعرق. ضع المصاب في أبرد مكان ممكن واسقه ماء او عصير برتقال. ضع على راسه منشفة باردة

الغرق

سحبت شخص كاد ان يغرق. يبدو لك انه لا يتنفس، لكنك تشعر بنبضه الخفيف.ابدأ فوراً افراغ الماء من مجرى التنفس ثم باشر عملية الانعاش بالتنفس الاصطناعي، انك تضيع وقتاً ثميناً اذا انصرفت الى افراغ جوفه ايضاً من الماء الذي ابتلعه قبل المبادرة الى التنفس الاصطناعي

التسمم

ابتلع طفل مستحضر تلميع الاثاث وهو يشير بانه يحس حريقاً في فمه. الحروق حول الفم والتشنجات المعدية هي اعراض التسمم بالاحماض والمواد القلوية. بادر الى تخفيف مفعولها باعطاء الطفل اكواباً من الحليب او الماء فهذا يبطئ امتصاص الجسم لتلك المواد. لاتحاول ابداً ان تجعله يتقيأ لأن ذلك قد يسبب اذى اضافياً للمريء. أقراء التوصيات المدونة على علبة المستحضرات واتبع ارشادها


النزيف الخارجي

نزيف شرياني-نزيف وريدي-النزيف الشعيري

النزيف الشرياني
هو الدم الذي يخرج من الشرايين ويتميز بلونه الاحمر الفاتح لانه مشبع بالاكسجين والنزيف لايتخثر فيه بسرعه ويكون تدفقه سريع جدا لهذا يكون النزيف الشرياني اخطر انواع النزيف ويجب ايقافه بسرعه واخد التدابير الازمه لايقافه

النزيف الوريدي
هو الدم الذي يخرج من الوريد ويكون لونه احمر داكن لعدم وجود الاكسجين ويكون ثابت التدفق وعادة يسهل ايقافه اسرع من النزيف الشرياني ويجب ان ننوه ان النزيف من الاورده العميقه قد يكون غزيرا ويصعب ايقافه مثل النزيف الشرياني لذا على اي حال يجب ايقاف النزيف الوريدي

النزيف الشعيري
هو الدم الخارج من الشعيرات الدمويه وهو شبيه في لونه بالدم الوريدي وهذا النوع من النزيف لايشكل خطوره في الحال وغالبا مايتوقف لوحده لاكن يجب ايقافه وتطهيره لعدم التهابه


ماذا تفعل حيال ذلك:

الضغط المباشر
اضغط مباشرة على الجرح باستخدام ضماد او شاش واذا لم يتوقف النزيف استخدم ضغط اضافي بيدك مع مراعاة عدم التلوث بالدم لعدم نقل العدوىاذا لم يتوفر الشاش المعقم استحدم اي قطعة قماش او فوطه نظيفه لاتزيل الضماد من مكانه اذا لم يتوقف النزيف بل استخدم ضماد اخر فوق الضماد المشبع بالدم وترك الاثنين في مكانهما


رفع العضو المصاب
قد يساعد رفع العضو المصاب في ايقاف النزف الا ان الضغط المباشر على النزيف مطلوب ايضا واذا تم رفع العضو المصاب فان الجادبيه تساعد على تخفيض ضغط الدم وهذا من شأنه ان يبطىء النزيف


استخدام نقاط الضغط
اذا لم يتوقف النزيف يمكن استخدام نقاط الضغط وهي المستخدمه في ايقاف معظم حالات النزيف واكثر نقطتين سهلتين يغلب استعمالهما هما النقطه العضديه في الدراع اذا كان النزيف في اليد والنقطه الفخديه في منطقة الشريان الفخدي اذاكان النزيف في القدم ويتم استخدام نفاط الضغط فقط في حالة فشل ايقاف النزيف بالضغط المباشر او رفع العضو



(اسعاف الكسور)

الكسور المضاعفه المفتوحه
ويكون فيها الكسر بارز الى الخارج مصحوب بالنزيف

الكسور البسيطه المغلقه
يكون فيها الكسر مغلق مع وجود ورم في مكان الاصابه مع وجود الام شديد

اسعافها

بصوره عامه تحتاج الكسور الى التثبيت ويتم ذلك باستخدام الجبائر وهنالك اهداف من تثبيت الكسور وهي

منع الكسر المغلق ان يتحول الى كسر مفتوح

منع اتلاف الاعصاب والاوعيه المجاوره والانسجه الاخرى بالعضم المكسور

تقليل النزيف والورم

خفض الالم الناتج عن حركة الطرف المكسور

عند استخدام الجبائر هنالك عدة اسس يجب ان تراعيها لضمان عدم حدوث اي مضاعفات للمصاب وهي كالاتي

اشرح للمصاب ان تقويم الكسر قد يسبب الما مؤقتا سيزول بعد تقويم الكسر وتجبيره

يجب ازالة الملابس فوق منطقة الكسر

لاتحاول معالجة الكسراذاكان الكسر مشوه والدوره الدمويه مستمره لاتحاول تقويمه بل ثيته في مكانه وعلى حالته

تقويم الكسور ذات الزاويه الحاده للعضام الطويله كالفخد مثلا قبل التجبير

لاحظ وجود النبض بنهاية الطرف المكسورقبل وبعد تجبيره في حالة عدم حس النبض يجب ان تعيد محاولة التجبير مرة اخرى

استخدم جبائر شد ثابته ولاتتعامل مع الكسور بحركات قويه وسريعه اثناء تثبيت الكسور بل تعامل معها بلطف

في حالة الكسور المفتوحه لاتحاول دفع اطراف العضام البارزه الى الداخل لان ذلك يؤدي الى التلوث والعدوى فقط لف الكسر المفتوح بالضماد وذلك لايقاف النزيف اذاوجد مع تجبير الكسرعلى حاله

تدكر دائما ان الكسور يصاحبها الام شديده جدا قد يدخل المصاب من خلالها في صدمه من شدة الام لذا تعامل مع الكسور بحذر ولطف




-------------------------------------

أهم إسعافات الأطفال

الإختلاجات - الحروق - أذيات العين - فقد الوعي - ارتفاع الحرارة - الكسور - ضربة الرأس - الرعاف - التسمم - الجروح - لدغ الحشرات -إصابات الأسنان - الشردقة وتوقف القلب - الأنعاش القلبي الرئوي او التنفس الأصطناعي - الغصة - الغرق - النوبة القلبية - لدغ العقارب والأفاعي



إسعاف الإختلاجات :
أبعد الطفل المصاب بالاختلاج عن كل ما يؤذيه و اجعله مستلقيا على احد جانبيه و اجري له تنفسا اصطناعيا اذا كان لا يتنفس او كان مزرقا و لا تضع اي شيء في فم الطفل و قم باخراج اي بقايا طعامية من فم الطفل و اتصل بالطبيب اذا استمر الاختلاج

إسعاف ضرر العين :
اذا تعرضت العين لاي مادة كيماوية قم بغسل العين بماء نظيف وبشكل متكرر ولمدة خمسة عشر دقيقة ثم اتصل بالطبيب او بمركز السموم ويجب ان تشاهد اذيات العين من قبل الطبيب في كل الحالات و لا تحول لمس او تدليك العين المتأذية و لا تضع اية قطرة عينية اما اذا لاحظت وجود جسم اجنبي في العين فاتركه ولا تحاول نزعه فقط قم بتغطية العين وااحضار الطفل للمشفى

إسعاف الطفل فاقد الوعي :

قم بوضع الطفل على ظهره و وجهه متجها نحو الجانب ثم ارفع ساقي الطفل لمستوى اعلى من مستوى الرأس و لا تعطي الطفل اي شيء عن طريق الفم ثم اتصل بالطبيب اذا لم يستعد الطفل وعيه خلال دقائق


اسعاف الطفل المصاب بارتفاع في درجة الحرارة :

تعتبر درجة حرارة الطفل مرتفعة اذا كانت اكثر من37.5 درجة مئوية و يكون ملمس جلد الطفل عندها حارا او يكون الطفل مصابا بالقشعريرة او التعرق و يفضل دائما قياس درجة حرارة الطفل و كإجراء اولي قم باعطاءالطفل احد الادوية الخافضة للحرارة التي يصفها طبيب الأطفال عادة وافضلها تحاميل السيتامول او شراب البروفين ولا تعط الطفل الأسبيرين خاصة في حالات الكريب وجدري الماء و لا تضع كمادات الماء البارد او الثلج او الكحول على جسم الطفل اما اذا كانت حرارة جسم الطفل مرتفعة بسبب تعرضه لاشعة الشمس لفترة طويلة فقم بنقل الطفل الى مكان اكثر برودة و اعطه الكثير من السوائل و أخيرا تذكر دوما ان الحرارة ليست مرضا بحد ذاتها و انما هي احد اعراض المرض ولابد من مراجعة الطبيب لمعرفة سبب الحرارة خاصة اذا كان عمر الطفل اقل من ثلاثة اشهر


إسعاف الكسور و الرضوض :

لا تقم بتحريك الطفل الذي يشتبه باصابته بكسر في العنق او في العمود الفقري لان تحريكه قد يسبب له أذية خطيرة ودائمة و يجب ان تشتبه بوجود كسر عندما يتعرض طفل ما لحادث سقوط او رض و عند وجود الم و تورم او تشوه في ناحية الرض كذلك عندما يسبب تحريك الطرف الما للطفل وهنا يجب عدم تحريك الطرف قبل تثبيته و اطلب الاسعاف بعد تثبيت الطرف المكسور و يمكنك وضع كمادات من الماء البارد ريثما يحضر الاسعاف


إسعاف الطفل بعد تعرضه لضربة على الرأس :

لا تقم بتحريك الطفل الذي يشتبه بإصابته بأذية في الرأس او العنق او العمود الفقري لان اي حركة للطفل هنا قد تؤذيه وتسبب أذية خطيرة و يجب عليك فقط طلب الطبيب او الاسعاف خاصة اذا كان لدى الطفل اي مما يلي :
فقد وعي او ميل شديد للنوم

صداع مستمر او اقياءات

عدم القدرة على تحريك احد الأطراف

سيلان الدم او سيلان سائل اصفر من الانف او من الاذن

عند وجود الاختلاجات

عند وجود اضطراب في الوعي او السوك او الكلام



إسعاف الرعاف :
ضع الطفل بوضعية الجلوس و الراس للاسفل قليلا ثم قم بضغط الانف بين اصبعيك ولمدة عشرة دقائق و يفضل ان تقوم بمعايرة الوقت بالساعة و اذا استمر الرعاف بعد الضغط لعشرة دقائق يجب مراجعة الطبيب



التســمـم

إسعاف الطفل المتسمم :
قم باسعاف الطفل الى الطبيب او الى اقرب مشفى اذا كان لدى الطفل المتسمم اي مما يلي :
فقد للوعي
ميل للنوم
إختلاجات
صعوبة في التنفس


أولا- فـي جمـيع الحـالات
تأكـد من عـدم وجـود خطر إضافي بسبب قيامك بإسعاف المصاب إذا كان ممكـناً
حـدد نـوع السـم واحتفـظ بوعـائـه أو غلافه
اتصل بمركـز السـموم أو المستشفى وأحـصل على النصائح الأولية إذا احتاج الأمر أطلب الإسعاف أو أي مساعد آخر ، أو انقـل المصاب وتأكد أن السـم ووعائه في معية المريض إلى المستشفى

ثانيا- في حالة السموم المستنشقة مثل دخان العوادم
تأكد أنك نفسك لا تكون ضحية هذه الغازات أيضاً
أزل مصدر هـذه الغازات/الأبخرة (مثلاً بإطفاء المحرك ) أو اقفـال أنبوبـة الغـاز
خذ المصـاب إلـى مكـان جـيد التهويــة
أطلـب الإســعاف أو مسـاعـد آخـــر إذا احتاج الأمر
قم بالتهوية الصناعية ( تنفس صناعي ) للمريض

ثالثا - في حالة السموم التي تلامس الجلد أو العيون
ذا تعرض جلد الطفل لمادة سامة مثل الاسيد او المبيدات الحشرية أغمر المنطقة بالماء البارد الجاري لمدة لا تقل عن 15 دقيقة وأغسل العينين برفـق استمر بغمر المنطقة حتى تصل إليك المسـاعدة
أبعـد جمـيع الملابـس الملـوثـة
لا تستعمـل أي ترياقات كيمـيائـية
رابعا- في حالة ابتلاع أو شرب السموم أو
الانعاش القلبي


اسعاف الطفل الذي تناول المادة السامة عن طريق الفم :
كل مادة يبتلعها الطفل غير الاغذية تعتبر حالة تسمم خطيرة و عليك عندها الإتصال بمركز التسممات و لا تجبر الطفل على الإقياء لا بعد استشارة الطبيب لان الاقياء قد يؤذي الطفل


إسعاف الطفل المتعرض للغازات والابخرة السامة :
أخرج الطفل الى مكان بعيد عن الدخان حيث يوجد هواء نقي ثم اتصل بالطبيب واذا توقف تنفس الطفل ابدأ بالتنفس الإصطناعي حتى يصل الاسعاف

اميره اميره
27 - 01 - 2012, 09:59
http://forum.roro44.com/image.php?u=747882&type=sigpic&dateline=1301583725

http://dc08.arabsh.com/i/02601/w7fxlb261nwk.png

nosa_aic
27 - 01 - 2012, 12:54
http://forum.roro44.com/image.php?u=747882&type=sigpic&dateline=1301583725

http://dc08.arabsh.com/i/02601/w7fxlb261nwk.png

جمعة مباركة اختى الفاضلة

و جزاكى الله كل خير

:Smilies082:

nosa_aic
27 - 01 - 2012, 12:56
دراسة:القلى بزيوت عبادالشمس والزيتون لايضر بالصحة (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/154232-%D8%AF%D8%B1%D8%A7%D8%B3%D8%A9-%D8%A7%D9%84%D9%82%D9%84%D9%89-%D8%A8%D8%B2%D9%8A%D9%88%D8%AA-%D8%B9%D8%A8%D8%A7%D8%AF%D8%A7%D9%84%D8%B4%D9%85%D 8%B3-%D9%88%D8%A7%D9%84%D8%B2%D9%8A%D8%AA%D9%88%D9%86-%D9%84%D8%A7%D9%8A%D8%B6%D8%B1-%D8%A8%D8%A7%D9%84%D8%B5%D8%AD%D8%A9)



http://www.alwafd.org/images/news/18197105111x8u17x9.jpg




أكدت دراسة طبية إسبانية أن تناول المقليات خاصة التى يتم قليها بطرق صحية وبزيوت غير مشبعة مثل عباد الشمس والزيتون لا تشكل خطورة على صحة الإنسان خاصة فيما يتعلق برفع فرص الإصابة بأمراض القلب والوفاة المبكرة.
وكان الباحثون بجامعة "مدريد" قد قاموا بتتبع 40 ألف شخص لنحو11عاما دأبوا على تناول المقليات .
وأشارت المتابعة إلى أن الاشخاص الذين أعتادوا على تناول المقليات بمايعرف بالزيوت الصحية مثل عبادالشمس والزيتون لم ترتفع بينهم فرص الاصابة بأمراض القلب بالمقارنة بالاشخاص الذين استخدمواالزيوت الأخرى الضارة إلى جانب استخدامهم الزيت لمرة واحدة وعدم تكرارالقلى فى نفس الزيت.
ويأتى ذلك فى الوقت الذى شدد فيه الباحثون على أن هذةالابحاث قد أجريت فى إطار منظومة إتباع المشاركين فى الدراسة لنظام غذائى لدول البحرالمتوسط الغنى بالخضراوات والفاكهة والخالى من الدهون المشبعة .
وكانت الابحاث الطبية السابقة قدأشارت إلى أن الاكثار من تناول المقليات تزيد من مخاطر الاصابة بأمراض القلب وخفض مستوى الكوليسترول الجيد فى الدم بالاضافة إلى البدانة أحد أهم الاسباب فى زيادة مخاطرالاصابة بالامراض المزمنة.

nosa_aic
27 - 01 - 2012, 13:01
http://imagecache.te3p.com/imgcache/0bd3a0c3f58b17627e783c4659dc8dab.jpg (http://www.dlu3at.net/vb/article55827.html)
ذكرت دراسة دنماركية
ان تعرض الام خلال فترة حملها
للملوثات الموجودة في الهواء
في عملها ربما يزيد من احتمال ان يصاب ابنها
الذي لم يولد بالربو فيما بعد.
وخلصت مراجعة بيانات مسجلة لعدد 45658 من الاطفال
في سن السابعة وامهاتهم الى ان 18.6 بالمئة
من اطفال الامهات اللائي تعرضن لجزيئات منخفضة
الوزن الجزيئي في العمل خلال فترة الحمل
اصيبوا بالربو
مقارنة بنسبة 16.1 بالمئة تعرضوا للتلوث العام.
وقال بريت كريستنسن
من كلية الصحة العامة بالدنمرك
الذي ترأس الدراسة في بيان
هذه اول دراسة على نطاق واسع توضح
وجود ارتباط بين تعرضات الامهات
خلال العمل والربو في الاطفال”.
وقدمت هذه الدراسة في الاجتماع السنوي
للجمعية الاوروبية للجهاز التنفسي في امستردام.
وبعد الاخذ في الاعتبار العمر
ومؤشر كتلة الجسم والحساسية
والحساسية المفرطة والتدخين
والعلاج والحيوانات الاليفة كان هناك خطر اعلى
بصورة طفيفة بنسبة حوالي 11 بالمئة للاصابة
بالربو في الاطفال عندما تتعرض امهاتهم الحوامل
لجزيئات منخفضة او مرتفعة الوزن الجزيئي.
ولم يجد الباحثون صلات بين الاصابة بالربو
في مجموعات التعرض الاخرى.
واستقبل الخبراء النتائج بحذر.
وقال كلاوس بونيليكي من مركز ربو الاطفال الدنمركي
الذي لم يشارك في البحث “نتائج مثل هذه
يجب ان يتم تفسيرها دائما بحذر حيث ربما
تتسبب في ارباك من عوامل حياة اخرى
ليس من السهل تعديلها”.
وقال لرويترز هيلث بالبريد الالكتروني “
على الرغم من ذلك فان هناك دليلا متزايدا
على ان فترة ما قبل الولادة ربما تكون فترة حاسمة
وتؤثر على خطر اصابة النسل فيما بعد بالربو
وامراض (الحساسية) الاخرى”.

nosa_aic
27 - 01 - 2012, 13:09
لاتأكل وأنت غاضب ..
‏ أو انت حزين لأن الغضب والخوف يمنعان إفراز عصير الهضم في المعدة ‏..‏
وحول تأثيرهما علي معدة المرأة





يقول د‏.‏ نبيل عبدالجواد
استشاري ورئيس قسم الجراحة العامة( القاهرة )




إن الإنسان عندما يغضب خاصة المرأة نظرآ
لَ رهافة أحاسيسها ورقة جهازها العصبي المركزي‏ ,‏
تتقلص الأوعية الدموية في بطانةالمعدة ‏,‏




ويقل افراز العصير الهاضم ‏,‏ مما يؤدي إلي فقدان الشهيةللطعام ‏..





* أماعن اضرار التوتر العصبي علىَ المعدة ..



فتتمثل في ازدياد الأحماض إلي حد كبير
بالغشاءالمخاطي الذي يحمي المعدة من الأحماض ‏,‏
وتصبح غير قادرة علي القيام بوظيفتها فتحدث بعض القرح بالمعدة ‏,‏
وفي الآثني عشر‏ ..
‏ ومن هنا تزداد حالات إصابةالنساء بالقرحة إثر مرورهن بأزمات عاطفية‏ ,‏
أو حوادث أليمة أو توترات نفسية ‏.‏..





ومن هنا ينصح الدكتور نبيل عبدالجوادالمرأة
بأن تكون هادئةومستريحة النفس قبل تناولها الطعام ‏,
‏ وألا تأكل وهي قلقة أو مضطربة ‏..
‏فَ الأحداث المؤلمة في الحياة ومايرافقها
من اضطراب وحزن تؤثر عليها
وعلي الجهازالهضمي أشد تأثير لهذا لانشعر
بالرغبة في تناول الأكل بعد أي حادث
أليم لأن المعدة لاتهضم والقلب حزين‏.‏..





كما يجب أن يكون وقت الطعام بهيجا ‏,‏
ومع من تحب ‏,‏ أو مع أفراد العائلة في جو هاديء
يسوده الود والحب بعيدا عن المناقشات الحادة
أو المنازعات العنيفة لأن الحدة والتوتر من
العوامل التي تقلل الشهية للطعام ‏,‏ كما تخفض من إفراز العصارة الهاضمة في المعدة ‏...


:36_1_13:

يعنى ممنوع الاكل اثناء متابعة الجلسة او بعدها
ممكن قبل الجلسة او بعدها بفترة لضمان عملية الهضم

nosa_aic
27 - 01 - 2012, 13:16
تمارين للعين أثناء الجلوس على الكمبيوتر


هذه التمارين نصح بها أحد أطباء العيون.
وهي جديرة بأن يمارسها كل واحد منا ممن يقضي الساعات الطوال فوق مكتب,
محدقا في شاشة الحاسوب.
و قد أطلق عليها اسم 20-20-20.


الخطوة الأولى:-

كلما مرت عشرون دقيقة من النظر المستمر على شاشة الجهاز
أدر رأسك عنه وركز النظر على أي شيء يبعد عنك عشرين قدما (6 أمتار).
فهذا يغيّر البعد البؤري لعدسة العين.
وهو شيء واجب للعين المجهدة.

الخطوة الثانية:-

أغمض العينين وافتحهما بتتابع سريع لمدة عشرين مرة متتالية
وذلك لترطيبهما


الخطوة الثالثة:-

حسب اتساع الوقت لديك قم بالمشي عشرين خطوة
بعد كل عشرين دقيقة من الجلوس في وضع واحد.
فهذا التمرين يساعد على تنشيط الدورة الدموية لكامل الجسم..

nosa_aic
28 - 01 - 2012, 10:02
الاناناس


http://www.lamst-a.net/upfiles/wtC84192.jpg (http://www.dlu3at.net/vb/article45344.html)


أفادت دراسة أمريكية بأن الأناناس له فوائد طبية كثيرة منها أنه يخفف الحموضة ويحسن عملية الهضم ويزيد الشهية ويزيل التخمة “عسر الهضم” كما يفتت الحصي ويهدئ الالتهابات‏,‏ بالإضافة إلى أنه علاج مفيد لتصلب الشرايين والنقرس‏.

وأشارت الدراسة إلى أن الأناناس يعمل على تنشيط وظائف الكبد‏,‏و ذلك لأنه غني بفيتامينات “A.B.C”.وأوضح الخبراء أن الأناناس غذاء جيد وفوائده عديدة ويساعد في علاج بعض الأمراض كنزلات البرد والأعراض المصاحبة له من السعال والبلغم الذي يصاحبها ويجعله أقل جفافاً كما أنه يسهل الهضم ويدر البول ويكافح السموم ويفيد في حالات قرحة المعدة.

وأكد الخبراء أن لب الأناناس المهروس يستخدم لعلاج الجروح وورقه لتغطية الجرح مثل الكمادات ويساعد في علاج السرطان لأنه يقوي جهاز المناعة ويخفف ارتفاع ضغط الدم.

nosa_aic
28 - 01 - 2012, 10:08
احذر من وضع جهاز الحاسوب المحمول على ارجلك


http://www.alaqsavoice.ps/images/larg/8032.jpg (http://www.dlu3at.net/vb/article45429.html)

تلافيا للإصابة بـ «متلازمة الجلد المحترق»، وهي حالة غريبة تصيب طبقات الجلد العليا بالحروق والتغير اللوني وتجعله يبدو كالخبز المحمص، والسبب هو التعرض للحرارة الصادرة عن جهاز الحاسوب المحمول لفترات طويلة.
نشر تقريرا أعده باحثون، جاء فيه أن طفلا عمره 12 عاما أصيب بحروق تشبه نمط الإسفنجة مع تغير في لون الجلد على فخذه الأيسر، والسبب كان استعمال جهاز الحاسوب المحمول عدة ساعات للعب كل يوم لعدة أشهر.
هذا وقد انتبه الطفل إلى أن الجهاز يسخن بشكل أكبر من الجهة اليسرى، لكنه لم يعر الأمر أي اهتمام ولم يقم بتبديل مكانه أو استخدام عازل بينه وبين الجهاز، واستمر باللعب حتى بدأت الأعراض المؤلمة بالظهور.
في حالة أخرى، أصيبت طالبة حقوق بحالة من تغير لون الجلد على أحد أرجلها بعد أن استعملت جهاز الحاسوب المحمول لإنجاز بعض الأعمال لمدة 6 ساعات يوميا.
وتقول طبيبة قامت بعلاج الطالبة الشابة: «في البداية لم نعرف سبب ظهور التغير المفاجئ على لون الجلد على إحدى أرجلها، ولكن بعد عدة جلسات من العلاج قالت الفتاة إنها غالبا ما تدرس واضعة جهاز الحاسب المحمول على أرجلها».
وللمعلومة فإن حرارة جهاز الحاسوب المحمول يمكن أن تبلغ 52 درجة مئوية.
وتنصح الدكتورة دائما باستعمال الحاسوب المحمول على المكاتب قدر الإمكان، أو استعمال عازل مخصص لأجهزة الحاسوب المحمول إذا اضطررت لاستعماله في مكان عام.

nosa_aic
28 - 01 - 2012, 10:19
تناول الشاى قد يساعد فى تخفيض ضغط الدم المرتفع



http://img.youm7.com/images/NewsPics/large/s12201128175541.jpg


أكدت أبحاث طبية، أن تناول ثلاثة أكواب من الشاى الأسود يساعد على خفض ضغط الدم المرتفع.

وتشير الأبحاث إلى أن الانتظام فى تناول الشاى خاصة الأسود يعمل على خفض ضغط الدم المرتفع بمعدل ما بين نقطتين إلى ثلاث نقاط.

وأوضح الباحثون، أن معدلات الخفض قد تبدو ضئيلة إلا أن الأطباء يؤكدون على أنها تشكل فائدة هامة وكبيرة فى وقاية الإنسان من مخاطر الإصابة بأمراض القلب بنسبة 10%.

ابو مالك
29 - 01 - 2012, 00:55
الغالبية العظمى قد تنتج عن مشاكل في الأذن أو أمراض المخ والأعصاب

خشونة الفقرات العنقية ليست سبباً معروفاً للدوخة والدوار !

http://s.alriyadh.com/2012/01/15/img/260685886615.jpg
الام في الفقرات
د.ياسر بن محمد البحيري
هل تعاني من دوخة ودوار مزمن؟
هل تؤثر هذه الأعراض على حياتك اليومية؟
هل قمت بزيارة العديد من الأطباء بما في ذلك أطباء الأنف والأذن والحنجرة وأطباء المخ والأعصاب وأطباء العظام وسبق أن قيل لك إن هذه الأعراض هي نتيجة خشونة في الفقرات؟
هل لازلت تعاني من هذه الأعراض وتشعر بحيرة وتشوش وعدم ثقة في التشخيص؟
إذاً فربما عليك إكمال قراءة هذه المقالة لعل وعسى أن تكون فيها فائدة بإذن الله.
الدوخة والدوار
هذه الأعراض شائعة نتيجة العديد من المشاكل الطبية التي تؤثر في الإنسان ويجب التفريق بين الدوخة والدوار. حيث إن الدوخة هي عبارة عن شعور بأن الشخص يبدأ في فقدان الوعي. أما الدوار فهو شعور بأن الغرفة أو المحيط الذي يجلس فيه الشخص يدور حوله ويؤدي إلى شعور بفقدان التوازن. ولكل من هذين العارضين أسباب. فمثلاً الدوخة قد تكون نتيجة لأمراض المخ أو نتيجة لأمراض القلب والشرايين ونقص تدفق الدم إلى المخ أو نتيجة اختلال في تمثيل الجسم للمواد الغذائية كما يحدث عند انخفاض مستوى السكر في الدم. وفي بعض الأحيان قد تكون هذه الأعراض نتيجة تضيق في شرايين العنق التي تغذي المخ مما يؤدي إلى الشعور بالدوخة بين فترات متباعدة. وبالإضافة إلى ما سبق فهناك الكثير من المشاكل الطبية الباطنية أو المتعلقة بأمراض الدم أو الغدد التي تؤدي إلى الشعور بالدوخة. أما الدوار فإنه عادةً ما يكون نتيجة اختلال في مركز التوازن في الإنسان. هذا المركز هو الأذن الداخلية والوسطى. بالإضافة إلى ذلك فإن أجزاء المخ المسؤولة عن التوازن قد تكون سبباً في الشعور في الدوران كما يحدث في أمراض المخ والأعصاب. وبغض النظرعن السبب الذي يؤدي إلى الدوار فإن الأعراض قد تكون شديدة وتؤثر على المريض وتستمر لفترات طويلة وتنغص عليه حياته وتمنعه من القيام بأبسط الأعمال. وعادةً ما يلجأ المريض إلى الأطباء لحل هذه المشكلة وقد يزور طبيب المخ والأعصاب الذي قد يطمئنه بعد الفحوصات اللازمة بأن كل شيء على ما يرام. كما أنه قد يمرعلى طبيب الأنف والحنجرة الذي أيضاً قد لا تكون الأعراض لدى المريض واضحة مما يؤدي إلى عدم التشخيص الدقيق لهذه الحالات. وفي كثير من الأحيان يتم تحويل المريض إلى طبيب العمود الفقري وذلك بهدف علاج حالة الدوار على أنها ناتجة عن خشونة الفقرات.





http://s.alriyadh.com/2012/01/15/img/757238980378.jpg

الدوخة والدوار المزمن قد لا يكون سببه الفقرات




خشونة الفقرات العنقية
في الواقع أن خشونة أو تآكل أواحتكاك الفقرات العنقية هو عبارة عن تغيرات تحصل في الغضاريف التي تقع بين فقرات العنقية السبع وأيضاً تغيرات الخشونة في المفاصل الصغيرة الخلفية التي تربط أجزاء من الفقرات ببعضها البعض. هذه الخشونة تكون ناتجة عن التقدم في السن وعوامل الزمن والإجهاد الذي يقع على فقرات العنق خلال السنين. وفي كثير من الأشخاص تكون الخشونة حميدة وليست لها أعراض تذكر. والمعروف أنه إذا ما أخذنا مئة شخص من الذين يبلغون 45 عاماً أو أكثر وقمنا بتصويرهم بأشعة الرنين المغناطيسي فإن نسبة كبيرة من هؤلاء الأشخاص سوف تكون لديهم تغيرات رثوية وخشونة في الفقرات بدون أن تكون لديهم أية أعراض. ولهذا فإن الخشونة والتغيرات الرثوية هي جزء من مرحلة التقدم في السن التي تصيب جميع أنحاء الجسم. ولكن في بعض الحالات قد تكون هذه الخشونة متقدمة أو مرضية كما يحدث في حالات الإنزلاق الغضروفي أو في حالات الخشونة الشديدة في المفاصل الخلفية في الرقبة أو في حالات ضيق القناة الشوكية أو في حالات جفاف غضاريف الرقبة.




http://s.alriyadh.com/2012/01/15/img/857195295310.jpg
اشعة تبين الخشونة




وفي هذه الحالات تكون هناك أعراض لدى المريض تتكون من آلام تختلف في شدتها ما بين الآلام الخفيفة إلى الآلام المبرحة وقد تعاوده بين فترة وأخرى وتزداد مع المجهود ومع ثني الرقبة لفترات طويلة ومع القراءة والكتابة لفترات طويلة ومع البرد وغير ذلك. والواقع أن مشاكل خشونة الرقبة هي في ازدياد خصوصاً مع الإستخدام المفرط لأجهزة الكمبيوتر وأجهزة البلاك بيري وأجهزة الهاتف الذكية التي تؤدي إلى ثني الرقبة لفترات طويلة مما يؤدي إلى وضع الضغوط غير الطبيعية على الفقرات والغضاريف. وفي الحالات المتقدمة قد يؤدي الألم إلى تشنج العضلات المحيطة بالرقبة وأيضاً قد يكون هناك ضغط على الأعصاب مما يؤدي إلى ظهور الألم في منطقة الكتف والذراع واليد ويصاحبها في بعض الأحيان الشعور بخدرأو تنميل في أطراف الأصابع. وهذه الأعراض عادةً ما تزداد مع مرور الوقت إذا ما تم إهمالها وقد تؤدي إلى تفاقم الألم إلى درجة أنه قد تؤثر على حياة المريض.
وعادةً ما يتم تشخيص مشاكل الفقرات العنقية بعد الفحص السريري الذي قد يبين وجود تحدد في حركة الفقرات العنقية وشد في العضلات المحيطة بالرقبة وآلام عند الضغط على هذه العضلات بالإضافة إلى وجود نواقص عصبية كضعف في الطرفين العلويين في الطرف العلوي الأيمن أو الأيسر أو وجود خدور ونقص فيهما. وبعد الفحص السريري يتم إجراء الأشعات اللازمة والتي قد تتكون من أشعة سينية للفقرات العنقية أو طلب أشعة رنين مغناطيسي في الحالات المتقدمة أو التي يكون هناك فيها ضغط على الأعصاب. ويجب التنبيه إلى أنه لايوجد سبب لحدوث الدوار أو الدوخة لدى مرضى خشونة الفقرات. حيث إن المرض لا يؤدي إلى ضغط على الشرايين أو الأوردة الموجودة في العنق لأن هذه الشرايين والأوردة بعيدة عن منطقة الاحتكاك والخشونة التي تصيب الفقرات العنقية. ولذلك فإنه يجب على الأطباء عدم تفسير الدوخة أو الدوار بأنه نتيجة الخشونة بل يجب البحث على الأسباب الحقيقية وراء حدوث هذه الدوخة أو الدوار. وبالنسبة لخشونة الفقرات فإنها قد تسبب صداعا وألما في منطقة الخلفية من الرأس ولكنها نادراً ماتسبب دورانا أو عدم توازن. وبالنسبة لمرض خشونة الفقرات فإنه عادةً ما يتم علاجه مبدئياً بالطرق التحفظية مثل جلسات العلاج الطبيعي واستخدام المخدات الطبية عند النوم وعند الجلوس وعمل تمرينات للرقبة لتقوية عضلات الرقبة وإطالتها وكذلك تناول الأدوية المرخية للعضلات والأدوية المضادة لإلتهابات العضلات والمفاصل والأدوية المسكنة. كما يمكن الإستعانة بجيمع أنواع المراهم أو الكمادات الدافئة وحتى الطوق الإسفنجي لفترات قصيرة. وفي بعض الحالات التي لاتستجيب للعلاج التحفظي والتي تكون نتيجة انزلاق غضروفي شديد أو نتيجة ضيق في القناة الشوكية مع ضغط على النخاع الشوكي فإن التدخل الجراحي قد يكون ضرورياً لرفع الضغط عن الأعصاب وتثبيت الفقرات المصابة بمرض الخشونة.



http://s.alriyadh.com/2012/01/15/img/800122789963.jpg
مشاكل الاذن قد تكون هي السبب




الدوخة والدوار وخشونة الفقرات العنقية
في كثير من الأحيان يأتي المريض أو المريضة إلى الطبيب وهو يحمل العديد من الأشعات والتحاليل لفقرات العنق ويشتكي بأن حالته مزمنة وأنه لا يتحسن بالرغم جميع الأدوية والطرق العلاجية التي ذكرناها سابقاً لعلاج خشونة الفقرات. وعند التدقيق في شكوى المريض قد يتبين أنه يعاني من دوخة أو دوار وأنه يعالج هذه الأعراض عن طريق علاج خشونة الرقبة. والواقع هو أن الأعراض التي يشتكي منها ليست ناتجة عن خشونة الفقرات والواجب على الطبيب المعالج التنبه لهذه النقطة وعدم إضاعة وقت المريض ومجهوده في علاج خشونة الرقبة للتخلص من الدوخة والدوار بل على الطبيب أن يكون صريحاً مع المريض وأن يشرح له بأن الغالبية العظمى للحالة الدوخة والدوار تنتج إما عن مشاكل في الأذن أو مشاكل ناتجة عن أمراض المخ والأعصاب وأنه يجب عليه التوجه إلى طبيب المخ والأعصاب وأيضاً إلى طبيب الأنف والأذن والحنجرة للقيام بعمل الفحوصات اللازمة ووضع الخطة العلاجية المناسبة التي تساعد بإذن الله على شفاء المريض أو المريضة من هذه الأعراض.




منقول
</B></I>

nosa_aic
29 - 01 - 2012, 04:20
لكل مرض عصير مناسب له


عصير الاناناس :

يساعد على الهضم ومفيد جدا للمعدة كما انه مدر للبول وطارد للسموم في
الجسم وينصح به المصابون بفقر الدم وعسر الهضم وعصير الاناناس
له قدرة كبيرة على تذويب الشحوم لذلك فهو مفيد جدا للمصابين بفرط السمنة.

عصير المشمش :

ينصح به الاشخاص المصابون بالوهن والهزل كذلك الوهن العقلي
والمصابون بفقر الدم كما انه مفيد جدا للاطفال بالاضافة الى فوائدة في مكافحة الاسهال.

عصير الخوخ :

غني جدا بفيتامين سين ومفيدا للمراهقين وينصح به دوما للذين يزاولون الالعاب الرياضية المرهقة.

عصير الكرز :

غني جداً بالعناصر المعدنية ومقوي لمفاصل الجسم كما ان شربه لمدة تزيد على يومين يسهل عملية طرد السموم والفضلات من الجسم.

عصير البرتقال:

ينصح به الاطفال والمراهقون في طور النمو كما ينصح به في فترة النقاهة بعد الاصابة بالحمى او الانفلونزا.

عصير التفاح :

مصدر للطاقة مدر للبول ملين ضد انقباض المعدة لغنائه بالاليفاف كما انه عصير محبب يعالج الكثير من الامراض.

عصير الليمون:

مفيد جدا للاطفال في طور النمو ولمكافحة امراض البرد والانفلونزا في فصل الشتاء

عصير التوت :

يعمل على تقوية وظائف الكبد وينظم الجهاز العصبي كما ينصح به المصابون بالنقرس الام المفاصل الروماتيزم للتخفيف من اوجاعها.

عصير الفراولة :

مرطب وملين اذ اخذ ممزوجا بالماء وقابض اذا اخذ بمفردة كما يوصف بشكل عام غرغرة ضد التهابات الحلق والبلعوم.

عصير العنب :

من افضل عصائر الفواكة لانه طارد للسموم وينصح به مرضى الكليتين والامعاء وامراض القلب وارتفاع ضغط الدم كما انه مزيل لاحتقانات الكبد
ويخفف من إلتهابات الجهاز الهضمي وهو ذو تاثير جيد في تنظيم الدورة
الدموية وينصح به الاشخاص المصابون ببعض انواع الحميات

nosa_aic
29 - 01 - 2012, 04:25
لماذا تتجعد الاصابع عندما يطول وضعها بالماء ؟


يغطي البشرة زيت طبيعي اسمه الدهن القلفي .

هذا الدهن يحفظ نعومة الجلد عن طريق حبس الرطوبة به و منع خروج السوائل منه فيجف ،

و اذا ابقينا ايدينا في الماء يتم غسل الدهن اي إزالته فيتجعد الجلد بمجرد أن تبتعد عن الماء بعض الوقت يفرز الدهن من

جديد و يعود الجلد الى حالته الطبيعية

nosa_aic
30 - 01 - 2012, 06:23
قشـــــــــــرة الفاكـــهة ..وماهي فوائدها الصحيه


من المعروف أن الفاكهة من النعم العظيمة التى تمدنا بالعديد من العناصر الغذائية المفيدة، لكن الغالبية منا لاتنتبه لما هو أكثر فائدة من الثمرة، وهو قشرة الثمرة التى تحتوى على عناصر غذائية لا حصر لها.

لذلك نلقى الضوء على أشهر أنواع الفاكهة المعتادة وما تحتويه قشورها من هبات يجب الانتباه لها للتمتع بالصحة الجيدة، ولكى نعلم أنه ما من شىء يخلقه الله إلا وله دوره فى حماية الإنسان من الأمراض وإمداده بكل ما يحتاج إليه جسمه من عناصر وقائية مفيدة.

ويكفى أن نعلم أن تناول كميات وفيرة من الفواكه والخضروات يوميا هى الطريقة الأكيدة لتقوية الصحة وحمايتها من أخطر الأمراض انتشارا، ومن هذه الأمراض:

- جميع أنواع السرطانات.

- السكتة الدماغية.

- أمراض القلب.

- أمراض السكر.

- البدانة.

لكن إذا قمت بتقشير الفاكهة والخضروات فسوف تفقد الكثير من تلك الفوائد العظيمة هباءا، وذلك لاحتواء تلك القشور على كنوز من الفوائد ومضادات الأكسدة والمساعدة على الحماية من ملوثات الجو، وتحسين التغذية، وحماية الجسم من الضغوط العصبية والنفسية وغيرها.

ويقع على قائمة تلك القشور التى تحتوى على أكبر كمية من الألياف لأنها مفتاح صحة الجهاز الهضمى والحماية من سرطان القولون، ومن أهم أنواع الفواكه والخضر التى تحتوى على قشور رائعة الفائدة الصحية هى:

1- قشور الفواكه الحمضية، تحتوى على قمة العناصر الغذائية وتشمل تلك الفواكه:

- الليمون.

- الجريب فروت.

- البرتقال.

- اليوسفى.

وتحتوى قشور هذه الفواكه على مكونات هامة مثل flavonoids و limonene و rutin، وفيما يلى تفصيل فوائد كل عنصر من هذه العناصر الثلاثة:

The Flavonoids:
ويفيد عنصر The Flavonoids فى الحماية من الأمراض الآتية:

- يقى من الحساسية.

- يقى من السرطان.

- يحتوى على مضادات الأكسدة.

- مضاد للالتهاب.

- مضاد للفيروسات الضارة.

كما أكدت العديد من الدراسات أن عنصر ال flavonoids يقلل من خطر الإصابة بأمراض القلب.

Limonene:
وهو عبارة عن مكون يتم استخلاصه من قشور الفواكه الحمضية، ويتميز برائحته الطازجة وفوائده المتعددة، حيث يقوم هذا الزيت المذهل بالحفاظ على صحة جسمك، ويعمل هذا المكون على تحفيز الكبد على القيام بعملية تخليص الجسم من المواد السامة، كما يحارب السرطان.

وأثبتت الدراسات أن هذا المكون يزيد من إنزيمات الكبد التى تساعد فى التخلص من السموم، ومنع الإصابة بالأورام داخل المعدة والرئة وأنسجة الثدى.

Rutin:
يعمل على مساعدة الجسم فى امتصاص الأملاح المفيدة مثل أملاح الحديد، كما يساعده فى الاستفادة من الفيتامينات الهامة مثل فيتامين سى.

2- قشر التفاح:

تنبهنا الأبحاث العلمية على أهمية قشر التفاح والذى يحتوى على مميزات ذات قوة هائلة، وهى:

Quercetin:
يوجد هذا العنصر بشكل مركز فى قشور التفاح، ويعرف بقدرته على علاج حمى القش، الإكزيما، التهاب الجيوب الأنفية والربو، كما يقلل من خطر الإصابة بأمراض القلب.

Triterpenoids:
يوجد هذا العنصر فى قشرة التفاح ويحتوى على المواد الواقية من السرطان، كما يقى من امتصاص الجلد لأشعة الشمس الضارة مثل UV-B

3- قشر الطماطم:

الذى يمنح قشرة الطماطم الفائدة الهائلة هو ما يمنحها اللون الأحمر، وهو عنصر الليكوبين Lycopene.

Lycopene:
وهو مضاد هائل للأكسدة، يوجد بشكل أساسى فى الطماطم المطهية حيث يرتبط ارتباط وثيق بالحماية من السرطان، كما يحارب تلف خلايا الجسم الذى يسبب الإصابة بالأمراض الانحلالية مثل أمراض القلب، التعرض للشيخوخة المبكرة، السرطان وماء العين، وقد أكدت العديد من الدراسات أن هذا العنصر يقى من الإصابة بسرطان البروستاتا.

ومن المهم أن نعرف أن فصيلة الدمم A وB لا تتجاوب بشكل جيد مع الطماطم، بينما تتجاوب فصيلتى O وAB مع فوائد قشرة الطماطم.

4- قشر الموز:

يمكن لقشرة الموز أن تستخدم فى العناية بالبشرة حيث يمكنها:
- إزالة النتوءات.

- تقليل الالتهابات والتورم الناتج عن لدغ الحشرات وخاصة البق.

- الوقاية من التجاعيد.

- الوقاية من داء الصدفية.

- علاج حب الشباب.

- علاج الطفح الجلدى الناتج عن التعرض للنباتات السامة.

- تحسين قوام وملمس البشرة.

وقد أعلن القدماء المصريون والرومان واليونان، عن علاقة الصحة والجمال بالفاكهة والعسل، وقشرة الموز وقدرتها الهائلة على تقليل التورم والتخلص من العدوى وإزالة التشققات والجفاف الذى يصيب البشرة.

وتحتل فاكهة الموز المرتبة الذهبية فى العديد من الدول لما تحتوى عليه قشورها من هبات لا حصر لها حيث تتميز بمنح الجسم الصحة والجمال معا.

إن تناول الموز بانتظام يساعد الجهاز الهضمى على العمل المنتظم، كما يعيد الطاقة للجسم ويمده بالعناصر الهامة لبناء خلاياه، وتحتوى قشرة الموز على العديد من مضادات الأكسدة والمعادن التى تساعد الجلد على استعادة حيويته بشكل طبيعى، كما تستخدم قشرة الموز فى علاج الكثير من أمراض البشرة ومنها الحساسية، والكدمات وتهيج الجلد، كما تحتوى المكونات الموجودة فى القشرة على البوتاسيوم، وغيره من العناصر التى تمنح البشرة النعومة والصحة.

قشرة الموز ومرض الصدفية:
إن جفاف البشرة وتكون القشور بها يعرف بمرض الصدفية، وهو عبارة عن مرض جينى يؤثر على الجلد والمفاصل، حيث تختلف حدة المرض من شخص لآخر، وقد تم استخدام قشرة الموز لعلاج هذا المرض منذ العديد من السنوات، حيث يؤدى استخدامها إلى النتائج الهائلة فى أيام أو أسابيع قليلة، كما يستعيد الجلد حيويته بسبب المرطبات والمواد المغذية التى تقلل من الحكة، وتقاوم تكون القشور عليه، لذلك يمكنك أن تمسحى المنطقة المصابة بالجزء الداخلى لقشرة الموز مرة أو مرتين فى اليوم وسوف تلاحظين الشفاء واختفاء أعراض الصدفية وعودة الجلد إلى حالته الصحية.

5- قشر الرمان:

أكدت العديد من الأبحاث العلمية أن قشرة الرمان تحتوى على كميات مضاعفة من مضادات الأكسدة عن الثمرة الداخلية للرمان، حيث تحتوى على العناصر الغذائية الآتية:

- الراتينج الفينولى phenolics و flavonoids و proanythocyanidins وهم من أقوى العناصر الغذائية التى تقى من العديد من الأمراض وتحتوى على مضادات الأكسدة.

واضافت أبحاث أخرى :أن الثمرة الداخلية للرمان تحتوى على 24 ملليجرام من عنصر الراتينج بينما تحتوى القشرة الخارجية له على 252 ملليجرام، كما تحتوى الثمرة الداخلية على 17 ملليجرام من ال flavonoids بينما تحتوى القشرة على 59 ملليجرام، وتحتوى الثمرة على 5 ملليجرام من عنصر ال proanythocyanidins بينما تحتوى القشرة على 11 ملليجرام.

تتميز قشرة الرمان باحتوائها على نسبة عالية من فيتامين C، كما تقى من أمراض القلب.

6- قشرة المانجو:

تعتبر المانجو من الفواكه التى تمنح الجسم العديد من العناصر الغذائية الهامة، ومن أهم ما تقدمه لنا المانجو :

- العناصر الموجودة فى القشرة الخارجية التى تحتوى على مواد غذائية تساعد البشرة فى استعادة الحيوية والنضارة والصحة.

- تعمل قشرة المانجو على تقشير الطبقة الخارجية الميتة من البشرة.

- منح البشرة النعومة.

- سرعة إعادة صحة خلايا البشرة.

- كما أن احتواء قشرة المانجو على مجموعة من المقويات مثل Alpha-Hydroxy aci-Lactic acid وL-Tartaric acid وL-Mandelic acid حيث تعمل كل تلك العناصر الهامة على إعادة الحيوية للبشرة بشكل عام، ومنحها المظهر الطبيعى الرائع.

nosa_aic
30 - 01 - 2012, 06:32
أسباب تكوٌن الحصى في المرارة

http://up.dlu3at.net/images/xrvo0ymp4kwibhkfj.jpg (http://www.dlu3at.net/vb/article51487.html)

يقدر خبراء الصحة أن أكثر من 14 في المئة من البالغين، حول العالم ، مصابون بحصى في المرارة أم أنهم عانوا منها ، في الماضي اليوم ، تظهر دراسة إيطالية ما هي أسباب تكوٌن هذه الحصى وما هي عوارضها التقليدية معطية بالتالي نصائح علاجية مفيدة ، في سياق متصل ، يوضح لنا البروفيسور فيستي ، أختصاصي في أمراض المعدة والأمعاء ، بعض جوانب هذه النتائج الهامة

ما هي أسباب تكوٌن الحصى في المرارة؟

ان 80 في المئة من حصى المرارة سببها الكولسترول ، وهي تعد تعبير ( سوية مع السكري والكبد المدهن والبدانة ) لما هو معروف باسم المتلازمة الأيضية ، يرتبط تكوٌن وتطور هذه الحصى بنمط الحياة ، وأبرز عوامل خطر الإصابة بها هي البدانة والنظام الغذائي المشبع بالسعرات الحرارية. كما تعتبر النساء الأكثر تعرضاً لهذا الخطر نتيجة نوع من الكسل يصيب المرارة ويرتبط بالحمل أم بالدورات الشهرية


ما هي العوارض المتعلقة بحصى المرارة ؟


ليس هناك عوارض أبداً في 80 في المئة من الحالات ! هناك بعض الاضطرابات كما الحرقة في المعدة أو الانتفاخ أو صعوبة الهضم بيد أن هذه الاضطرابات تتكرر بنفس الوتيرة لدى من هو غير مصاب بحصى المرارة ، أما الإصابة بالمغص فهي تتميز بوجع في فم المعدة أم في طرفها الأيمن ، يستمر هذا الوجع نصف ساعة أم ساعة بالكامل ولا يختفي حتى بعد التغوط ، ان هذا الحدث جرس إنذار يكفي لالتقاط صورة بالموجات الصوتية للمرارة بهدف تشخيص الإصابة المحتملة بالحصى


ماذا يستطيع المريض أن يفعل ؟


لا تكمن الاستراتيجية العلاجية الوحيدة في استئصال المرارة جراحياً بعد الإصابة بالمغص ، كما أن خطر إصابة المريض مجدداً بالمغص يرسو على 50 في المئة ، لكن المعطيات المتوافرة لدينا لا تخولنا الجزم ان كان المريض( أم فئة من المرضى ) سيعاني مجدداً من المغص أم لا ، في حال غياب التداعيات الصحية الخطرة على المريض ، يمكننا أن نتفادى مؤقتاً استئصال المرارة لاتباع استراتيجية علاجية مؤلفة من مراقبة صحية دورية( مع تعاطي الأدوية المناسبة ) ونصائح حول تحسين نمط الحياة الغذائي

nosa_aic
31 - 01 - 2012, 04:42
أهمية وجبة الأفطار للطفل

http://www.jamaluk.com/uploads/thumb/article_88c21335e945f4d01280842fadb39997.jpg (http://www.dlu3at.net/vb/article56900.html)




يتسبب إهمال الأطفال لوجبة الإفطار قبل الذهاب للمدرسة في الكثير من المشكلات الصحية، اذ تعتبر وجبة الإفطار للأطفال أفضل وسيلة لتزويد الطفل بالطاقة لكي يبدأ يومه قبل المدرسة بكل حيوية ونشاط، حيث أظهرت الدراسات أن الطفل الذي يتناول وجبة إفطار تتكون من سعرات حرارية متعادلة من النشويات المركبة والبروتينات تظهر لدية قدرة أكبر على التحصيل والإنجاز عن الطفل الذي يتناول إفطار يحتوي على نسبة أعلى من البروتين أو النشويات.

تتركز أهم الأسباب التي تجعل الطفل لا يقبل على تناول وجبة الإفطار فيما يلي:


1.تأخر الطفل في النوم، وبالتالي يتأخر في الاستيقاظ مما لا يمكن الطفل من تناول وجبة الإفطار.
2.عدم قدرة بعض الأمهات على تحضير وجبةالإفطار؛ نظراً لأن أبناءهن يذهبون إلى المدرسة في وقت مبكر ولا يوجد وقت كافٍ لتحضير الطعام.
3.انشغال الوالدين بأعمالهم وعدم توافر الوقت الكافي لتجهيز وجبة الإفطار للطفل قبل الذهاب للمدرسة.
4.عدم تعود الأسرة على تناول وجبة الإفطار، ومن ثم ينعكس هذا التعود على الأطفال فلا يتناولون وجبة الإفطار.


http://jamaluk.hawaaworld.com/uploads/image/5ece0f1e318b4b4f127cd7d391b5ee29.jpg (http://www.dlu3at.net/vb/article56900.html)

نصائح هامة حول إعداد وجبة الإفطار للطفل:

- الحرص على أن يكون الطعام المعد للطفل يوفر التغذية الآمنة والمتوازنة له، والتي تكفي احتياجات الطفل خلال وجوده في الحضانة أو المدرسة.

- مراعاة النظافة أثناء تحضير طعام إفطار الطفل، بحيث يحافظ على جودته وقيمته الغذائية.

- تنبيه الطفل بأن يضع طعامه في المبرد بالمدرسة؛ في حالة إذا ما كان الطعام يحتوي على البروتينات التي قد تفسد إذا أبقيت لمدة طويلة خارج المبرد.

- الاهتمام بأن تكون وجبة الإفطار شاملة لجميع أنواع الطعام كالجبن والخيار والفاكهة أو سندوتشات الدجاج والبطاطس.

- الابتعاد عن إعطاء الطفل المكسرات والشوكولاته والفستق؛ لأنها قد تسبب الحساسية له.

- تعويد الطفل على تناول اللبن بجميع منتجاته؛ لاحتوائه على الكالسيوم وفيتامين ب؛ الذي يساعد في التغلب على إحساس التعب عند الطفل.

- استبدال الخبز الأبيض بالخبز البلدي أما البطاطس المقلية الجاهزة (الشيبس) الذي ثبت حديثاً احتواؤه على نسب مرتفعة من مادة الأكرايل أميد المسرطنة؛ فينصح باستبداله بالبطاطس المقلية بالبيت بقليل من الزيت.

- إعطاء الطفل العصائر الطبيعية كالبرتقال أو الموز أو الجوافة أو المانجو أو بعض ثمار الفاكهة الطازجة المغسولة جيداً، ووضعها للطفل داخل أكياس نظيفة بعد تقطيعها لكي يأكلها الطفل بسهولة أثناء اليوم الدراسي.

nosa_aic
31 - 01 - 2012, 04:55
كيفية قياس الضغط .. بالصور والشرح ..


قلب الإنسان عبارة عن مضخه تدفع الدم القادم من الرئة إلى الجسم عبر الشرايين و تسحب الدم من الجسم و تدفعه للرئة عبر الأوردة بشكل منتظم على شكل دورة متتابعة ما بين
إنقباض و إنبساط وتسمى بالنبضات





http://imagecache.te3p.com/imgcache/f88cc618de3907b6d15c6c5cd67ed224.gif (http://www.dlu3at.net/vb/article45971.html)






ما هو ضغط الدم ؟

هو الضغط الذى يبذله الدم على جدار الاوعية الدموية سواء كانت شرايين او اورده او شعيرات دموية وهو ناتج من قوة دفع القلب للدم في الشرايين



قياس ضغط الدم :


يقاس ضغط الدم باستخدام جهاز يسمى



Sphygmomanometer





الجهاز من حزام داخله كيس يتم تعبئته بالهواء بواسطة مضخة هوائية يدوية و يتصل بالكيس جهاز قياس ( سواء كان سائل أو على شكل عداد ) ؛ كما تستخدم سماعة الأذن لسماع صوت جريان الدم أثناء القياس



الجهاز ياخذ قراءتين :
القراءة العلوية : تمثل الضغط الانقباضى Systolic Pressure .
الضغط الانقباضي : هو كمية الضغط الذي يولده القلب أثناء ضخ الدم خارج القلب عبر الشرايين "عند انقباض عضلة القلب
المعدل الطبيعي للضغط الانقباضي هو من 110إلى 139



القراءة السفلية : وتشير إلى الضغط الانبساطى Diastolic Pressure .
( الضغط الانبساطى ) : وهو الضغط السفلي حينما تسترخي عضلة القلب فينخفض ضغط الدم إلى حده الأدنى
المعدل الطبيعي للضغط الانبساطي هو من 70 إلى0 8


http://imagecache.te3p.com/imgcache/8d8bebdf9f19285e9fdd6a0f1b61190f.jpg (http://www.dlu3at.net/vb/article45971.html)




المعدل الطبيعي للضغط :
الضغط المثالي هو ان يكون أقل من 120/80 ملم زئبق، نشير بالرقم الأول "120" إلى الضغط الانقباضي (العالي) ،بينما نشير بالرقم الثاني "80"إلى الضغط الانبساطي
(المنخفض)
إذا كان قياس الضغط 140/90 ملم زئبق فما أعلى يعتبر ارتفاع في ضغط الدم
واذا كان قياس ضغط الدم أقل من 100/60 يعتبر عند الشخص انخفاض في ضغط الدم


طريقة قياس ضغط الدم :
1- الجلوس على مقعد مستندا الظهر إلى الخلف ووضع الأطراف العلوية على نفس مستوى القلب .
2- يتم ربط الحزام على اليد (فوق المرفق) بشكل جيد بحيث يكون طرف الحزام عند الخط الذي يظهر عند مفصل الكوع

http://imagecache.te3p.com/imgcache/f7e9f4fd064b6662e080d53f49380afe.jpg (http://www.dlu3at.net/vb/article45971.html)




3- ضع السماعة تحت الحزام وثبتها برفق - فوق أفضل مكان يسمع فيه الشريان ( أسفل الساعد مباشرة فوق مفصل الكوع وللداخل قليلا ) - يجب أن لا تضغط بشدة - أو تلمس
السماعة مثانة قياس الضغط أو الخراطيم .


http://imagecache.te3p.com/imgcache/52e0988fbe02833bb5488af1ef1846a8.jpg (http://www.dlu3at.net/vb/article45971.html)

4- أغلق صمام الهواء
5- ثم أنفخ المثانة الخاصة بجهاز قياس الضغط واستمر في نفخ الحزام حتى يتوقف الدم من الجريان و هنا لا يسمع للدم أي صوت في السماعة
6- أفتح صمام الهواء برفق بحيث يتم تفريغ الحزام من الهواء بالتدريج و بمجرد بدأ الدم في الجريان سيتمكن سماع صوته في السماعة عندها حدد النقطة "الرقم" التى تسمع عندها
صوت متكرر واضح على جهاز القياس ، هذا هو الضغط الانقباضى للدم .



http://imagecache.te3p.com/imgcache/896ea801ab733f1919f7b1c8c26fe0d3.jpg (http://www.dlu3at.net/vb/article45971.html)








ملاحظات مهمة :-
1- يجب ان يكون جهاز الضغط بمستوى الذراع لا اعلى ولا اسفل .

2- الضغط الجيد على السماعة وبالمكان المناسب ووضعها على الاذن بشكل جيد.
3- اعطاء فترة استراحة للمريض قبل قياس الضغط .
4- اعادة الفحص مرة ثانية وبعد فترة من الفحص الاول للتاكد .
5- يجب ان تكون اذني الشخص القائم بالفحص سليمتان .




اما بالنسبة للاجهزة الحديثة فهي تقوم بالعمل اتوماتيكيا وتظهر النتائج على شاشة صغيرة


http://imagecache.te3p.com/imgcache/cf5930351e8c46c2d615135e25cd2630.jpg (http://www.dlu3at.net/vb/article45971.html)







ولكن اغلب الناس لاترتاح لهذه الاجهزة وغالبا ماتحتاج لشخص مختص لابما ترتاح عندما تشكي له او يطمئنها بالكلام ( تاثير نفسي )



اقترحت منظمة الصحة العالمية أنه عندما يصل ضغط الدم عند الإنسان أكثر من 140/95 فإنه يعد غير طبيعي، وقد تم مؤخراً تصنيف وتقسيم ضغط الدم على حسب شدته وهو كالآتي:


التصنيف الضغط الانقباضي/ الضغط الانبساطي


Optimalالضغط المثالي 120/ 80
Normalالضغط الطبيعي 130 او اقل/ 85 او اقل
H.Normalالضغط فوق الطبيعي 130-139 /85-89
Grade-1ضغط مرتفع من الدرجة الاولى 140-159 /90-99
Grade-2ضغط مرتفع من الدرجة الثانية 160-179 /100-109
Grade-3ضغط مرتفع من الدرجة الثالثة 180 او اعلى/ 110 او اعلى




طريقة عمل الجهاز :


يتم ربط الحزام على اليد (فوق المرفق) بشكل جيد ثم يتم تعبئته بالهواء فيضغط الحزام على اليد مانعا مرور الدم في الشريان للجزء المتبقي من اليد و هنا سيضغط الشريان على سطح الحزام بمقدار الضغط المتولد فيه من جراء دفع القلب للدم وبذلك يمكن قياس التغير في ضغط الهواء داخل الكيس حسب تغير الضغط داخل الشريان






.

http://imagecache.te3p.com/imgcache/43021f0c4e8cba545540d0859b1555fc.jpg (http://www.dlu3at.net/vb/article45971.html)








(1)
بعد ربط الحزام يتم وضع السماعه على سطح اليد فوق الشريان و يتم نفخ الجزام حتى يتوقف الدم من الجريان و هنا لا يسمع للدم اي صوت في السماعه.






http://imagecache.te3p.com/imgcache/4d2e15faef4b6ce1540c8d281fddb334.jpg (http://www.dlu3at.net/vb/article45971.html)








(2)


يتم تفريغ الحزام من الهواء بالتدريج و بمجرد بدا الدم في الجريان سيمكن سمعا صوته في السماعه في حينها يتم قراءه الضغط على جهاز القياس و يكون هذا اعلى قرائه للضغط او الضغط العالي او ما يسمى ضغط الأنقباض



(3)


يتم الأستمرار في تفريغ الحزام تدريجا و سينخفض صوت جريان الدم كذلك في السماعه حتى يتم الوصول الى مرحله يختفي فيها صوت جريان الدم في السماعه حينها يتم قراءه الضغط في جهاز القياس و سيكون هذا الضغط المنخفض او ما يسمى ضغط الأنبساط

.

http://imagecache.te3p.com/imgcache/c0fae3b2dc7c8db7c8b5ac4eeab02f92.gif (http://www.dlu3at.net/vb/article45971.html)







الشروط الواجب توافرها عند قياس ضغط الدم :

إن ضغط الدم غير ثابت في كل الأحوال فهو يتغير باستمرار تبعاً لوضع الجسم والنشاط اليومي


اليكم بعض الشروط الواجب توافرها للحصول على قراءة صحيحة لضغط الدم

1- عدم التدخين وعدم تناول اي مشروبات محتوية على الكافيين على مدى 30دقيقة قبل قياس ضغط الدم.

2- الجلوس لمدة خمس دقائق مع جعل القدمين مسطحتين على الأرض قبل القياس مع جعل الذراعين مسترخيتين
على منضدة يقع مستواها عند مستوى القلب.
3- ارتداء أكمام قصيرة بحيث تكشف عن الذراعين لتسهيل قياس الضغط.
4- عدم مضغ العلك (اللبان)، وعدم التحدث أثناء قياس الضغط.
5- يجب الحصول على قراءتين بينهما دقيقتان على الأقل والحصول على المتوسط منهما.
6- إذا اختلفت القراءتان بمقدار يزيد عن 5 مم زئبق فيجب أخذ المزيد من القراءات.


وهناك عوامل تؤثر على قياس ضغط الدم :

1- ممارسة التمارين والاجهاد
2- الحالة النفسية .
3- وضعية الشخص الذي يريد قياس ضغط دمه.



ما ننصح به لمن يقيسون ضغطهم ويجدونه مرتفع:

اولا عليهم متابعة وقياس ضغط دمهم لمدة اسبوع وتدوينه
مع اتباع نظام حمية غذائية بتجنب الاكلات الدسمة والموالح.
اذا لم يلاحظ اي تغيير او هبوط في الضغط فعليه التوجه الى الدكتور ليصف له العلاج المناسب

nosa_aic
31 - 01 - 2012, 05:17
معلومات طبية مفيدة


✽اليانســون✽
http://thumbs.bc.jncdn.com/98b19cfe5d0c188caa34f15ac4ccc009_lm.jpg (http://www.dlu3at.net/vb/article54985.html)

يطرد البلغم – يسكن السعال والربو - يطرد الغازات- يقوى الكبد والطحال- يسكن مغص الأطفال-
يدر الطمث ويسكن آلامه و يقوى المبيض يدرالبول- يشفى الرمد بعمل كمادات للعين- يسكن الصداع والدوار- يفتت الحصى.




✽البابونــج✽
http://www.tamatart.com/wp-content/uploads/flya-032.jpg (http://www.dlu3at.net/vb/article54985.html)

يطرد الغازات - ينشط الهضم - يسكن التهابات الجهاز الهضمي والسعال وآلام المبايض - خافض للحرارة ينشط الكلى
يطهراللثة - يزيل ورم الجفون باستعماله موضوعيا - جيد للبشرة الدهنيةموضعيا.


✽الحلبــة✽
http://sohbetna.com/arab_articles_up/b27fab4.jpg (http://www.dlu3at.net/vb/article54985.html)

لو علم الناس ما في الحلبة لاشتروهابوزنها ذهبا لأنها تدر البول وحليب المرضع والطمث والعرق - تطرد البلغم والسعال
تسكن الربووالتهابات اللوز والمغص - تقوى جنسيا - تعالج الخراج موضوعيا وكذلك الاكزيما – يفتح الشهيه


✽الزنجبيــل✽
http://www.weqaia.com/wp-content/uploads/2011/02/ginger.jpg (http://www.dlu3at.net/vb/article54985.html)

يقوى المعدة والكبد - يطرد الغازات والبلغم والأملاح والماء الزائد بالجسم - يوسع الأوعية الدموية - يقلل الدهون بالدم
يقوى جنسيا - يقي من السموم والسرطان والصداع - ينظم الدورة الدموية - ينشط الغدة النخامية - يعالج النقرس



✽الكركديــة
http://site.iugaza.edu.ps/rhashish/files/2011/06/1042011-0c045.jpg (http://www.dlu3at.net/vb/article54985.html)

يقوى القلب والمعدة - يذهب الحموضة يمنع العطش - قاتل للبكتريا - مضاد للديدان - خافض للضغط اذا كان بارد•• رافع للضغط اذاكان ساخن
والحرارة - يفيد الربو والسل - يقي من تصلب الشرايين - ملين خفيف - يفضل شربة مع التمر الهندي


✽الليمــون✽
http://images.aarabladies.com/media/images/scandalous-lemons.jpg (http://www.dlu3at.net/vb/article54985.html)

يقاوم فساد الأطعمة - يقوى اللثة - فاتح للشهية - يدر البول - خافض للحرارة - يذيب الدهون - ينظم الضغط
يقي من البروستاتا - وتصلب الشرايين والصداع - والدوالي وحب الشباب يسكن الدوار يقوى الكبدوالقلب


✽النعنــاع✽
http://www.muslmah.net/imgpost/11/3bffd686011c8595402320845d4b55d4.jpg (http://www.dlu3at.net/vb/article54985.html)

يقوى المعدة والكبد - والقلب والبنكرياس- فاتح للشهية - يطرد الديدان والغازات - يسكن المغص - وآلم الطمث
وضيق التنفس - والصداع والتهابات البلعوم واللثة - والأسنان ومغص حصوةالمرارة



✽الشـاي الأخضـر✽
http://up.g4z4.com/uploads/6fbb550c3f.jpg (http://www.dlu3at.net/vb/article54985.html)
يقوى القلب - خافض للكلسترول - يدرالبول - يسهل العمل الذهني - والعضلي - يقوى العظام - يعمل على حرق الدهون .

✽الشعيـرالناعـم✽
http://up.i66i.com/uploads/13178581203.jpg (http://www.dlu3at.net/vb/article54985.html)

يذهب بعض الحزن ويدر البول - ينشط الكبد - يخفض السكر - والوزن - والضغط والدهون- يقوى المناعة- والمعدة يقي من الجلطة

nosa_aic
31 - 01 - 2012, 18:59
زيت السمك يقى من الأزمات القلبية

http://www.youm7.com/images/NewsPics/large/SAMA3200815142946.jpg (http://www.dlu3at.net/vb/article56418.html)
زيت السمك يساعد على كفاءة عمل الشرايين


أظهرت الأبحاث الطبية الحديثة أن تناول زيت السمك الغنى بمادة الأوميجا - 3 يعمل على الوقاية من الإصابة بالأزمات القلبية، خاصة بين المرضى الذين يعانون من تلف وتراجع فى كفاءة الشرايين.

ويرى الباحثون أن ارتفاع مستوى الأوميجا - 3 فى شرايين هؤلاء المرضى يساهم بصورة كبيرة فى الحيلولة دون وقوعهم فريسة لإصابة بالأزمات القلبية الخطيرة، وهو ما يلعب دوراً مهماً فى تجنب حدوثها، مؤكدين أهمية احتواء النظام الغذائى المتبع لهؤلاء المرضى على كميات وفيرة من الأوميجا -3.

وتوضح الأبحاث أن أجسامنا تفرز كميات ضئيلة من مادة الأوميجا-3 والأحماض الأمينية، وهو ما نحتاج معه فى كثير من الأحيان لتناول أغذية غنية بهذه المواد والمتواجدة بوفرة فى أسماك السالمون والتونة وغيرها من المنتجات البحرية، أو تناولها فى صورة مكملات غذائية لما لها من تأثير إيجابى على تجنب أمراض القلب وتحسين كفاءة أداء الشرايين

nosa_aic
31 - 01 - 2012, 19:12
موسوعة شاملة عن الفشل الكلوى


http://www.7elm3aber.com/up/images/57202158159813917540.gif (http://www.dlu3at.net/vb/article55789.html)



الفشل الكلوي Renal failure

هناك نوعان من الفشل الكلوي

الفشل الكلوي الحاد acute renal failure
والفشل الكلوي المزمن chronic renal failure. والفشل الكلوي بصفة عامة هو حدوث قصور في عمل الكلية ووظائفها مما يؤدي إلى اختلال عام في جسم الإنسان. وسوف نتطرق إلى كلً من النوعين بشيء من التفصيل.



الفشل الكلوي المزمن Chronic renal failure


في معظم حالات الفشل الكلوي المزمن يتحطم عدد كبير من النفرون Nephron (وحدة عمل الكلية) والباقي لا يكفى لقيام الكلية بعملها، وفي الغالب يكون نتيجة إصابة الكلى لفترة طويلة من الزمن.



الأسباب المؤدية للفشل الكلوي المزمن ..


التهاب الكلى Glomerulonephritis
لا يعرف السبب الحقيقي لهذه الإصابة إلا أن إصابة الجسم بالميكروبات يؤدي إلى اختلال في الجهاز المناعي للجسم لتتكون مولدات الأجسام المضادة antigen ونتيجة لذلك يقوم الجسم بتكوين مضادات الأجسام antibodies ليتسرب الناتج في أغشية الكبيبات glomeruleالكلوية.
انسداد المجاري البولية كوجود الحصوة في الحالب أو المثانة أو الإحليل وكتضخم البرستاتة وقد سبق شرحها في موضوع الفشل الكلوي الحاد.

ارتفاع ضغط الدم ومرض السكري Hypertension & Diabetes
إن نسبة قليلة من حالات ضغط الدم ومرض السكري تنتهي بإصابة الكلى إصابة تؤدي إلى الفشل الكلوي. ولكن إصابة الإنسان بارتفاع ضغط الدم أو السكري تؤدي مع مرور الزمن إلى ضيق الشرايين المغذية للكلية وبالتالي يحصل ضمور في منطقة القشرة للكلية مما يؤدي إلى إصابة الكليتين بالفشل الكلوي المزمن.

الاستخدام المفرط لبعض الأدوية
إن الإفراط في استخدام الأدوية والمسكنات بالذات (استخدامها لفترة طويلة وبجرعات عالية) من أهم الأسباب المؤدية إلى الفشل الكلوي حيث أنها تصيب نخاع الكلية الذي يصب في حوض الكلية مما يؤدي إلى موتها وإليكم بعض أهم العقاقير المسببة لإصابة الكلية بالفشل:
الأدوية المسكنة مثل الباراسيتامول والأسبيرين والفيناسيتين وغيرها.

أدوية الروماتيزم مثل الفينوبروفين والإندوميثاسين والنابروكسين وغيرها.

بعض المضادات الحيوية أهمها مشتقات الأمينوجلايكوزايد Aminoglycosides.
الصبغات الخاصة المستخدمة في الأشعة.

الأدوية المستخدمة لعلاج السرطان

الأدوية المستخدمة في التخدير.

التهاب حوض الكلية المزمن Chronic Pyelonephritis


ويحدث عادة نتيجة ارتفاع البول إلى الحالب (نتيجة عيب خلقي يمكن علاجه جراحياً أو إذا تم حبس البول متعمداً عدة مرات ولفترات طويلة) ومنه إلى حوض الكلية مما يؤدي إلى تكرار الالتهابات الميكروبية التي بدورها تقوم بتحطيم نسيج حوض الكلية ونخاعها وينتهي الأمر بالفشل الكلوي.



ما هي أعراض وعلامات المرض؟

قد لا يشعر المريض بأي أعراض لفترة طويلة ولكن من أهم الأعراض المصاحبة للمرض هي:
الشعور بالتعب والإرهاق الجسدي والذهني
قلة الشهيه للطعام
صعوبة في التنفس
الضعف الجنسي
كثرة التبول (خاصةً ليلاً).
كما أن المريض قد يصاب بفقر في الدم أو ارتفاع في ضغط الدم والتهاب في الأعصاب الطرفية (تنميل) ونتيجة لنقص فيتامين د بصورته النشطة يصاب المريض بلين في العظام.

أسئلة يوجهها لك الطبيب أو تناقشها معه :


- هل تتبع النظام الغذائي السليم . وهل تم شرح هذا النظام لك بوضوح ؟
- ما مستوى الطاقة والنشاط في جسمك ؟ وهل تغير منذ زيارتك الأخيرة ؟
- هل لديك نقص في شهيتك أو نقصان في الوزن أو غثيان أو قيء ؟
- هل تجد صعوبة في النوم ليلآ ؟
- هل تجد صعوبة في التركيز أو ضعفآ في ذاكرتك ؟
- هل تجد ألمآ في الصدر أو قصر في النفس ؟
- هل تشعر بحكة في الجلد ؟
- هل تشعر بالبرد ؟
- هل تتبول أكثر أو أقل من المعتاد ؟
- هل تتناول أدويتك أو أية أدوية تصرف دون تذكرة طبية ؟
- هل المرض الكلوي الذي تعاني منه وراثي ؟ وهل يجب اختبار افراد عائلتك ؟
- هل بوسعك فعل أي شيء للحد من تقدم المرض ؟
- هل تحتاج إلى غسيل كلى ؟
- هل أنت في حاجة ( وهل يمكن أن تصبح مؤهلآ ) لأن يجرى لك زرع للكلية ؟ وكيف يتسنى وضعك في قائمة من تزرع لهم كلية ؟ هل يمكن أن يتبرع لك احد افراد عائلتك بإحدى كليتيه ؟ هل يمكن أن يتبرع شريك ( أو شريكة ) حياتك أو أحد أصدقائك بكلية لك ؟


قد يفحص الطبيب اجزاء جسمك أو ظائفه التالية :
- معدل دقات القلب ، و ضغط الدم ، و الوزن
- العينين
- اوردة الرقبة
- النبض
- القلب و الرئتين
- البطن ( لمعرفة ما إذا كان موجعآ عند الضغط برفق )
- الكاحلين و الساقين ( للكشف عن التورم )
- درجة الانتباه و التركيز


قد يأمرك الطبيب بإجراء الاختبارات المعملية و الابحاث التالية :- اختبارات الدم لقياس مستويات المعادن و الاملاح ( مثل الصوديوم ، البوتاسيوم ، الكلوريد ، البيكربونات ، الكالسيوم ، المغنيسيوم ، و الفوسفور )
- اختبارات وظائف الكلى ( مثل نيتروجين اليوريا و الكرياتينين في الدم )
- احصاء كامل لعدد خلايا الدم الحمراء ( للكشف عن الأنيميا )
- تجميع البول على مدى 24 ساعة ( للكشف عن الكرياتينين و البروتين ( بصفة دورية فقط ))

كيف يشخص الفشل الكلوي المزمن؟


يتم تشخيص مرض الفشل الكلوي من الفحوصات السريرية السابق ذكرها مع بعض الفحوصات المخبرية مثل ارتفاع نسبة البولينا urea والكرياتينين creatinine في الدم كما أن تصفية الكرياتينين من البلازما ينخفض مستواها إلى 30 مليلتر من أصل 120 مليلتر.



ويحتاج الطبيب إلى تشخيص مرض الفشل الكلوي ودرجة شدته (عن طريق أخذ عينة من كلية المريض لفحصها) وذلك ليقرر ما إذا كان المريض وصل إلى مرحلة متقدمة وهل يحتاج إلى عملية الغسيل الكلوي أو إلى عملية زرع كلية أم لا.


ما هو علاج الفشل الكلوي المزمن؟



علاج الفشل الكلوي المزمن يتضمن الحمية الغذائية، الأدوية، الغسيل الكلوي، أو زرع الكلى.
الحمية الغذائية
أهم ما في الحمية الغذائية لمريض الفشل الكلوي هو خفض كمية البروتينات (الموجودة في البيض واللحوم والبقوليات) التي يتناولها والتعويض عنها بالسكريات والنشويات أو الدهون، وكذلك خفض كمية ملح الطعام والبوتاسيوم (الموجودة في المكسرات والموز والبرتقال والمندرين والجريب فروت) .
الأدويةيعطى المريض الأدوية التالية:
فيتامين (د) vitamine D لتعويض نقصه.
شراب هيدروكسيد الألمونيوم Aluminium hydroxide وذلك لمنع امتصاص الفوسفات الذي تكون نسبته عالية عند مرضى الفشل الكلوي.
حقن الإريثروبيوتين Erythrobiotin لعلاج فقر الدم.
أدوية تخفيض ضغط الدم.



الغسيل الكلوي (الإنفاذ) أو (الديلزة Dialysis)
وهي عبارة عن عملية تنقية الدم من المواد السامة بمعاملته مع محلول سائل الإنفاذ dialysing fluid (يشبه تركيبه تركيب البلازما). وهناك نوعان من الغسيل الكلوي:
الإنفاذ البيروتوني (الخلبي) Peritoneal dialysis والذي يستخدم به الغشاء البريتوني (الموجود في جوف البطن كغطاء لجدار البطن والأحشاء) كفاصل بين سائل الإنفاذ والدم وتتم الطريقة كالآتي:
يغرز في أسفل البطن (تحت السرة وفوق العانة) قسطره خاصة canula بعد التخدير الموضعي، ثم يتم تسريب سائل الإنفاذ من خلالها (لتر واحد أو لترين) إلى جوف البطن ويترك لبضع ساعات (4-5 ساعات) ونتيجة لفرق التركيز بين سائل الإنفاذ والدم تنفذ المواد السامة إلى السائل من خلال الشعيرات الدموية الموجودة في جوف البطن (في غشاء البيرتون) ومن ثم يصرف السائل إلى الخارج وتتكرر هذه العملية عدة مرات في اليوم مع الأخذ بعين الاعتبار وجوب توقف العملية أثناء نوم المريض.


تمتاز هذه الطريقة بسهولتها وقلة تكلفتها وعدم حاجتها إلى الآلات المعقدة، فالمريض لا يحتاج إلى الحمية الغذائية ولا إلى التنويم في المستشفي حيث يمكن بالتدريب أن يقوم بالعملية بنفسه في البيت.
ومن أهم وأخطر عيوب هذه الطريقة (مما يجعلها غير منتشرة إلا في أوروبا وأمريكا) هي إمكانية حدوث التهاب بيريتوبي للمريض إذ أنها تحتاج إلى درجة عالية من التعقيم وتدريب المرضى عليها.
الإنفاذ الدموي (غسيل الكلى) أو الديلزية الدموية haemodialysis تتم هذه الطريق بإخراج دم المريض من جسمه وتمريره عبر جهاز الإنفاذ الذي يقوم بتنقيته ثم يتم إعادته إلى جسم المريض. وجهاز الإنفاذ يحتوي على غشاء رقيق يسمى المنفاذ dialyser الذي يفصل بين الدم وسائل الإنفاذ، كما يحتوي على غشاء نصف نفوذ Semipermeable والذي يسمح بمرور مواد معينة من الدم إلى سائل الإنفاذ.


كما أن الجهاز يحتوي على مضخة لضخ الدم في جهاز الإنفاذ ومن ثم إعادته إلى المريض، ويحتوي أيضاً على مصيدة الفقاعات الموجودة في الدم التي يمكن أن تسبب مضاعفات خطيرة للمريض إذا ما عادت إلى الدورة الدموية. كما يحتوي على عدة أجهزة إنذار للتنبيه إذا ما حدث خطأ ما في دائرة الإنفاذ.


ومن ميزات هذه الطريقة كفاءتها العالية في التخلص من السموم المتراكمة في الجسم. ومن عيوبها تكلفتها العالية ووجوب عملها في المستشفي مرتين إلى ثلاث مرات أسبوعيا، في كل مرة يبقى المريض دون حراك لفترة ما بين 4-5 ساعات كما أن المريض يشعر بضعف جسدي وجنسي، كما أن هذه الطريقة تعتبر العامل الرئيسي في نقل الفيروس المسبب لالتهاب الكبد الوبائي (ب) B و (ج) C.
زرع الكلى Kidney transplantation


هل تعلم أن :
حوالي 50-60 شخص من كل مليون شخص في العالم يشكو من الفشل الكلوي النهائي الذي يحتاج إلى عملية الغسيل الكلوي أو عملية نقل الكلى.
تكلفة عملية زراعة الكلى في أمريكا حولي ثلاثون ألف دولار
أكثر من تسع آلاف عملية زرع كلى تتم سنويا في أمريكا وحدها .
لقد بدأت المحاولات الأولى لزرع الكلية منذ بداية القرن العشرين ولكن كلها بائت بالفشل وذلك نتيجة رفض الجسم للكلية المزروعة إلى أن تم البدء في اكتشاف الأدوية المستخدمة لمنع الجسم من رفض الكلية المزروعة Immuno-suppressants في بداية الستينات، مثل البريدنيزولون Prednisolone، الأزاثيوبرين Azathiopurine و السيكلوسبورين Cyclosporine حيث أنها تخفض مناعة الجسم.
وقد انتشرت هذه العمليات بعدها وكانت نسبة نجاحها بعد مرور عام عن العملية تصل إلى حوالي 95 في المائة إذا كان المتبرع حي ومن أحد أقرباء المريض وحوالي 80 في المائة إذا كانت الكلية من شخص متوفى.
ومن محاسن هذه العملية أنها تحسن من مستوى حياة المريض مقارنة بعملية الغسيل الكلوي الذي يجب أن يرتبط بجهاز الإنفاذ ثلاث مرات أسبوعياً، فيستطيع بذلك السفر بحرية أكبر ويزيد من قدرته على العمل والإنتاج، ويستعيد قدرته أو قدرتها الجسدية والجنسية وتتحسن حالته النفسية، وأيضاً إذا نظرنا إلى كلفة عملية زرع الكلى وكلفة عملية الغسيل الكلوي على المدى البعيد فإننا نجد أن الكلفة النهائية لعملية الغسيل الكلوي أعلى من كلفة زرع الكلية.

كيفية اختيار المرضى والمتبرعين لزرع الكلية

اختيار المرضى

يجب أن يكون المريض مصاب بالفشل الكلوي النهائي
أن يكون سنه فوق الخمسة سنين وأقل من ستين
أن يكون خالي من بعض الأمراض كالسرطان الذي لم يتم السيطرة عليه أو مرض الإيدز
أن لا يكون سبب الفشل الكلوي لديه ناتجاً عن الأمراض المناعية اختيار المتبرعين
أن يكون المتبرع بالغاً ولا يزيد عمره عن الستين وأن تكون صحته العامة جيدة.
أن يكون قد تبرع بكليته بمحض إرادته دون الضغط عليه ويفضل أن يكون أحد أقرباء المريض أو أصدقائه المقربين.
أن تكون كليتاه سليمتين.
أن لا يكون المتبرع مصاباً بمرض السكري أو ضغط الدم أو بالسرطان أو حاملاً لمرض معدي كالإيدز أو التهاب الكبد الوبائي وغيرها.
أن يخضع لفحوصات معينة مثل فحص الدم وفحص تطابق الأنسجة.
إذا كان المتبرع من الموتى انطبقت عليه نفس الشروط السابقة بالإضافة إلى أن يكون المتوفى قد أوصى بذلك أو أخذت موافقة الورثة على ذلك.




الفشل الكلوي الحاد Acute kidney failure


الفشل الكلوي الحاد هو الفقدان المفاجيء لوظائف الكلى ، وهو يصيب حوالي 3 اشخاص من كل 10 آلاف شخص في الولايات المتحدة كل عام .
الفشل الكلوي الحاد يمكن أن يسبب حالة خطيرة مهددة للحياة من تراكم السوائل والنفايات في الجسم وما يتبعها من اختلال لتوازن الكيماويات ( التي تقاوم الكلى السليمة بتنظيمها في الحالة الطبيعية ).


اكثر اسباب الفشل الكلوي شيوعآ هو الهبوط المفاجيء في تدفق الدم في الكليتين الناتج عن النزيف الزائد ( ويشمل ما يحدث أثناء العملية الجراحية ) أو الصدمة أو الجفاف الشديد .
كما يمكن أن ينتج الفشل الكلوي الحاد عن الادوية التي تسبب الالتهاب الكلوي البيني ، أو عن تضيق الشريان الكلوي أو عن انسداد أو اعاقة خروج البول من الكليتين ، وهذا يمكن أن يحدث في حالات تضخم البروستات أو اورام المثانة ، أو عن الامراض التي تبدأ في الكلى مثل الالتهاب الكلوي الكبيبي .


الفشل الكلوي الحاد يمكن أن يهدد الحياة إذا لم يعالج ، قد يكون من الضروري إجراء غسيل للكلى ( وهو الاجراء الذي يتم أحيانآ بصفة مؤقتة ) .
الفشل الكلوي الحاد يمكن عادة شفاؤه إذا تم علاج سبب حدوثه .


إحتمال الوفاة يكون أعلى بين المسنين والاشخاص الذين يتناولون عقاقير مثبطة لجهاز المناعة ، والاشخاص الذين يعانون من أمراضآ مزمنة خطيرة مثل امراض الكبد والقلب أو الرئتين .

الاعراض :

قد تشتمل اعراض الفشل الكلوي الحاد النقص الهائل في انتاج البول والغثيان والقيء وفقدان الشهية و النعاس و الصداع
وقد تتورم الساقان مع تراكم السوائل .
وقد تظهر تغيرات ذهنية مثل الاعياء والهياج والارتباك وتقلبات المزاج .
يجب ملاحظة أن الإرتباك والنعاس يسبقان الغيبوبة في المرضى الذين لا يتم علاجهم .


تعتمد الأعراض الأخرى على الحالة التي تسبب الفشل الكلوي ، ففي بعض الأشهاص قد لا يكون ثمة أعراض على الإطلاق ، وقد يتم تشخيص التغير في وظائف الكلى في شخص ما عندما تجرى له اختبارات الدم لسبب آخر .


أسباب الفشل الكلوي الحاد :


- هبوط وخيم في ضغط الدم بسبب عدوى حادة أو فقد للدم أو نوبة قلبية
- اضطرابات حادة للكلية
- عقاقير سامة للكليتين
- بعد الجراحات المعقدة
- انسداد في الاوعية الدموية المتجهة للكلية
- صدمات أو حروق أو جروح حادة
- بعض الادوية

خيارات التشخيص :


إذا كنت تعتقد أنك مصاب بفشل كلوي حاد ، فإتصل بالطبيب أو إذهب للمستشفى وسوف يجري لك الطبيب اختبارات لدمك وبولك ، والتي ستكشف عما إذا كان لديك فشل كلوي أم لا ( ولكنها لا تكشف بالضرورة عن سببه ) .
كما يقيم الطبيب حالتك لمعرفة الاختلاجات الناتجة عن تدهور وظائف الكلى .
قد تحتاج أيضآ إلى أخذ عينة من الكلية لفحصها .
أو فحص بالموجات فوق الصوتية لكليتيك وبطنك أو تصوير البطن بأشعة إكس أو بالاشعة المقطعية بالحاسب الآلي أو بالرنين المغناطيسي
العلاج :

هدف العلاج هو إيقاف تقدم الفشل الكلوي عن طريق علاج الحالة المسببة له ، وهذا غالبآ ما يشفي المرض في قليل من الأيام أو الأسابيع أو الشهور حسب الحالة المسببة .


من الضروري أيضآ منع تراكم السوائل و النفايات الزائدة ، وقد يتم تحديد ما تتناوله من بروتين لتمنع كليتيك من الإضطرار إلى التعامل معه ، وقد تعطى مدرات البول لزيادة إخراج السوائل من الجسم .


قد تستخدم عقاقير أخرى للتحكم في مستوى البوتاسيوم في الدم ، وقد تحتاج إلى غسيل الكلى إذا كان التلف الكلوي شديدآ .

السكر والفشل الكلوي


رغم ارتفاع احتمالات إصابة مرضي السكر بالفشل الكلوي‏,‏ إلا أن الكثير يمكن فعله للوقاية من ذلك‏,‏ وأولي خطوات الفعل الصحيح للوقاية من مضاعفات أي مرض مزمن هي التعرف علي عوامل الخطورة التي بوجودها لدي المريض ترتفع احتمالات حدوث ذلك التداعي‏,‏و ضمن عدد الأسبوع الأخير من شهر أكتوبر الماضي لمجلة‏'‏ رعاية السكر‏'‏ الصادرة عن رابطة مرض السكر الأمريكية‏,‏ عرض الباحثون الألمان نتائج متابعاتهم للعوامل التي تشكل خطرا في ارتفاع احتمالات إصابة مرضي السكر من النوع الأول بالفشل الكلوي‏,‏ وأكدوا علي أن ارتفاع ضغط الدم وارتفاع نسبة سكر الجلوكوز في الدم وكون المريض ذكرا وطول أمد الإصابة بالسكر‏,‏ هي العوامل الأهم في التأثير السلبي لمرض السكر في عمل الكلي والوصول بها إلي مرحلة الفشل‏.‏


وأكدت الدراسة المعلومات العلمية السابقة حول دور الاضطرابات المصاحبة للإصابة بالسكر في الوقاية من مضاعفات المرض البالغة الضرر علي الأعضاء المستهدفة‏.‏




ومن أهم عوامل الخطورة في حصول الضرر في أعضاء مستهدفة كالقلب والدماغ والكلي لدي مرضي السكر‏,‏ هو تلك الاضطرابات المصاحبة للسكر مثل ارتفاع ضغط الدم وارتفاع الكولسترول الخفيف والدهون الثلاثية‏.‏




تضيق أو انسداد الشريان الكلوي Renal Artery Stenosis



هي حالة تضيق او انسداد او الاثنين معاً تصيب الشريان الكلوي وهو الوعاء الدموي الرئيسي الذي يغذي الكلية بالدم .


يسبب تدهور توارد الدم تفاعلاً تسلسلياً كيميائياً وهرمومونياً يمكن ان يؤدي الى ارتفاع ضغط الدم او فشل كلوي مزمن .


قد ينتج تضيق الشريان الكلوي عن تغلظ جدار الشريان ( حالة من سوء التكوين الليفي العضلي لهذا الجدار ) او عن انسدادات داخل الشريان بسبب البلاكات ( اللويحات ) الناتجة عن حالة التصلب العصيدي للشرايين .


حالة سوء التكوين الليفي العضلي تحدث اكثر في النساء و صغار البالغين من الشباب ، اما تصلب الشرايين أساساً في كبار البالغين أي كبار السن .


الأعراض :


لا توجد عادة أي أعراض ، وقد يكتشف تضيق الشريان الكلوي أثناء استقصاء حالة ارتفاع في ضغط الدم أو انخفاض في وظائف الكلى .


خيارات التشخيص :


قد يشك الطبيب بوجود حالة تضيق بالشريان الكلوي إذا كنت تعاني من ارتفاع في ضغط الدم او إذا استمع من خلال سماعته الى صوت ضجيج غير طبيعي يسمى طبياً لغط (bruit ) او حفيف يحدث مع كل دقة للقلب كلما دُفع الدم عبر منطقة الانسداد .


قد يُجرى مسح تصويري بالرنين المغناطيسي للكلية لمعاينة تدفق الدم من خلال الشريان ، وللبحث عن منطقة التضيق .


يمكن أن يكشف الفحص بالموجات فوق الصوتية عن حجم الكلية الذي يكون غالباً أصغر بسبب انخفاض تدفق الدم .


قد يُجرى تصوير الشرايين بالاشعة لتحديد موضع الانسداد او التضيق بدقة أكثر .


خيارات العلاج :


يهدف العلاج الى التحكم في ضغط الدم و استعادة تدفق الدم الى الكلية .


يمكن عن طريق الادوية كبح ارتفاع ضغط الدم ، كما يمكن بالجراحة توسيع الشريان الضيق .


قد ينصح الطبيب بإجراء عملية التوسيع الشرياني بالبالون ، وفيها يتم إدخال قسطرة في طرفها بالون صغير و توجيهها من خلال أحد شرايين الساق حتى تصل الى الشريان الكلوي الضيق ثم يتم نفخ البالون ليتمدد و يضغط على جدر الشريان الضيق من الداخل الى الخارج و بهذا تتسع قناته الداخلية .


كبديل لهذا ، قد تجرى جراحة التخطي لاستئصال الجزء التالف من الشريان و إعادة توصيل النهايتين السليمتين .


في حالات نادرة يكون من الضروري إستئصال الكلية لمنع ارتفاع ضغط الدم .

nosa_aic
01 - 02 - 2012, 21:18
أغذية مفيدة لتقوية المناعة


http://media.kenanaonline.com/photos/1237981/1237981129/large_1237981129.jpg?1254288998 (http://www.dlu3at.net/vb/article52331.html)
للحصول على جهاز مناعة قوي وصحي تأكد من أن تشمل الأطعمة التالية في حميتك الغذائية
حتى تتجنب الكثير من الأمراض ولتتمتع بحياة ملؤها الصحة والعافية:
http://media.kenanaonline.com/photos/1237981/1237981126/large_1237981126.jpg?1254295311 (http://www.dlu3at.net/vb/article52331.html)
- الليمون والطماطم والبطاطا الحلوة: هذه الأغذية غنية جدا بموانع الأكسدة ومركبات
ألبيتا كاروتين بالإضافة إلى احتوائها على كميات عالية من فيتامين C.
http://media.kenanaonline.com/photos/1237981/1237981134/large_1237981134.jpg?1254289199 (http://www.dlu3at.net/vb/article52331.html)
- شوربة الدجاج: تساعد هذه الشوربة في مقاومة مختلف أنواع الفيروسات المسببة للزكام عن طريق طرد البلغم خارج الجسم ولا زال العلماء غير قادرين على تحديد العامل الحاسم الذي يسبب هذه الظاهرة.
http://media.kenanaonline.com/photos/1237981/1237981127/large_1237981127.jpg?1254288963 (http://www.dlu3at.net/vb/article52331.html)
- الثوم: لهذا النبات فوائد صحية كثيرة أهمها قدرته على زيادة قدرة الجسم على إنتاج أجسام مضادة لمقاومة الأمراض كما أن له قدرة على مقاومة الفطريات ويعمل كمضاد حيوي للجسم.
http://media.kenanaonline.com/photos/1237981/1237981131/large_1237981131.jpg?1254289040 (http://www.dlu3at.net/vb/article52331.html)
- السوائل: كثرة تناول السوائل تؤدي إلى غسل الجسم من كل الأوساخ وخاصة البكتيريا.
لذلك ينصح عادة بتناول ثمانية كؤوس من الماء يوميا لضمان حصول الجسم على كميات كافية من السوائل وفي حالة المرض ينصح بتناول ضعف هذه الكمية من السوائل.
http://media.kenanaonline.com/photos/1237981/1237981133/large_1237981133.jpg?1254289150 (http://www.dlu3at.net/vb/article52331.html)
- التوت: هذه الفاكهة مفيدة جدا لأنها غنية بموانع الأكسدة كما أنها تعد مقاوم طبيعي لالتهابات المثانة والتقرحات بالإضافة إلى الوقاية من أمراض القلب والسرطان.
- الدهون الصحية: مثل زيت الزيتون والدهون الموجودة في الأسماك والافوكادو والمكسرات كل هذه المواد تساعد جهاز المناعة وتقويه.
http://media.kenanaonline.com/photos/1237981/1237981135/large_1237981135.jpg?1254295594 (http://www.dlu3at.net/vb/article52331.html)
- العسل: من آلاف السنين يعد العسل دواءاً طبيعيا لعلاج جميع الأمراض فهو يقتل البكتيريا ويعالج التهاب الحنجرة والأذنين كما يحافظ على صحة الجلد ويساعد في الهضم. هذا ومن جانب آخر، ومع التقدم السريع للعلم الحديث، استطاع العلماء التوصل إلى المكونات التي تعطي الأغذية خاصيتها المفيدة. حيث يضيف الخبراء بأن البشر اصبحوا يتناولون الحبوب التي تعوض النقص في البروتين بشكل مطرد و ذلك بسبب نقص كمية البروتينات التي يتم تناولها عن طريق الأغذية العادية. و يرجع السبب في انخفاض القيمة الغذائية لمأكولاتنا إلى انتشار الهندسة العضوية التي بدأت في التأثير على الصفات الأساسية للمنتجات الزراعية أثناء سعيها الحثيث إلى زيادة الإنتاج. بالإضافة إلى الزراعة في الظروف الاصطناعية والطريقة الخاطئة في الطبخ ، كل ذلك أدى إلى تجريد المنتجات الزراعية من الكثير من خواصها الغذائية المفيدة. كذلك اتباع الحميات الغذائية و القلق و المرض يزيد من استهلاك الفيتامينات في أجسامنا لذلك إذا أردت تجنب السرطان و الأمراض الأخرى المتفشية في هذا العصر عليك بتناول الأغذية ذات الفائدة الغذائية العالية.
http://media.kenanaonline.com/photos/1237981/1237981136/large_1237981136.jpg?1254289328 (http://www.dlu3at.net/vb/article52331.html)
- الصويا: تعتبر الصويا من افضل أنواع الحبوب فائدة للبشر. فقد توصل العلماء إلى إثبات فوائدها الكبيرة في الوقاية من امرض القلب والسرطان ومشاكل عسر الهضم. كما تخفض من آلام انقطاع الطمث وتزيد من الوقاية ضد هشاشة العظام.

- الثوم: يستخدم الثوم كنبات علاجي منذ فجر التاريخ، وذلك لما تحويه هذه النبتة من فوائد علاجية كثيرة. فالثوم يعتبر من اكثر النباتات مقاومة للبكتيريا والفطريات.
فالثوم اثبت فعالية عالية في مقاومة البرد و العدوى من الأمراض الأخرى ومنها السرطان. الثوم مفيد للقلب كما أنة يقوي الأوعية الدموية و يخفض نسبة الكوليسترول في الدم و يخفض كذلك من ضغط الدم المرتفع.
- البروكلي: نبات عظيم الفائدة لاحتوائه على نسبة عالية جدا من الألياف و الفيتامينات. لكن المفيد جدا في هذا النبات هو احتوائه على نسبة عالية جدا من مادة (sulforaphane) المقاومة للسرطان. لذلك ينصح الأطباء بان يتم تناول البروكلي بشكل يومي مع الطعام العادي.
http://media.kenanaonline.com/photos/1237981/1237981137/large_1237981137.jpg?1254295760 (http://www.dlu3at.net/vb/article52331.html)
الشاي الأخضر: هذا الشاي يحتوي على مادة (polyphenols) والتي تعتبر من اكثر المواد المقاومة للأكسدة. كذلك تعتبر هذه المادة ذات اثر فعال في تخفيض الكوليسترول وضغط الدم بالإضافة إلى فعاليتها في مقاومة السرطان. لذلك ينصح الأطباء بتناول أربعة فناجين من الشاي الأخضر يوميا.

nosa_aic
01 - 02 - 2012, 21:26
دليل السعرات الحرارية

اليكم هذه المعلومات عن السعرات الحراريه و جدول لها يوضح
كميه السعر الحراري المتوافر في كل غذاء (سعر حراري=كالوري)

يحتاج الشخص البالغ المتوسط العمر إلى حوالي
2200كالوري في اليوم أما المراهق فيحتاج إلى مابين 2400و 3000كالوري في حين أن العامل أو ممارس الرياضة البدنية الشديدة يحتاج إلى ما بين 4800و 5000 كالوري يبقى أن الشخص المسن لا يحتاج إلى اكثر من 1800 وحده حرارية يوميا


الخضار (الكميه دائما هي 100 غرام )

ملفوف 30
الثوم 60
البصل 49
ارضي شوكي 40
هليون 25
كرفس 30
فطر 35
انديف 25
كراث 20
باذنجان 30
شمندور احمر 45
جزر 20
قرع 33
فول اخضر 64
فول يابس 330
فاصوليا خضراء 40
فاصوليا يابسة 336
عدس 337
القرنبيط 30
الخيار 15
الكوسة 33
السبانخ 35
الخس 19
اللفت 35
الزيتون الأخضر 215
بقدونس 55
الفجل 20
البندوره 22
البطاطا ( مسلوقة ) 90
البطاطا المقلية 300
بطاطا (شيبس - شرائح ) 540
الفلفلية 22
الحمص الأخضر 60
الحمص اليابس 350


الفاكهة (الكميه دائما هي 100غرام )

المشمش الطازج 55 وحده حرارية
المشمش المجفف 270
اللوز اليابس 620
أناناس طازج 45
أناناس محفوظ 96
افوكاتو 210
موز 100
كرز 65
كستناء 200
ليمون حامض 45
سفرجل 70
ثمر النخيل (بلح ) 300
تين طازج 80
تين مجفف 280
فريز 40
ثمر العليق 45
ماندارين (يوسف افندي ) 44
مانغا 62
شملم 30
جوز يابس 660
جوز الهند 400
برتقال 45
جريب فروت 45
بطيخ 30
دراق 60
فستق 630
خوخ 60
تفاح 60
أجاص 60
عنب ناضج طازج 80
زبيب 300

العصائر ( الكميه دائما سعه كوب واحد )

المشمش 135
الجزر 50
البرتقال 135
الجريب فروت 120
العنب 165
البندوره 50
المشروبات الغازيه
والمحلاة (الكولا مثلا) 80

المواد الدهنية

زبده 760
زيت نباتي 900
مار غرين 765

لحــــــوم

بقر 205
الصدر (الضلع ) 250
القلب 150
الكبد 115
الغنم 250
ضلع الغنم 300
فخذ الغنم 230
الخروف 280
ضلع الخروف 330
كبد الخروف 130
فخذ الخروف 250

طيــــــــور

الفروج ( الفراخ ) 175
الدجاج 300
الإوز 360
ديك الحبش 280
البط 200
بيضه دجاج 75
بياض بيضه ( الزلال ) 20
صفار بيضه 55

منوعات

خبز ابيض 260
خبز كامل 240
طحين القمح 345
القمح المنبت 390
القمح المجروش
(برغل أو سميد ) 370
طحين الذرة 350
اللبن الرائب 60
الأرز 350

حلـــــوى


السكر 380
حليب بالشوكولا 550
مربيات 290
عسل 330

nosa_aic
01 - 02 - 2012, 21:29
كيف يتم ايقاف نزيف الانف ؟

1- إضغط بإحكام على كل الجزء اللين من الأنف فوق فتحتي الأنف مباشرة

2- إجلس ومل برأسك إلى الأمام (فهذه الوضعية ستضمن ان الدم والإفرازات الأخرى لن تنزل إلى الحلق فتبتلع)
3- تنفس من فمك.
4- إبق على هذه الوضعية لمدة خمسة دقائق فإذا لم يتوقف النزيف فإستمر على نفس الوضعية لعشرة دقائق أخرى،
فإذا لم يتوقف النزيف رغم ذلك فإذهب لقسم الطورايء لأقرب مستشفى.

اميره اميره
02 - 02 - 2012, 11:42
الوضوء يزيل الام المفاصل (http://www.12allchat.com/forum/viewtopic.php?f=4&t=105508)


أكد عالم الفيزياء السوري علي منصور كيالي أن الوضوء له فوائد عظيمة، منها إزالة آلام المفاصل والروماتيزم، فيما تزود قراءة القرآن الإنسان بالطاقة.

وقال الأستاذ في كلية حلب في سوريا والاختصاصي في الإعجاز العلمي، خلال محاضرة له بجائزة دبي الدولية للقرآن، بعنوان "المادة والطاقة في القرآن" نقلتها مجلة هسبريس المغربية الإلكترونية: "إن للماء طاقة عجيبة".

وأوضح أن "الوضوء بجانب أنه نظافة دائمة ومستمرة لمدة 5 مرات في اليوم والليلة، إلا أن له فوائد عظيمة من خلال إزالة الشحنات الكهربية الضارة التي تنزل على الأرض وتصيب الإنسان بآلام المفاصل والروماتيزم".

ولفت كيالي إلى أن الطاقة نوعان منها الخيرة ومنها الشريرة يجسدهما على الترتيب قول الله عز وجل، "إن الذين قالوا ربنا الله ثم استقاموا تتنزل عليهم الملائكة ألا تخافوا ولا تحزنوا وابشروا بالجنة التي كنتم توعدون"، مشيرًا إلى أن الملائكة تنزل بالطاقة الإيجابية. أما الشياطين، فهم يجسدون الطاقة السلبية، ويظهر ذلك في قول الحق "قل هل أنبئكم على من تنزل الشياطين، تنزل على كل أفاك أثيم".

وذكر أن الطاقتين متنافرتان تمامًا، منوهًا إلى أن الله جعل لكل شخص منا ملائكة لتحفظه، مستشهدًا بقول الله عز وجل "ويرسل عليكم حفظة".

وأكد كيالي أن الإنسان عندما يبتعد عن القرآن يتبعه الشيطان على اعتباره طاقة شريرة، لافتًا إلى أن هناك حبلاً للطاقة يرسله الله على كل إنسان.

ولفت العالم الفيزيائي إلى أن القرآن الكريم فيه طاقة هائلة أظهرها قول الله عز وجل، "لو أنزلنا هذا القرآن على جبل لرأيته خاشعًا متصدعًا من خشية الله وتلك الأمثال نضربها للناس لعلهم يتفكرون"، مؤكدًا أنه يستحيل أن يحدث أي عمل في الكون إلا من خلال طاقة الله المباشرة.

nosa_aic
03 - 02 - 2012, 10:46
السلام عليكم ورحمة الله وبركاته

العيادة المنزلية

http://www.najaat.com/images/para/1488.gif (http://www.dlu3at.net/vb/article48882.html)

موقع و مواصفات العيــادة المنزلية:

بعيدا عن متناول الأطفال , بعيدا عن ضوء الشمس المباشر , في مكان بارد وجاف , يمكن قفلها ذات حجم كاف لترتيب الأدوية ولوازم الإسعاف .



محتويات العـــيادة:

خافضات الحرارة
مثل البنادول (أقراص، شراب، تحاميل)
مسكنات الصداع والألم وأوجاع المفاصل البنادول
الأسبرين ( الأطفال أقل من 12 سنة يجب عدم إعطائهم الأسبيرين دون استشارة الطبيب )
بروفين Brufen
مضادات الحموضة،وحرقان المعدة وارتجاع الحمض: مثل
ريوبان Rioban (حبوب، شراب ،فوار ، أقراص للمص) لمعادلة الحموضة
زانتاك Zantac لمنع إفراز الحمض
بريبلسيد Prepulsid لمنع ارتجاع الحمض
الملينات و علاجات الإمساك: مثل
- حبوب دلكولاكس Dulcolax
-متاميوسي mucil بودرة تضاف إلي كأس ماء.
- تحاميل غليسرين
مضادات الإسهال لا ينصح بها إلا بعد استشارة الطبيب)
مثل حبوب أموديوم Imodium أو لوموتيل Lomotil
مسكنات أعراض الزكام والرشح واحتقان الأنف: مثل
أكتيفيد Actifed، فينيستيل Fenistil، كلارينيز Clarinase

http://www.uaearab.com/es3afat/images/15.jpg (http://www.dlu3at.net/vb/article48882.html)

مسكنات مغص البطن وآلام الطمث: ( يراجع الطبيب عند استمرار المشكلة) مثل : بسكوبان Buscopan
أدوية تخفيف الغثيان والدوار ( ينصح باستشارة الطبيب ومراجعته عند استمرار المشكلة) مثل: درامامين Dramamin
مرهم مضاد حيوي مثل فيوسيدين Fucidin لعلاج الجروح والحروق السطحية

علاجات حكة الجلد والتحسس: مثل
- كريم إلكون Elcon Cream
- أو حبوب برياكتين Periactin أو شراب بندريل Benedryl
- مرهم أو محلول كالامين ملطف للجلد في الحروق البسيطة والسطحية أو آثار حرارة الشمس
دواء محفز على التقيؤ ( يستعمل في حالات التسمم بمواد غير بترولية ) مثل :إبيكاك Ipecac, . وعموماً يستعمل هذا الدواء بعد التحدث مع الطبيب أو مركز السموم
غرغرة الفم والحلق مثل: سانسيلا Sansilla ، حبوب مص طبية لألم الحلق
غسول العين ( عند التعرض للغبار والأتربة) مثل أوبتركس
مطهرات الجروح والحروق مثل السافلون Savlon
تجهيزات الضماد: مقص ، ملقط صغير ، شاش ( قطع مربعة ورباط ضماد )، قطن، شريط لاصق بأحجام مختلفة، ورباط ضاغط يستعمل في حالات إصابات المفاصل ورباط مثلث، كفوف بلاستيكية، ومسحات طبية
ميزان حرارة طبي ، ومصباح بطارية صغير لا تنسى أن تضع قلماً وورقة قد تحتاجهما عند الضرورة
سجل رقم هاتف الطوارئ والنجدة والإسعاف والطبيب والمستشفى والصيدلية المحلية في ورقة وألصقها في داخل صندوق الصيدلية
كمادات باردة( تتفاعل كيميائيا عند الضغط لتبرد تلقائياً وأخيرا ينبغي الإحتفاظ بكتيب تعليمات الإسعافات الأولية ويحفظ داخل الصندوق
وتعد الصيدلية المنزلية من الأشياء الأساسية في كل منزل نظراً لأهميتها
في الحالات الإسعافية، فاحتواء الصيدلية على المستلزمات
الضرورية لإسعاف المصاب في الدقائق الأولى من إصابته يساعد-
بإذن الله- على الشفاء السريع، وقد يقلل من تعرض المصاب لعاهات
مستديمة، تحدث أحياناً نتيجة للتأخر في إسعاف المريض.
وتتكون الصيدلية المنزلية من خزينة للإسعافات الأولية وخزينة للأدوية،
وسوف نتطرق بشيء من التفصيل لمحتويات هاتين الخزينتين.
http://www.bab.com/admin/articles/40_2003%5Cimages%5Cnimg8544.jpg (http://www.dlu3at.net/vb/article48882.html)


خزينة الإسعافات الأولية:


حقيبة الإسعافات الأولية متوفرة في الصيدليات بأنواع وأحجام مختلفة،
فيجب انتقاؤها حسب الحاجة وذلك بعد استشارة الصيدلي،
وغالباً ماتحتاج إلى إضافة مواد أخرى على الحقيبة الموجودة
في السوق.
وإليك بعض المواد الرئيسة الواجب توفرها في خزينة الإسعافات
اللازمة لإجراء معظم الإسعافات الأولية:

1- الضمادات والأربطة: هناك عدة أشكال من الضمادات والأربطة
الطبية متوفرة في الأسواق للاستخدام المنزلي،
ويعتمد استخدام كل منها على نوع الإصابة وموضعها والمواد الإسعافية المتوفرة، ويستحسن أن تكون معقمة لتمنع دخول الجراثيم.

وإليك بعض هذه الأنواع:


- ضمادات الشاش: هذه ضمادات من طبقات عديدة من الشاش الناعم
وهي تساعد على التحكم في النزيف وتعمل على امتصاص الدم
وإفرازات الجروح والوقاية من العدوى ومنع التلوث. ويفضل
استخدام الضمادات الكبيرة حتى تغطي الجرح والمنطقة المحيطة به،
وتثبت برباط أو شريط لاصق حتى لاتنزلق فوق المنطقة المجاورة.


- أربطة شريطية لاصقة: وهي مؤلفة من شاش قابل للامتصاص مثبتة
في مكانها بظهر لاصق. ويستخدم هذا النوع من الأربطة للجروح
الصغيرة بشرط أن يكون الجلد حول الجرح نظيفاً وجافاً قبل
ربط الشريط. كما يمكن استخدامه مع ضمادات الشاش لتغطية الجروح.

- رباطات ملفوفة: هذا النوع من الرباط يصنع من أحجام مختلفة
ويستعمل للحفاظ على الضمادات في أماكنها ولوقف النزيف
أو لتقويم التواء أو إسناد أورام.


- رباطات مثلثة: يمكن أن تستخدم كرباطات اعتيادية لضماد الجروح
أو كمعلاق لتعليق يد مصابة بكسر إلى الرقبة ولوقاية الذراع
والصدر ولربط ضمادات فوق الرأس واليد والقدم.


- شريط لاصق: يثبت الأربطة والضمادات الصغيرة.


- قطن طبي: يجب أن تحتوي خزانة الإسعاف على كمية كافية
من القطن الطبي، لأنه في بعض الأحيان يحتاج المسعف إلى كمية
كبيرة من القطن لاستخدامه كحشوة للجبيرة أو لرفع الدم المتراكم
على الجرح أثر نزف شديد.

2- مناشف أو كمادات باردة: تستخدم لإسعاف الرضات الداخلية
والتواء المفاصل ولتخفيف الألم ولمنع التورم.

3- قفازات طبية معقمة: تستعمل هذه القفازات عند القيام بتطهير
الجروح، أو وقف النزيف والإفرازات العضوية الأخرى للوقاية من
حدوث عدوى، وتستخدم مرة واحدة فقط.



4- مسحة طبية: عبارة عن كحول الأيزوبروابايل (70%) لتطهير الجروح.

5- مقص وملقط: يستخدم المقص لقطع الجلد الميت عند حدوث إصابة
تستلزم ذلك، وقطع العصابات والضمادات. أما الملقط فهو ضروري
لإزالة الأجسام الصغيرة والشظايا من الجسم. ويفضل شراء مقص
من النوع الجيد الذي لايصدأ لأن شراءك لمقصات رديئة وقابلة للصدأ له
أثر كبير في تلوث الجزء المصاب. ويفضل غلي كل من المقص
والملقط بالماء لمدة خمس دقائق قبل وبعد الاستعمال.

6- إبرة كبيرة ومشابك: الإبرة الكبيرة لإزالة الشوك وخلافه من
الجسم، والمشابك لتثبيت الأربطة.


7- ميزان حرارة طبي: لقياس درجة الحرارة، ويفضل توفير نوعين:
الأول لقياس درجة الحرارة عن طريق الفم ويستعمل للكبار،
والآخر لقياس الحرارة عن طريق الشرج ويستعمل للصغار.

8- مصباح يدوي: يستخدم إذا كانت الإصابة في مكان مظلم.

9- ورقة وقلم: وهي من الأدوات المهمة التي يجب أن تكون جزءاً
من محتويات حقيبة الإسعاف التي يمكن أن تستعمل لتسجيل
رقم هاتف مهم في حالة الإسعاف ووقت الإصابة وكذلك المعالجة
التي قدمت والأدوية التي تناولها المصاب وحالته وغيرها من المعلومات
المهمة التي يحتاجها الطبيب المسعف فيما بعد.

10- قائمة بأرقام هواتف الطوارئ: تحتوي على أرقام تلفونات
المستشفيات ومراكز الأدوية والسموم القريبة من المنزل.
http://elmalak2.bizland.com/blog/wp-content/uploads/2008/04/female_pharmacist.jpg (http://www.dlu3at.net/vb/article48882.html)

11- دليل الإسعافات الأولية: كتيب يحتوي على ملخص لكيفية
عمل الإسعافات الأولية لأكثر الحوادث شيوعاً في المنزل، ويفضل
قراءة الكتيب مبكراً، ومعروف أن هذا الدليل لايكفي لعمل الإسعافات
الأولية على الوجه الصحيح، بل لابد من أخذ دورات في كيفية إجراء
الإسعافات الأولية.

خزينة الأدوية:

محتويات الصيدلية:

خافضات الحرارة
مثل البنادول (أقراص، شراب، تحاميل)


مسكنات الصداع والألم وأوجاع المفاصل
البنادول
الأسبرين ( الأطفال أقل من 12 سنة يجب عدم إعطائهم الأسبيرين دون استشارة الطبيب )
بروفين BRUFEN


مضادات الحموضة،وحرقان المعدة وارتجاع الحمض:
مثل
ريوبان RIOBAN (حبوب، شراب ،فوار ، أقراص للمص) لمعادلة الحموضة
زانتاك ZANTAC لمنع إفراز الحمض
بريبلسيد PREPULSID لمنع ارتجاع الحمض


الملينات و علاجات الإمساك:
مثل
- حبوب دلكولاكس DULCOLAX
-متاميوسيل MUCIL بودرة تضاف إلي كأس ماء.
- تحاميل غليسرين


مضادات الإسهال
[ ينصح بها إلا بعد استشارة الطبيب)
مثل حبوب أموديوم IMODIUM أو لوموتيل LOMOTIL


مسكنات أعراض الزكام والرشح واحتقان الأنف:
مثل
أكتيفيد ACTIFED، فينيستيل FENISTIL، كلارينيز CLARINASE


مسكنات مغص البطن وآلام الطمث:
( يراجع الطبيب عند استمرار المشكلة) مثل : بسكوبان BUSCOPAN


http://www.alriyadh.com/2007/09/02/img/029672.jpg (http://www.dlu3at.net/vb/article48882.html)

أدوية تخفيف الغثيان والدوار
( ينصح باستشارة الطبيب ومراجعته عند استمرار المشكلة) مثل: درامامين DRAMAMIN


مرهم مضاد حيوي
مثل فيوسيدين FUCIDIN لعلاج الجروح والحروق السطحية

علاجات حكة الجلد والتحسس: مثل
- كريم إلكون ELCON CREAM
- أو حبوب برياكتين PERIACTIN أو شراب بندريل BENEDRYL
- مرهم أو محلول كالامين ملطف للجلد في الحروق البسيطة والسطحية أو آثار حرارة الشمس

دواء محفز على التقيؤ
( يستعمل في حالات التسمم بمواد غير بترولية ) مثل :إبيكاك IPECAC, . وعموماً يستعمل هذا الدواء بعد التحدث مع الطبيب أو مركز السموم


غرغرة الفم والحلق
مثل: سانسيلا SANSILLA ، حبوب مص طبية لألم الحلق


غسول العين

( عند التعرض للغبار والأتربة) مثل أوبتركس

مطهرات الجروح والحروق
مثل السافلون SAVLON

كمادات باردة( تتفاعل كيميائيا عند الضغط لتبرد تلقائياً وأخيرا ينبغي الإحتفاظ بكتيب تعليمات الإسعافات الأولية ويحفظ داخل الصندوق

اميره اميره
03 - 02 - 2012, 11:37
المختصر المفيد في الخميرة



http://img526.imageshack.us/img526/5469/showoa0.jpg

الخميرة هي كائنات حية دقيقة وحيدة الخلية تتكاثر بطريقة الانقسام، وتتبع الخميرة فصيلة الفطر (Fungi)، والذي يهم هو نوعان فقط من هذه الأنواع هما:

1- خميرة البيرة (Brewrs Yeast).
2- وخميرة الخبز (Bakers Yeast).

وهما أهم أنواع الخمائر المفيدة في التصنيع الغذائي، وعملياً لا يوجد فوارق تذكر بين هذين النوعين من الخمائر.

والخميرة كائن حي يأكل ويشرب، فهي تفرز إنزيمات خارجية تسبب تخمير الغذاء الكربوهيدراتي (مثل النشا والسكر)، وتخرجها على الطعام الذي تقع عليه بهدف تحليله، ومن ثم امتصاصه بعد تحليله، وإذا ما توفر للخميرة الطعام فإنها تنمو وتتكاثر.

وإنتاج الخميرة الموجودة في الأسواق عبارة عن خلايا خميرة حية جافة ولكنها في حالة سكون؛ لأنه لا يوجد غذاء وماء يجعلانها تنمو، عندما نضعها في الماء مع قليل من السكر فإنها تعيد امتصاص الماء وتفرز إنزيماتها، وتحلل السكر، وتنتج ثاني أكسيد الكربون وهو (غاز) وماء ومواد أخرى، وتنشط وتكبر وهكذا تتكاثر ومع تكاثرها السريع جداً تنتج ثاني أكسيد الكربون.

إذا أخذنا الخميرة بعد تنشيطها هذا ووضعناها مع الدقيق وعجناه ثم تركناه جانباً فإنها ستستمر في التكاثر وتتغذى من العجين وتنتج غاز ثاني أكسيد الكربون وينتفش العجين، وبعد مدة كافية يمكن خبزه فيكون خبزاً منتفخاً بالأشكال المعروفة.

أما إذا لم تكن هناك خميرة في العجين فلن يتكون غاز، ويصبح الخبز وكأنه قطع من البلاستيك، وهي تنمو بصورة جيدة على درجة حرارة الغرفة، وحتى درجة 41ْم، وبصورة مثالية على درجة 41ْم ولكن إذا زادت الحرارة عن 54ْم فإنها تموت.

وخميرة الخبز المتوفرة في الأسواق اليوم على ثلاثة أنواع، أشهرها:

1-الجافة النشطة (Active dry Yeast (ADY)، وتتميز بعمرها الطويل عند تخزينها.

2- والنوع الثاني رطبة، بها قاعدة من النشا تعمل كمصفى لها، وهذه لا بد من حفظها في الثلاجة وإذا لم تحفظ في جو بارد ماتت الخلايا.

3- أما النوع الثالث فهو الخميرة الجافة سريعة الانتفاخ (الانتفاش) إذ إنها تتميز بامتصاص الرطوبة بسرعة وتنتج ثاني أكسيد الكربون بسرعة.

وتعتبر الخميرة من الناحية الغذائية مادة بروتينية عالية المحتوى من الفيتامينات وخصوصاً فيتامين (ب)، والخميرة مفيدة للصحة فهي بروتينات بها الأحماض الأمينية الأساسية التي يحتاج إليها الجسم وهي عالية المحتوى في الفيتامينات خصوصاً مجموعة (ب) التي لها أدوار عديدة في عمليات التمثيل الغذائي في الجسم.

كما أن الخميرة غنية بالمواد المسماة القواعد البيورينية التي تكون الأحماض النووية في الجسم (RNA) و(DNA)، وهذه القواعد مهمة أيضاً لنشاط الاستجابة في جهاز المناعة في الجسم.

كما أن بها نسبة جيدة من العناصر المعدنية مثل الفسفور والبوتاسيوم والزنك والحديد؛ لذا فيمكن اعتبارها مصدراً طبيعياً غنياً بالفيتامينات والمعادن والبروتين، والخميرة تباع على هيئة حبوب في الصيدليات، وهناك أمران مهمان حول فائدة الخميرة:

الأول: الكمية التي يتناولها الإنسان منها قد لا تحقق الاكتفاء بالعناصر التي ينشدها كمتطلبات لجسمه فهي محدودة حدود الكمية المتناولة.

الثاني: يحذر المصابون بمرض النقرس (داء الملوك) من تناول الخميرة؛ لأن القواعد البيورينية الموجودة فيها تساعد على زيادة تكون حامض اليوريك في المفاصل ويزداد الألم؛ لذا فمن الأغذية التي يجب أن يبتعد عنها مريض النقرس هي الخميرة.

خميرة الخبز تعد من المصادر الهامة لمجموعة فيتامين (ب) والتي تسهل عمل وظائف الجسم وجهاز المناعة والتوازن العصبي، وإن تناول عشرة جرامات منها يوميا يكفي احتياجات الجسم من فيتامين ب.1 ب.2 ب9.

هذا وقد ثبت بشكل عام أن الخميرة تزيد من نسبة الامتصاص ونشاط الجهاز الهضمي، وقد تؤدي إلى زيادة الوزن في بعض الأحيان.

والطريقة الصحيحة لتناول الخميرة هي تذويب ملعقة من الخميرة الجافة مع كوب من الماء الدافئ وملعقة سكر ثم تشرب مرة واحدة يوميا، ويفضل على الريق صباحا.

وتناول الخميرة لا يتعارض مع تناول الحديد.

والله الموفق.

ابو مالك
03 - 02 - 2012, 17:51
شكرا لهذه المعلومات الأكثر من رائعة

nosa_aic
04 - 02 - 2012, 05:17
شكرا لهذه المعلومات الأكثر من رائعة


مرحبا اخى الفاضل استاذ ابو مالك

نتمنى الافادة للجميع

تحياتى

nosa_aic
04 - 02 - 2012, 05:24
أطعمة تخفف الكولسترول


الكولسترول هو عبارة عن مادة دهنية أساسية في تكوين أغشية الخلايا في جميع أنسجة الكائنات الحية، ويلعب دورا مركزيا في الاستقلاب الحيوي، ويتواجد بكثرة في الأنسجة الحيوانية وبنسب ضئيلة في أنسجة النبات والفطريات.
وللحفاظ على مستويات جيدة من الكولسترول الصحي والتخلص من الكولسترول السيئ ننصحك بتناول هذه الأطعمة:

1. الشوفان:

استبدل ما تأكله الآن بوجبة خفيفة من الشوفان الذي يخفض الكولسترول السيئ بنسبة 5.3 % في 6 أسابيع فقط.

2. السلمون والسمك الدهني:

تعتبر دهون الأوميغا -3 إحدى عجائب الصحة الطبيعية التي تساعد في تجنب مرض القلب، الخرف، والعديد من الأمراض الأخرى. يمكن أن تضيف هذه الأحماض الدهنية أيضا فائدة صحية أخرى هي خفض الكولسترول، وفقا لبحث من جامعة لوما ليندا، استبدال الدهون المشبعة بالأوميغا -3 مثل تلك الموجودة في السلمون، السردين، والرنغة يمكن أن يرفع الكولسترول الجيد بنسبة 4 %.


3. المكسرات:

إذا كنت تريد خفض مستويات الكولسترول بطريقة ممتعة، فيجب أن تأكل المكسرات.

4. الفاصولياء:

وجد باحثون من جامعة ولاية آريزونا للتقنيات المتعددة بأن إضافة ½ كأس من الفاصولياء إلى الشوربة ينزل الكولسترول الكلي، بضمن ذلك الكولسترول السيئ، بحدود 8 %.

5. الشاي:

بالرغم من شهرة الشاي في مكافحة السرطان وغناه بمانعات التأكسد القيمة، إلا أنه أيضا يشكل دفاعا عظيما ضد المستويات المرتفعة من الكولسترول السيئة.

6. الشوكولاته:

غنية بمانعات التأكسد القوية التي تساعد على بناء مستويات الكولسترول الجيدة.

7. الزبد النباتي:

انتقل إلى الزبد النباتي للمساعدة على خفض الكولسترول. تحتوي ستيرول النباتات على مركبات تخفض امتصاص الكولسترول.

8. السبانخ:

يحتوي هذا النبات على الكثير من lutein، الصبغة المشمسة الصفراء الموجودة في الخضار الورقي ومح البيض، يملك اللوتين مقدرة على الوقاية من مرض تراجع البصر المرتبط بالعمر والذي يؤدي إلى العمى. 1/2 كوب من اللوتين في اليوم يمكن أن يقلل من الإصابة بالنوبات القلبية عن طريق حماية الشريان من الكولسترول الذي يسبب إغلاق الشرايين.

9. الأفوكادو:

الأفوكادو مصدر عظيم للدهن الأحادي للإشباع الصحي للقلب، وهو نوع من الدهن قد يساعد على رفع الكولسترول الجيد وخفض الكولسترول السيئ.

10. الثوم:

بالإضافة إلى النكهة اللاذعة التي يضيفها الثوم للأطباق، وجد الباحثون بأن الثوم مفيد في خفض الكولسترول، ومنع جلطات الدم، وخفض ضغط الدم، والوقاية من الالتهابات.

11. زيت الزيتون:



زيت الزيتون ملئ بالأحماض الأحادية اللاتشبع الصحية للقلب التي تنزل الكولسترول السيئ كما أن لها تأثر جانبي رائع يساعد على تشذيب دهون البطن

nosa_aic
04 - 02 - 2012, 05:31
أطعمة ترفع نسبة الاصابة بالسرطان

كشف الأبحاث الحديثة الصادرة عن جامعة كاليفورنيا الجنوبية أن سرطان الدم لدى الأطفال قد يرتبط بالإفراط في تناول اللحوم المصنّعة كالمقانق والهمبرغر، إذ أن من يتناولون أكثر من 12 قطعة منه في الشهر هم عرضة للإصابة بنسبة 1:10 أكثر من الأطفال الذين لا يتناولونه على الإطلاق. وتفيد دراسة ثانية أجريت على 3700 رجل وسيدة أن تناول اللحوم المصنعة يرفع نسبة الإصابة بسرطان القولون، كما أن الدهون الموجودة فيها تؤدّي إلى أمراض الشيخوخة، ومن بينها التهاب المفاصل وانسداد الشرايين وأمراض القلب.


توضح الباحثة سوزانا لارسون التي رأست مؤخراً فريق بحث تابعاً لهيئة الإذاعة البريطانية أن العلاقة بين تناول اللحوم المصنعة وأمراض السرطان الأخرى ما تزال تثير الجدل، إلا أنه من المعروف أن تناول اللحوم يزيد من مخاطر الإصابة بسرطان القولون والمستقيم. ومن هذا المنطلق، يعدّد الباحثون في جامعة نورث كارولينا الشمالية الأميركية بعض أنواع الأطعمة الخطرة والأكثر استهلاكاً في دول العالم الثالث،
أبرزها:

_ الأطعمة المصنعة: تذكر الصحافية الأميركية المتخصّصة بالصحة ومؤلّفة أكثر من 32 كتاباً من ضمنها "المخ المعجزة" جين كاربر أن هناك خطراً كبيراً ينتج عن الإفراط في تناول اللحوم المصنعة كالبرغر والمقانق والسلامي والمورتديللا ألا وهو ارتفاع نسبة تكوّن مواد "النيتروسامين"، وهي كيميائيات تتكوّن في المعدة نتيجة احتواء هذه المنتجات على مادة نترات الصوديوم، ما يسبّب الارتفاع في نسبة الإصابة بأنواع السرطان كافّة. ووفقاً للأبحاث الطبية الصادرة عن هذه الجامعة، وجد أن الشباب الذين يتناولون السجق والسلامي مرّة أسبوعياً هم أكثر عرضة للإصابة بأورام المخ بمعدّل الضعف مقارنة بمن لا يتناولونه على الإطلاق، فيما أن الأشخاص الذين يكثرون من تناول البرغر يكونون أكثر عرضة للإصابة بسرطان المخ بنسبة 80%.



_ اللحم المشوي: تعتقد غالبيّة متتبّعي الحميات الغذائية أن الشواء هو أفضل طريقة للطهي، إلا أن الأبحاث الحديثة الصادرة عن مركز الوقاية والتحكّم من الأمراض بأميركا تثبت أن شي الطعام على الفحم، وخصوصاً اللحوم، قد ينتج عنه كميّات كبيرة من الأمينات الضارّة خصوصاً إذا كان الطعام دهنياً حيث تتساقط دهون اللحم على الفحم المشتعل فيحدث لها انحلال حراري ينتج عنه مركبات الهيدروكربونات الحلقية التي تترسّب على سطح اللحوم المشوية. وتجدر الإشارة إلى أن هذه المركبات الضارة تحدث لها تحوّلات داخل جسم الإنسان ترتبط مباشرة بحدوث أورام سرطانية فيه، علماً أن تناول اللحم المشوي على فترات متباعدة لا يمثّل خطورة على الصحة مقارنة بتناوله بصورة دائمة. وبصفة عامّة، توضح دراسة صادرة عن جامعة الطب بولاية نيويورك أن تناول اللحوم يومياً يمكن أن يعرّض للإصابة بسرطان القولون والبنكرياس والمثانة لدى الرجال وسرطان الثدي لدى النساء، بالإضافة إلى أمراض القلب والأوعية الدموية والشرايين الناتجة عن ارتفاع معدّل الكوليسترول في الدم.

_ الدجاج المقلي: يعدّ أقل خطورة من اللحم المشوي، إلا أنه يحتوي على بعض الأمينات الضارة بمعدل يفوق السمك المقلي بـ 5 أو 8 مرّات. لذا، ينصح الخبراء بسلق الدجاج ونزع طبقة الجلد الخارجية منه لاحتوائها على كميات كبيرة من الشحوم والهرمونات غير الصحية.



- الزيوت النباتية: يؤكّد الباحثون أن أخطر أنواع الدهون التي يمكن أن يستخدمها الإنسان في طعامه، هي زيوت الذرة ودوار الشمس والفول السوداني، بالإضافة إلى السمن النباتي (المارجرين) الذي يكون أخطر من السمن الحيواني ويتسبّب في وفاة ما يقارب 30 إلى 100 ألف شخص سنوياً بسبب أمراض القلب وارتفاع معدل الكوليسترول في الدم وذلك وفقاً لإحصائيات منظمة الصحة العالمية.

وعن مخاطر الزيوت النباتية، تقول جين كاربر "إن استخدام زيت الذرة أو دوار الشمس في الطعام قد يعيق عمل الخلايا ويتلفها، وقد يتسبّب في إصابتها بالسرطان". ويعزو الباحثون هذه الخطورة إلى القدرة الفائقة للزيوت النباتية وخصوصاً المستخرجة من الذرة على التفاعل مع الأوكسجين الخارجي، علماً أن الأوكسجين يذوب في الدهون أسرع 8 مرّات من ذوبانه في الماء ما يشكّل بها "الشق الأيوني الحر" الذي يهاجم مئات الخلايا في الجسم ويدمّرها.

_ الزيوت المهدرجة: يحذّر الخبراء من الزيوت المهدرجة التي تتعرّض إلى درجات حرارية عالية في استخدامها أثناء القلي أو تصنيعها كالمارغرين والزبدة، ما يغيّر التركيبة الكيميائية للدهن الموجود فيها ويسبّب عدداً من الأمراض، أبرزها:

انسداد الشرايين وزيادة في معدّل ضربات القلب.
ارتفاع معدل الكوليسترول الضار وخفض الكوليسترول الجيد.
ضعف المناعة وارتفاع الشوادر الحرة في الجسم.
زيادة فرص الإصابة بالأمراض المزمنة (السرطان والسكري وأمراض الجهاز التنفسي والعصبي).
ضعف قدرة الجسم على هضم هذه الدهون والتخلّص منها، ما يؤدّي إلى تخزينها وزيادة في الوزن.



المنتجات الحيوانية: تعدّ مكوّناً رئيسياً في غالبية الأنظمة الغذائية اليومية، ما يسبّب الفشل في إنقاص الوزن وصعوبة التخلّص منه. وتتوافر هذه المنتجات الحيوانية في البيض واللحوم الحمراء والدواجن ومنتجات الألبان (القشدة والجبن). وتوضح الأبحاث الحديثة والتي نشرت في "مجلة الصحة الأميركية" أن الإكثار من تناول المنتجات الحيوانية يُسرّع من ظهور علامات الشيخوخة ويزيد من فرص الإصابة بالسرطان، كما أن تناول اللحوم يومياً يمثّل خطورة على الصحة بفعل احتوائه على نسب مرتفعة من الحديد الذي يتّحد مع الكوليسترول وبالتالي يصبح عاملاً مساعداً للشق الأيوني الحر الذي يهاجم خلايا الجسم ويتلفها مؤدّياً إلى الإصابة بجلطات في الشرايين وأزمات قلبية وسكتات دماغية. بالإضافة إلى ما سبق، تؤثّر الدهون الحيوانية المشبعة كالسمن الحيواني والزبدة على هرمونات الجسم مسبّبة الإصابة بسرطان الثدي والقولون والتهاب المفاصل الروماتيزمي وانسداد الشرايين وأمراض القلب والضغط وضعف المناعة.



7 نصائح لوزن مثالي

1 أكثري من استخدام زيت الزيتون في الطعام لأنه من أكثر أنواع الزيوت أماناً وحفاظاً على الوزن، تليه زيوت الكانولا وبذر اللفت والسمسم وبذرة الكتان والجوز والصويا.

2 واظبي على تناول الأسماك من مرّة إلى مرّتين أسبوعياً، إذ يعمل هذا التدبير على تنشيط انزيمات إزالة السميّة من الجسم، وبالتالي تقليل فرص الإصابة بالسرطان وأمراض القلب والشيخوخة

3 عند الشواء، يفضّل تصغير حجم قطع اللحم لتقليل فترة تعرّضها للحرارة، كما إزالة الدهون الظاهرة عن القطع المشوية لمنع تساقط الدهون على الفحم وبالتالي زيادة الأمينات الضارة الناتجة عنها. وينصح الخبراء بتتبيل قطع اللحم في خلطة مكوّنة من الملح والليمون الحامض والخل والفلفل قبل الشي بـ 8 ساعات على الأقل لتقليل المواد الضارة الناتجة عنها أثناء الشواء بنسبة قد تصل إلى 90%.

4 امتنعي عن تناول الأطعمة التي قد تعيق عملية إنقاص الوزن (الدونات ورقائق الذرة ومكعبات مرق الدجاج وزبدة الفول السوداني وزيوت الطهي النباتية وتوابل السلطة والمايونيز والبيتزا والمقانق والشوكولاتة ورقائق البطاطس) لأنها غنيّة بالدهون الضارة والزيوت المهدرجة.

5 خفّفي من استهلاك اللحوم الحمراء، وذلك بمعدل مرة إلى مرتين على الأكثر أسبوعياً وبكميات ضئيلة، وذلك حفاظاً على الصحة وحمايتها من الأمراض المرتبطة بالإفراط في تناول اللحوم كارتفاع معدل الكوليسترول، وما يترتّب عنها من أمراض القلب والأوعية الدموية وانسداد الشرايين.

6 يفضّل شي أنواع معيّنة من الخضر مع اللحوم، كالبصل والفليفلة والبندورة والكوسى إذ لا تتكوّن في داخلها المركبات الحلقية الضارة، كما تضمّ مواد "الفايتو" المحفّزة لانزيمات الجسم والتي تحوّل هذه المركبات الضارة في اللحوم المتناولة إلى صورة غير نشطة يسهل طردها من الجسم.

7 أكثري من تناول الماء وممارسة الرياضة بانتظام والتوقّف عن تناول الطعام قبل النوم بـ 3 ساعات على الأقل والنوم مبكراً وعدم التدخين واتّباع الطرق الصحية في الطهي كالسلق أو الطهي على البخار بدلاً من القلي.

nosa_aic
04 - 02 - 2012, 05:37
6 أطعمة لتحسين مزاجك


انسي كل شيء سمعته عن تناول الطعام أثناء التوتّر، وعن كونه أمراً سيّئاً. إذا تناولت الأطعمة الصحيحة، حين تشعرين بالتوتّر والعصبيّة، فإنّ ذلك قد يهدّئك فعلا. وهذا خبر رائع، لأنّ آخر شيء تحتاجين إليه هو المزيد من التوتّر، الذي قد يزيد من احتمال إصابتك بارتفاع ضغط الدم والأمراض القلبيّة والسمنة وانفجارك في لحظة غضب على شيء تافه. فيما يلي أفضل الأطعمة التي تهدّئ التوتّر وتواجه الضرر الذي يحدثه الضغط المزمن. تناولي الكثير منها بحيث، حين يرتفع التوتّر، يمكنك التغلّب عليه، بدل الشعور بالذعر.

اللوز والفستق الحلبي والجوز

حين ينهار كلّ شيء، تناولي حفنة من اللوز. فهي غنيّة بفيتامين E، وهو مضاد أكسدة يدعم الجهاز المناعي في الجسم. ويحتوي اللوز أيضاً على فيتامينات B، التي قد تساعد الجسم على التماسك خلال الأحداث المزعجة أو المؤلمة. كلّ ما تحتاجين إليه هو حوالي ربع كوب يوميّاً. ومن العلاجات السهلة الأخرى هي التحوّل من زبدة الفستق العاديّة إلى زبدة اللوز، في الأيام التي يكون فيها مستوى التوتّر عالياً لديك.
إذا سئمت من اللوز، تناولي الفستق الحلبي أو الجوز. فكلاهما يساعدان على منع تسارع دقات القلب حين تصبح الأمور محمومة. نشهد استجابة فوريّة من القلب والأوعية للشدّة بسبب ردّ فعل القتال أو الهروب. وحين نصاب بالشدّة، يرفع هرمون الأدرينالين ضغط الدم لتعزيز الطاقة، بحيث تكونين مستعدّة للهرب بسرعة إذا اضطررت. ولكن، ولأنّنا نادراً ما نحتاج إلى استجابة القتال أو الهرب، من الأفضل تخفيف الضغط على القلب. وقد وجدت دراسة أنّ تناول أونصة ونصف (حفنة تقريباً) من الفستق الحلبي يوميّاً يخفّض ضغط الدم، بحيث لا يضطر قلبك إلى العمل وقت إضافي. وتبيّن أيضاً أنّ الجوز يخفّض ضغط الدم، سواء في حالة الراحة أو التوتّر. أضيفي حوالى أونصة من الجوز على السلطة.

الأفوكادو

في المرّة المقبلة التي تشعرين بها بأنّك تشتهين تناول أطعمة دهنيّة أو كريميّة لأنك متوتّرة أو قلقة، لا تأكلي الآيس كريم، وجرّبي تحضير وجبة الغواكامول (الأفوكادو المهروس مع الفلفل والطماطم) في المنزل، فملمسه الغني السميك يهدّئ رغبتك في تناول الطعام، ويخفّف من حدّة مشاعرك المحمومة. بالإضافة إلى هذا، فإنّ احتواءه على الدهون الأحاديّة غير المشبعة والبوتاسيوم يخفّض ضغط الدم. ووفقاً لدراسات علمية حول القلب والرئة والدم، فإنّ أحد أفضل الطرق لتخفيض ضغط الدم المرتفع هو الحصول على ما يكفيك من البوتاسيوم. وتوفّر نصف حبّة أفوكادو 487 ملغم منه، أي أكثر مما تحصلين عليه من موزة متوسطة الحجم. لتحضير صلصة الأفوكادو، اهرسي حبّة أفوكادو متوسّطة مع ملعقتين كبيرتين من عصير الليمون والقليل من الفلفل الحارّ.

الحليب خالي الدسم

يؤيّد العلم العلاج القديم بتناول الحليب الدافئ لعلاج الأرق والتعب. وقد تبيّن أنّ الكالسيوم قد يقلل تشنّجات العضلات، ويهدّئ التوتر. وقد يقلل كوب من الحليب (يفضّل أن يكون خالي الدسم أو دسماً بنسبة 1 %) أعراض الدورة الشهريّة، مثل تقلّبات المزاج والقلق والتهيّج. ووفقاً لإحدى الدراسات، تبيّن أنّ النساء اللواتي يشربن أربع أكواب من الحليب قليل الدسم أو خالي الدسم أو أكثر يوميّاً، تقلّ لديهن نسبة الإصابة بالإكتئاب قبل الدورة الشهريّة بنسبة 46 % عنها لدى النساء الذين لا يشربن أكثر من كوب واحد أسبوعيّاً.

الشوفان

الكربوهايدرات تجعل الدماغ ينتج المزيد من مادّة السيروتونين، وهي نفس المادّة الكيميائيّة المهدئّة التي يتم إفرازها حين تتناولين الشوكولاته الداكنة. وكلما كان جسمك أبطأ في امتصاص الكربوهايدرات، كلما زاد ثبات تدفّق السيروتونين. والنتيجة هي تقليل احتمالات انفجار غضبك. وننصح أيضاً بتناول، مع الشوفان، القليل من المربّى لكي ينتج الجسم السيروتونين بشكل أسرع. وحين تشعرين أنّ هذا اليوم سيكون محموماً، تجنّبي الأنواع المعالجة بشكل كبير (مثل النوع السكّري الذي يأتي في علب يجب وضعها في الميكروويف)، التي يتمّ امتصاصها بشكل أسرع، وتستغرق وقتاً لتصنيع الشوفان السميك. ولكن إذا لم يكن لديك وقت طويل لتناول الإفطار، يمكنك تحسين مزاجك عن طريق اختيار الشوفان بدل Cocoa Puffs.

البرتقال

إذا كنت تشعرين بالقلق من مقابلة عمل، أو عرض تقديمي في العمل، صبّي لنفسك كوباً من عصير البرتقال، أو قشّري برتقالة. والمادة المغذيّة السحريّة فيه هو فيتامين C. وفي دراسة نشرت في Psychopharmacology، كلّف باحثون ألمان 120 شخصاً بمهمّة الخطابة العلنيّة، بالإضافة إلى معاناتهم من مجموعة من المشاكل الرياضيّة. وكان أولئك الذين تناولوا 3.000 ملغم من فيتامين C يشعرون بتوتّر أقل، وعاد ضغط الدم ومستويات الكورتيزول (هرمون التوتّر) لديهم إلى المستوى الطبيعي بشكل أسرع. ومن المعروف أيضاً أنّ فيتامين C يعزّز الجهاز المناعي.

الأسماك

هرمونات التوتر عدوّها أحماض أوميغا-3 الدهنيّة. وقد وجدت دراسة علمية أنّ النظام الغذائي الغنّي بأحماض أوميغا-3 الدهنيّة يمنع الزيادة الكبيرة لمستوى الكورتيزول والأدرينالين. وتحمي أحماض أوميغا-3 الدهنيّة أيضاً من الأمراض القلبيّة. تناولي ثلاث حصص من الأسماك، خاصة الأسماك الدهنيّة، مثل السلمون والماكريل والرنجة والتونة الخفيفة، مرّتين أسبوعيّاً على الأقل. إذا كنت لا تحبّين السمك، وللحصول على كفايتك من أحماض أوميغا3، اشتري الأطعمة المعزّزة بـ DHA (ستجدين هذا الحمض الدهني في البيض واللبن الزبادي والحليب ومنتجات الصويا) ولكن لا تبذلي جهداً كبيراً لشراء المنتجات المعزّزة بمستويات كبيرة من ALA، وهو حمض دهنيّ آخر، والذي قد لا يكون فعّالاً.

السبانخ

يساعد أوّلاً على تخفيض مستويات الشدّة، مما يبقي جسمك في حالة راحة نسبيّة. عدم الحصول على كفايتك من المغنيسيوم قد يحفّز الصداع النصفي ويجعلك تشعرين بالتعب. (حوالي سبعة من كل عشرة أشخاص لا يحصلون على كفايتهم من هذا المعدن). ويوفّر لك كوب واحد فقط من السبانخ 40 % من احتياجاتك اليوميّة.
قد يقلل كوب من الحليب تشنّجات العضلات، ويهدّئ التوتر, ويخفّف من أعراض الدورة الشهريّة، مثل تقلّبات المزاج والقلق

nosa_aic
04 - 02 - 2012, 12:04
كيف نتجنب تعرضنا لأمراض العصر؟


اليكم بعض الوصايا والنصائح التي إذا اتبعناها تعمل على مساعدتنا على تجنب بعض أمراض العصر المنتشرة هذه الايام



أولا: تناول الزيوت النباتية مثل زيت الزيتون بدلاً من الدهون الحيوانية الموجودة في اللحم الاحمر والدجاج وصفار البيض.



ثانيا: تناول خمس أنواع من الفاكهة والخضار يومياً خصوصاً الطماطم، العنب الأحمر...، حيث تمنع من السكتة الدماغية وأمراض السكري والقلب.



ثالثا: الإبتعاد عن التدخين لأن التدخين ينتج عنه الإصابة بالجلطات القلبية وأمراض السرطان.



رابعا: أكل الحبوب مثل القمح والأرز أربع مرات أسبوعياً لأنه يقلل من احتمال الإصابة بالسرطان بنسبة 40%.



خامسا: تناول الأسماك مرة أسبوعياً على الأقل وذلك يعمل على تفادي أمراض القلب ويقلل معدل الوفيات بسبب الجلطة القلبية.



سادسا: إذا كنت من الأشخاص الذين لا يحصلون على غذاء متكامل فإنه عليك بتناول حبة فيتامينات بشكل يومي فذلك يقي من الإصابة بسرطان القولون.



سابعا: ممارسة رياضة المشي السريع لمدة نصف ساعة على الأقل ثلاث مرات أسبوعياً، فذلك يساعد على تجنب الإصابة بأمراض القلب وتخفيض نسبة الكوليسترول.



ثامنا:بالنسبة للأشخاص الذين يعانون من ارتفاع في ضغط الدم وللحوامل، فإنه يفضل الأقلال من شرب القهوة والشاي والمشروبات الغازية التي تحتوي على مادة الكافيين.



تاسعا: إعمل على قياس وزنك وطولك بشكل دوري وتأكد أن وزنك في الحدود الطبيعية.



عاشرا: وأخيرا تذكروا أن الضغوط النفسية الكثيرة التي يعاني منها الكثير من الناس تعتبر من أهم الأسباب التي تساعد على ظهور الكثير من أمراض العصر، لذلك لا تترددوا في استشارة أهل الأختصاص في هذه الأمور.

مع تمنياتي بالتمتع بالصحة الجيدة للجميع

nosa_aic
04 - 02 - 2012, 12:11
التهاب المفاصل


http://www.2y20.com/imgcache/11155.imgcache.jpg (http://www.dlu3at.net/vb/article48165.html)


ما هو التهاب المفاصل؟
التهاب المفاصل مرض يُسبب تورم و تصلب و آلام في المفاصل، مما يؤدي بدوره إلى الحد من حركة المفصل.


ما هي أنواع التهاب المفاصل؟

هناك ما يزيد عن مئة نوع من التهاب المفاصل،تتراوح بين النوع الناتج عن شد وتمزق الغضروف مثل التهاب العظام Osteoarthritis ، إلى النوع الناتج عن فرط نشاط الجهاز المناعي مثل التهاب المفاصل الرثوي Rheumatoid Arthritis (الروماتيزم).


ما هي أعراض التهاب المفاصل؟

تشتمل الأعراض بشكل عام على ألم موضعي، وتقييد لوظيفة المفصل، وتشوه شكله،كما تتصف المفاصل الملتهبة بتصلبها وانتفاخها واحمرارها وضعفها وسخونة ملمسها.
تتضمن الأعراض التي تتميز بها بعض أنواع التهاب المفاصل كالرثية Rheumatoid Arthritis أو الذئبة الإحمرارية Lupus Erythematosus ما يلي: ارتفاع درجة الحرارة، وانتفاخ في الغدد، وفقدان الوزن، والإحساس بالضعف، وكذلك أعراض ناتجة عن الوضع غير الطبيعي لبعض الأعضاء كالرئتين أو القلب أو الكليتين.


من الذي يُصاب بالتهاب المفاصل؟

يصيب هذا المرض الرجال والنساء والكبار والصغار على حدٍ سواء، ويبلغ عدد المصابين به حوالي 350 مليون شخص حول العالم.


كيف يُشخص التهاب المفاصل؟

لتشخيص هذا المرض يجب تقييم الأعراض، وإجراء الفحص الطبي والشعاعي، وهذا مهم لإظهار مدى الضرر الواقع على المفصل، أما فحوص الدم المخبرية وغيرها فهي تُساعد على تحديد نوعية التهاب المفصل.

ما هي الأدوية المستعملة في العلاج؟

هناك الكثير من مجموعات الأدوية التي تُستعمل في علاج التهاب المفاصل تتضمن التالي:

· المسكنات: هي أدوية تُخفف الألم ، إلا أنها لا تخفف الالتهاب. ويعتبر الأسيتامينوفين Acetaminophen (تايلينول Tylenol) من أشهرها. يُمكن للطبيب وصف المسكنات المخدرة في حالة الألم الشديد مثل الكوديين.

· مُضادات الالتهاب غير الستيروئيدية NSAIDs: توصف عادة لتخفيف التهاب المفصل. وهي تُقسم إلى مجموعتين الأولى تقليدية مثل دايكلوفيناك Diclofenac ( فولتارين (Voltaren® والأيبوبروفين Ibuprofen(بروفين Brufen®)). والثانية حديثة وهي مُثبطات كوكس-2 COX-2/ Inhibitors مثل سيليكوكسيب Celecoxib (سيليبريكس Celebrex®).

· مُعدلات المرض المضادة للرثية Disease-Modifying Anti-Rheumatic Drugs DMARDs: تعمل هذه الأدوية بطريقة أو بأخرى على تثبيط فرط المناعة مع/ أو بدون تثبيط النظام الالتهابي ، وبهذه الوسيلة تقوم بالسيطرة على شكل من أشكال تطور المرض. أشهر دواء مُستعمل في الوقت الحاضر من هذه المجموعة هو الميثوترويكسيت Methotrexate وهناك بعض الأدوية الأخرى مثل: (روماتريكس Rheumatrex®)، سلفازالازين Sulfasalazine (آزولفيدين Azulfidine®)، هايدروكسيكلوروكوين Hydroxychloroquine (بلاكوينيل Plaquenil®)، ليفلونومايد Leflunomide ( آرافا Arava®)، سايكلوسبورين Cyclosporine (سانديميون Sandimmune®، نيورال Neoral®)، وهناك غيرها مثل أملاح الذهب Gold salts(سولغانال Solganal® ) ، آزاثايوبرين Azathioprine (إيميورانImuran®)، دي-بينيسيلامين D-Penicillamine (سوبريمين Cuprimine® ، ديبين Depen®).

تُثبط هذه المجموعة جهاز المناعة، لذلك تجب مراقبة أعراض العدوى بالالتهابات مثل الارتعاش، وارتفاع الحرارة، والتهاب الحلق أو السعال، وإخبار الطبيب عن حدوثها، كما يجب التشاور مع الطبيب المُعالج قبل أخذ أي لقاح أثناء فترة العلاج بأحد هذه الأدوية.

· مُعدلات الاستجابة الحيوية Biologic Response Modifiers (BRMs): توقف هذه المجموعة تطور المرض، وقد تبدأ في بعض الحالات فترة طويلة من تخفيف الألم. تعمل هذه المجموعة على تثبيط عمل بروتينات لها علاقة بالالتهاب تُدعى السايتوكينز Cytokines. أمثلة عن هذه المجموعة: أداليميوماب Adalimumab (هيوميرا Humira )، إيتانيرسيبت Etanercept (إينبريل Enbrel)، إنفليكسيماب Infliximab (ريميكاد Remicade)، أناكينرا Anakinra (كينيريت Kineret ).

· الستيروئيدات القشرية Corticosteroids (Steroids): تنتمي هذه الأدوية إلى هورمون الكورتيزول الذي يفرزه الجسم طبيعياً، وهي أدوية فعّالة يمكنها تخفيف الانتفاخ والالتهاب بسرعة، إلاّ أنه بات معلوماً بأن استعمالها لمدة طويلة أو تناولها بجرعات عالية يزيد من احتمال حدوث أعراض جانبية خطيرة. يمكن للأطباء وصف جرعات وريدية عالية من الستيروئيدات ولمدة قصيرة، أو حقنها موضعياً في المفصل الملتهب لتخفيف الألم والانتفاخ حيث يتوفر بعضها مُخصصاً للحقن الموضعي مثل الترايامسينولون Triamcinolone (كينالوغ Kenalog).

هل هناك طريقة علاج غير دوائية للالتهاب المفاصل؟

نعم، يمكنك اتّباع النصائح التالية التي تُخفف الألم ولكنها لا تعالج المرض وتشفيه:

· خفف وزنك إذا كان زائداً.

· مارس التمارين الرياضية القصيرة.

· استعن بالمعالجة الفيزيائية.

· استعمل العكاز والأدوات الأخرى لحماية المفاصل.

· تحاشى حمل الأشياء ثقيلة الوزن.

· تحاشى إجهاد المفاصل.

· استبدل رفع الأشياء لتغير مكانها بدفعها من مكان إلى آخر.

· استعمل الكمادات الحارة أو الباردة (أو الاثنتين معاً بالتناوب) لتخفيف الألم والتصلب.

nosa_aic
04 - 02 - 2012, 17:45
اعراض نقص الكالسيوم وعلاجه


-هل أنت عصبية وكثيرا ما تشعرين ب تعكر المزاج؟

-هل تشعر بالام في المفاصل والساقين؟

-هل تعاني أحياناً من نقص العضلات او اجهادها ؟

-هل لديك مشاكل في الأسنان ؟

-هل تعاني من التهاب المفاصل؟

-هل تعاني او تشعر بالدور و الخفقان؟

الكالسيوم عنصر أساسي لصحة القلب والأوعية الدموية والعظام القوية والنمو هو أيضا يلعب دوراً هاما في نظام الحركه والنقل و يجعل الشعور باللمس والحس اكثر وضروري عند انكماش العضلال للذكور والعوامل الحسية عند المرأة الكالسيوم أيضا الجزء مكون من جميع سوائل الجسم.

المصادر الاساسية له

منتجات الألبان

حزب الخضر المورقة

حبوب

الخوخ المجفف

المكسرات

الفواكه المجففة

المحار والسمك الصغير(مثل السردين وأسماك الأنشوجة )

اميره اميره
04 - 02 - 2012, 19:44
http://www.mazikao.net/vb/imgcache/58977.png
http://i53.tinypic.com/66gcuo.jpg

nosa_aic
05 - 02 - 2012, 05:31
http://www.mazikao.net/vb/imgcache/58977.png
http://i53.tinypic.com/66gcuo.jpg

اللهم امييييين

و كل عام و الجميع بخير

:cgiving:

nosa_aic
05 - 02 - 2012, 05:33
التغيير في لون العين علامة لوجود خلل بالجسم


أثبتت دراسة طبية حديثة أجراها باحثون بريطانيون بجامعة لندن أن شكل وصحة العين يكشف عن العديد من الأمراض التي يعانيها الجسم كوضع الأظافر ووضع الجلد وغيرها من أجزاء الجسم ولذلك فإن أي تغيير في لون العيون أو نوعية الرؤية يمكن أن يشكل تحذيرا بأن إشكاليات ما يعانيها الجسم قد يكون البعض منها خطيرا.
وقد نبه الباحثون من خلال الأوساط الطبية المختصة بعلم العيون إلى أن بعض التغييرات التي تطرأ على العيون يمكن لها أن تشكل البدايات الأولى المحذرة بوجود أورام في الدماغ, أو قصور في عمل الغدة الدرقية, أو بدء الإصابة بمرض اليرقان, أو الإصابة بمرض الجلوكوما أو ما يسمى أيضا بالمياه الزرقاء ولذلك فإن من الأهمية بمكان الاهتمام بهذه التغييرات لالتقاط هذه الأمراض الجدية في بداياتها, الأمر الذي يسهل معالجتها بنجاح.
وقال الباحثون إن هناك العديد من العراض التى يتجالها الناس ومن ضمنها العيون الصفراء حيث ينصح الأطباء من يعانون من تلك الحالة بمراجعة الطبيب فور تغير المنطقة البيضاء في العين التي تسمى الصلبة إلى صفراء لان الأمر يمكن أن يؤشر إلى الإصابة بمرض اليرقان والذي ينجم في الأغلب من الإصابة بفيروسات, أو مرض معد يضر بالكبد كما يظهر مرض اليرقان لدى الإصابة بالحصى في المرارة أو الإصابة بورم في الكبد أو البنكرياس.
وأضافوا أن ذرف الدموع بشكل مبالغ من الاعراض المقلقة حيث من الطبيعى أن تفرز الغدد الدمعية باستمرار كميات من الدموع لترطيب وتنظيف سطح العين ومنع احتكاكها بالجفن غير أن ذرف الدموع بشكل مبالغ به يمكن أن يؤشر إلى حدوث ضرر في قرنية العين أو في الأجفان أو الأهداب, ويرى الاطباء أنه في حال عدم ترافق الذرف المبالغ به بألم فإن ذلك يمكن أن يكون أمرا طارئا يتصحح بشكل عفوي أما في حال الشعور بألم فان ذلك يتطلب مراجعة الطبيب فورا لأنه يمكن أن يؤشر إلى الإصابة بعدوى فيروسية أو دخول جسم غريب أو حدوث ضرر في قرنية العين.

nosa_aic
05 - 02 - 2012, 05:57
احذروا الأكواب المصنوعة من الفلين


احذروا الاكواب المصنوعة من الفلين مادة البولي ستايرين الرغوي ...
والتي يتم استخدامها بكثرة للمشروبات الساخنة ...
في كافة أنحاء الشركات والجامعات والمطاعم ...
وذلك نظرا لما تمثله تلك الأكواب من خطورة على الصحة ...
فقد وجد أن استخدام الأكواب المذكورة للمشروبات الساخنة ...
يؤدي إلى تسرب مادة الستايرين السامة ...
وبعض المواد الهيدروكربونية الأخرى من تلك الأكواب إلي المشروبات الساخنة ...
هذا ما أثبتته التحاليل المخبرية ...
التي أجرتها مختبرات الهيئة الملكية بينبع ...
والمادة المشار اليها هي من المواد التي قد يتم امتصاصها ...
ووصولها إلى بعض الأعضاء الحيوية بجسم الإنسان ...
وبالتالي تراكمها بمرور الزمن ...
من ناحية أخرى لوحظ عدم صلاحية الأكواب المذكورة للاستخدام ...
مع بعض المشروبات الباردة كعصير الليمون الطازج ...
وذلك لتحلل المادة المصنوع منها الكوب عند التعرض لعصير الليمون ...

nosa_aic
05 - 02 - 2012, 06:02
تغطية الرأس أثناء النوم


إن تغطية الرأس أثناء النوم بالكامل عادة سيئة وخطيرة مما يزيد من تركيز ثاني

أكسيد الكربون وقلة نسبة الأكسجين في الحيز المتاح للتنفس ويؤدي هذا مثل

التدخين إلى كارثة تصيب خلايا المخ وقد تسبب ما يعرف بالانتحار الذاتي لخلايا

المخ وضمورها ووقف نموها وبالتالي فقدان المخ القدرة على القيام بوظائفه

بفاعلية وكفاءة.

nosa_aic
05 - 02 - 2012, 06:06
النهوض السريع من السرير عند الاستيقاظ من النوم ... خطر

عندما تستيقظ قد تشعر في كثير من الأحيان بأنك مليء بالنشاط والحيوية فتقفز من السرير بقوة ونشاط ولكن اهدأ قليلا فتلك القفزة السريعة من السرير قد تسبب لك فيما بعد أزمة قلبية مفاجئه...

يقول الأطباء :

أن لحظة الاستيقاظ أو لحظة فتح الجفون هي لحظة مهمة جدا في حياة الإنسان فيما يتعلق بالقلب ودقاته فإذا هب المرء قافزا في تلك اللحظة تحمل القلب عبئا إضافيا مضاعفا لذا عليك أن تسترخي لدقيقه بعد الاستيقاظ ثم تعد جسمك للنهوض وتقوم بكل راحة بعد أن تأخذ الدورة الدموية نشاطها المعتاد.

nosa_aic
05 - 02 - 2012, 06:16
مرض السكر


ما هو السكري
السكري حالة مرضية تتميز بارتفاع مفرط في مستوى السكر في الدم وظهور السكر في البول مع أعراض وعلامات أخرى مميزة. يخضع مستوى السكر في الدم إلى تحكم جيد من قبل الجسم حيث يبقى بين 4 الى 6 ملي مول. ويقوم هورمون الأنسولين (الذي تفرزه غدة البنكرياس) بالمحافضة على هذا المستوى . وفي حالة السكري فإن مقدار الانسولين الموجود في الجسم لا يكفي لحاجة الجسم وهذا يؤدي إلى ارتفاع مستوى سكر الدم الذي يسبب ظهور السكر في الدم

أنواع السكري

يقسم الي نوعين

الأول هو الذي يصيب الأطفال والمراهقين وبعض الرجال والنساء دون سن الأربعين . ولأن هناك عجز كامل في إفراز الانسولين، هنالك حاجة ماسة إلى العلاج بالأنسولين عن طريق الحقن
الثاني وهو النوع الذي يصيب الأشخاص بعد سن الأربعين. وفيه يوجد مقدار متبق من الانسولين في الجسم، ولكنه لا يكفي لحاجة الجسم أو أن الأنسولين لا يعمل بصورة صحيحة بسبب البدانة. قد يكفي التنظيم الغذائي وحده للمحا فظة على مستوى السكر في الدم وفي المدى الطبيعي ولكن الرياضة المنتظمة وإنقاص الوزن سوف يساعدك على تحقيق هذا. بالإضافة إلى التنظيم الغذائي، قد تحتاج الى العلاج بالأقراص، أو بعض الانسولين عن طريق الحقن

أعراض السكري

العطش وجفاف الفم
كثرة الإدرار
نقص الوزن
الإجهاد والتعب
ضبابية أو (زغللة) النظر
قد لا تحدث كل هذه الأعراض معاً وقد تختلف فيما بينها في الشدة. ولكن كل هذه الاعراض تختفي بسرعة عند بدء العلاج

العلاج

يعتمد علاج النوع الأول من السكري على الانسولين. أما النوع الثاني فيعتمد على التنظيم الغذائي أولاً ولكنه قد يحتاج الى استعمال الأدوية أو الانسولين
التنظيم الغذائي هو أهم عناصر علاج السكري. ولعل أهم جانب في التنظيم الغذائي هو إنقاص الوزن وتجنب البدانة. فإذا كنت بديناً فإنه من المهم جدا أن تنقص وزنك إلى الوزن المثالي

مرض السكري من الامراض الشائعة ويصيب مختلف الاعمار والطبقات. أن خطورة هذا المرض تتاتى من امكانية حدوث مضاعفات كثيرة وخطيرة قد تؤدي الى الوفاة او الاصابة بعاهات مستديمة يصعب علاجها مثل فقدان البصر بسبب تخريب شبكية العين كما قد يؤدي الى عجز الكلى وتخريب الاعصاب المحيطية وفقدان الاحساس وما يترتب على ذلك من نتائج خطيرة على المصاب وعائلته على حد سواء.

يمكن تفادي مضاعفات السكر إذا حافظ المريض على :

ابقاء نسبة السكر في الدم قبل الاكل ولمدة ساعتين بعد الاكل بكمية تتراوح بين 4-8 ملليمول في اللتر أو 72-144 ملغم في مائة مليلتر.
أبقاء معدل السكر في خضاب الدم Haemoglobin AIC بنسبة مقاربة للحد الطبيعي وهو 4-6%.
أما طرق علاج المرض بنوعيه الذي يحتاج الى الانسولين والذي يصيب الصغار وذلك الذي يصيب الكبار فيعتمد على توعية المريض وتثقيفه بمشاكل المرض واساليب السيطرة عليه. وتكمن اهمية التوعية في مرض السكري في استمرارية هذا المرض المزعج وعدم امكان الشفاء منه.
العامل الاول في العلاج هو الغذاء، أي الحمية الغذائية فيما يتعلق بنوعية الطعام وكميته ووقت تناوله. وتزداد اهمية تثبيت مواعيد تناول وجبات الطعام بالنسبة للنوع الاول الذي يصيب صغار السن حيث يجب حقن الانسولين قبل تناول الطعام بفترة قصيرة.
العامل الثاني في العلاج هو الرياضة التي يجب ان تكون تحت اشراف طبي واهمية الحركة والتمارين الرياضية كبيرة في علاج هذا المرض . العامل الثالث هو العلاج بالادوية إذا فشلت الحمية الغذائية والرياضة في السيطرة على المرض. وتستخدم هذه الادوية لعلاج النوع الثاني من المرض الذي يصيب المسنين والكهول ويجب ان تؤخذ تحت اشراف الطبيب وهناك عدة انواع من هذه الادوية.
العامل الرابع في العلاج هو الحقن بالانسولين الذي يستخدم عادة لعلاج النوع الاول من المرض الذي يصيب الاطفال والشبان. وتعطى هذه الحقن عادة مرتين في اليوم.
أما عن الوقاية من المرض فقد اثبت الدراسات ان هناك شرائح معينة من الناس اكثر عرضة من غيرهم للاصابة بالمرض:
السيدات اللواتي يرتفع لديهن مستوى السكر في الدم خلال فترة الحمل. فقد يستمر المرض لديهن أو يعود خلال سنة واحدة او سنتين بعد الولادة وننصح هؤلاء بإرضاع اطفالهن واتباع الحمية الغذائية والرياضة للتقليل من اوزانهن.
العامل الوراثي وخاصة إذا كان احد الوالدين او كلاهما مصاب بداء السكري. السمنة وخصوصا حول البطن او ما يدعى بالكرش.
قلة الرياضة والحركة
تناول بعض الادوية مثل حبوب منع الحمل وبعض الهورمونات مثل الكورتيزون وبعض المدررات. وفي مثل هذه الحالات ينبغي ازالة او علاج المسببات للوقاية من المرض.

nosa_aic
07 - 02 - 2012, 05:58
البطاطس قرمزية اللون تخفض ضغط الدم المرتفع بين البدناء

أظهرت الأبحاث الطبية الحديثة أن تناول البطاطس قرمزية اللون تعمل على تخفيض ضغط الدم المرتفع بين البدناء خاصة فى حال تناولها مرتين يوميا على مدار شهر كامل.وأشارت الابحاث التى أجريت فى هذا الصدد أن البدناء الذين اعتادوا على تناول البطاطس القرمزية بصورة منتظمة فى نظامهم الغذائى لم ينجحوا فقط فى خفض الضغط المرتفع بل أيضا فى عدم اكتسابهم مزيدا من الوزن .
وكان الباحثون بجامعة "نيويورك" الامريكية قد أجروا أبحاثهم على نحو 18 بالغا فى مرحلة منتصف العمر , حيث طلب من نحو نصف المشاركين تناول نحو ست حبات من البطاطس القرمزية بالقشرة وذلك على وجبتى الغداء والعشاء لنحو أربعة أسابيع فى الوقت الذى يتناول فيه الاخرون البطاطس .
وكشفت المتابعة أن الاشخاص الذين انتظموا فى تناول البطاطس القرمزية نجحوا فى خفض ضغط الدم المرتفع بينهم بمعدل 3% وعدم إكتسابهم للوزن فى الوقت الذى لم يطرأ فيه أى تغير فى معدلات ضغط الدم بين الاشخاص الذين لم ينتظموا فى تناول البطاطس القرمزية .

nosa_aic
07 - 02 - 2012, 06:03
الزعتر.. يقوي جهاز المناعة (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/158653-%D8%A7%D9%84%D8%B2%D8%B9%D8%AA%D8%B1-%D9%8A%D9%82%D9%88%D9%8A-%D8%AC%D9%87%D8%A7%D8%B2-%D8%A7%D9%84%D9%85%D9%86%D8%A7%D8%B9%D8%A9)



http://www.alwafd.org/images/news/313074352g456df4g.jpg



يعد الزعتر من أكثر التوابل فائدة للإنسان، ويحتوي علي عناصر تدعم جهاز المناعة، ولذلك لا تخلو منه موائد الكثير من الأسر في بلاد الشام، حيث يحرصون علي إضافته علي الطعام،
خاصة مع زيت الزيتون الذي يضفي عليه طعماً لذيذاً، وتصنع بعض الأسر مناقيش لها مذاق رائع، وتصنع منه بعض العائلات هناك «دُقَّة» بإضافة السمسم المحمص والملح وملح الليمون، وهناك من يضيف إليها بعض المكسرات المطحونة، وبإضافة زيت الزيتون إليها نحصل علي خلطة لذيذة وصحية. وفي بعض البلدان تصنع معجنات يضاف إليها الزعتر وزيت الزيتون للحصول علي قطعة خبز شهية ومفيدة.. ويمكن تناول الزعتر في صورة شاي، حيث توضع نصف ملعقة صغيرة منه في كوب ويضاف إليه الماء الساخن، ويفضل تحليته بعسل النحل، للحصول علي المزيد من فوائد هذا المشروب في تقوية جهاز المناعة.
وينتشر الزعتر في دول حوض البحر المتوسط، ومنه الزراعي والبري، ومن المعروف أن النباتات البرية أكثر فائدة من النباتات الزراعية. ويعرف الزعتر برائحته العطرية الجميلة، التي جعلت بعض الناس يطلقون عليه «مُفرح الجبال»، وذلك لأن رائحته الزكية تفوح في الجبال التي ينتشر فيها، ومنها الجبل الأخضر في ليبيا.
يتميز الزعتر بالعديد من الفوائد الصحية، ومن أهمها تخليص الجسم من السموم، منها: علاج الكحة والسعال الديكي ونزلات البرد والربو والالتهابات الشعبية، وتحسين الهضم وفتح الشهية ومنع تخمر الطعام، وعلاج الإسهال، والتخلص من الديدان والطفيليات المعوية وجراثيم القولون، ويعمل علي إدرار البول، وتقوية عضلة القلب، والحماية من تصلب الشرايين، وخفض الكوليسترول، ويعالج آلام الأسنان واللثة، ولذلك فإنه يستخدم في صناعة بعض معاجين الأسنان لقدرته علي تطهير الفم.
ويجب ملاحظة أن الزعتر يسبب الإمساك، لذلك يضاف إليه زيت الزيتون للوقاية من هذه الخاصية.
أكدت دراسة كيميائية للدكتور محمد أحمد مطر الباحث في المركز القومي للبحوث أن الزعتر مفيد في شفاء كثير من الأمراض، خاصة أمراض الجهاز التنفسي مثل السعال الديكي والالتهابات الشعبية والربو، بالإضافة الي مرض نقص المناعة المكتسبة «الإيدز».. وأشار إلي أنه يحتوي علي مواد لها خاصية مسكنة للألم ومطهرة ومنشطة للدورة الدموية.
وقال: إن نبات الزعتر إلي جانب أنه يزيد الشهية لتناول الطعام، فإنه يحتوي علي مادة الثيمول التي تعمل علي قتل الميكروبات وتطرد الطفيليات من المعدة.

nosa_aic
07 - 02 - 2012, 06:17
كيف تتخلص من الانتفاخ ؟

يعاني الكثير من الأشخاص من انتفاخ المعدة الذي يسبب الألم والضيق ويسعى الكثير للحصول على الطرق السهلة للتخلص منه



وإليك بعض النصائح التي تجعلك تتخلص منه نهائيا:


تجنب الأطعمة الآتية أو تناولها بكميات قليلة مثل:


-الأطعمة الغنية بالكربوهيدرات حيث يؤدي تناول الكثير منها إلى احتباس الماء التي لا لزوم لها، وتزيد من الانتفاخ.
-الخضار غير المطهي فمن المعروف أن الإكثار من الخضار يسبب العديد من الغازات عندما تؤكل قبل طهيها، خاصة القرنبيط، والبروكلي، والفلفل، والبصل،.... في حين ان تناول الخضار بعد طهيه يحتوي على نفس القيمة الغذائية له قبل طهيه.
-الأطعمة الغنية بالتوابل والملح بما في ذلك الأغذية المصنعة والتي تؤدي إلى زيادة نسبة الحموضة بالمعدة ويزيد من عملية الإنتفاخ والإلتهابات.
-التقليل من تناول الأطعمة الدسمة بالدهون، وخاصة الأطعمة المقلية، والتي تسبب الإنتفاخ نتيجة البطء الشديد في هضمها ويمكن استبدال ذلك بتناول الأطعمة التي تحتوي على الأحماض الدهنية غير المشبعة الاحادية مثل زيت الجوز، وبذور عباد الشمس والأفوكادو.
المشروبات الغازية:لما تحتويه من فقاعات الهواء التي تزيد من نسبه الهواء في المعدة وتسبب الانتفاخ.
يعتقد الكثير أن مضغ اللبان يعمل على إراحة المعدة ولكن أثبتت الأبحاث أن مضغ اللبان يمكنه أن يزيد من نسبة الهواء في المعدة مما يزيد من الانتفاخ.


وإليك أيضا بعض النصائح التي تقلل من الانتفاخ مثل:

1- ممارسة رياضة المشى التى تقلل من الانتفاخ لان النشاط البدنى يساعد على عملية الهضم و يسيل الغازات فى المسالك بشكل اكبر
2- تناول الطعام ببطء لان تناوله بسرعة كبيرة جدا يجعلك تدخل المزيد من الهواء الى معدتك و يسبب الانتفاخ مع الحرص على اغلاق الفم دائما عند مضغ الطعام

3- تناول المزيد من كميات المياة لانها تساعد على التخلص من الانتفاخ و الحد منه
4- تجنب استخدام الشفاطات ( الشاليمو) عند تناولك المشروبات لما تسببه من زيادة نسبة دخول الهواء فى المعدة و الذى يسبب المزيد من الانتفاخ

nosa_aic
08 - 02 - 2012, 08:17
ملعقة من السكر تساعد الطفل على ابتلاع الدواء


أظهرت الأبحاث الطبية أن تناول الطفل لملعقة من السكر تساعده على ابتلاع الدواء وسرعة وصوله إلى المعدة.
حيث يجد الكثر من أولياء الأمور مشقة فى إقناع الاطفال بتناول الدواء لما يتصف به من المذاق المر واللاذع لكثير من الأطفال يرفضون معه ابتلاعه .
وأوضح الباحثون أن إضافة القليل من السكر على بعض عقاقيرالسعال والحساسية للاطفال على سبيل المثال يسهم فى سرعة تقبلهم وابتلاعهم للدواء بالإضافة إلى سرعة إمتصاصه.

nosa_aic
08 - 02 - 2012, 08:29
أمراض الأطفال من الألف إلى الياء

http://photoserver.ws/files/1xy7g8u2a26srjefnf0p.gif (http://www.dlu3at.net/vb/redirector.php?url=http%3A%2F%2Fforum.sedty.com%2F )

1-التهاب رئوى


أحد الأمراض المنتشرة والخطيرة التي تصيب الجهاز التنفسي للأطفال ويكثر حدوثه

في فصلي الشتاء والربيع وهو التهاب للحويصلات الهوائية للرئة وما حولها بواسطة

( المكور الرئوي ) وتحدث العدوى عن طريق الرذاذ المتطاير من أنف وفم المريض

عند السعال وتشكل نزلات البرد والأنفلونزا وإهمال علاجهما العامل الرئيسي في

حدوث المرض .


أعراضه


تبدأ بارتفاع فجائي في درجة حرارة الطفل مع قشعريرة أو رعشة ويصاب الطفل

بهيجان ويصبح تنفسه سريعاً وغير عميق يصاحب ذلك ألم فى جانب الصدر

وسعال جاف وتلاحظ الأم أن فتحة أنف الطفل تنفرج مع الشهيق لإدخال أكبر

كمية ممكنة من الهواء وأن طفلها يحدث أنيناً مميزاً (Grunting)

مع الزفير .


2- برايت


مرض برايت أو (التهاب الكلى الحاد ) نوع من أنواع الحساسية (للميكروب السبحى)

ولذا فغالبا ما يسبق هذا المرض بالتهاب الحلق أو اللوزتين أو الحمى القرمزية وسمي

بمرض (برايت ) نسبة إلى الطبيب الانجليزي (ريتشارد برايت ) الذي اكتشف الحقائق

الرئيسية للمرض .

وهناك ثلاثة أعراض رئيسيه للمرض منها

أولا: تغيرات فى البول وتشمل

( نقص كمية البول وتغير لونه ووجود الزلال وأسطوانات دمويه بالبول )

ثانياً : ارتفاع ضغط الدم

ثالثا : حدوث تورم خاصة الوجه وحول العينين

المضاعفات

هبوط القلب وارتفاع الضغط بالمخ والفشل الكلوي الحاد

ولذا فالوقاية هنا مهمة جداً فيجب عدم تعريض الطفل لنزلات البرد وتجنب وجوده في الأماكن

الرطبة والمزدحمة والاهتمام بنظافة المسالك الهوائية . وحماية الطفل من الإصابة بالتهابات

الحلق واللوزتين والحمى القرمزية .

nosa_aic
08 - 02 - 2012, 08:34
3- تبول لا ارادى


ظاهرة مرضية تعني عدم قدرة الطفل على التحكم في البول أثناء النوم وبعد العام الرابع من عمره

ويحدث بين سن ( 4 ـــ15 ) سنة وتصل نسبته إلى 12% من الأطفال عند عمر ( 5 ) سنوات

و8% عند عمر ( 8 ) سنوات % حتى سن ( 15 ) سنة

وهناك الأسباب العضوية وتمثل 10% من الأسباب وتعود إلى خلل أو مرض عضوي في أحد

أعضاء الجهاز البولي أو الجهاز العصبي المتحكم في نظام الجهاز البولي مثل التهابات حوض

الكلى أو الحالب أو المثانة ، ضيق حجم المثانة ، تشوهات العمود الفقري ، مرض السكر

أما الأسباب النفسية وتمثل 90% من الأسباب فتعود إلى فقدان الطفل الشعور بالأمن

وحرمانه من العطف والحنان ، أيضاً ضرب وتوبيخ الطفل بعد تبوله ، وخوف الطفل

وقلة العناية بالطفل بعد الاهتمام به عقب شفائه من مرض ما مثلاً أو ولادة طفل جديد

يقوم الطبيب بعلاج المرض العضوي بعد عمل الفحوصات المعملية في حالة وجوده

ثم يبدأ العلاج النفسي ببحث الأسباب المؤدية إلى التبول مع الطفل وولديه وتدريب

الطفل أثناء النهار على حبس البول أكبر قدر ممكن ويراعى عدم شرب السوائل

بعد السادسة مساء وتعويد الطفل على إفراغ مثانته قبل النوم .


4 : الجدرى

مرض فيروسي تنتشر عدواه عن طريق الرذاذ أو عن طريق أدوات المريض الملوثة

تبدأ أعراضه بارتفاع بسيط في درجة الحرارة مع صداع وتوعك عام يعقبها ظهور

الطفح الجلدي المميز للجدري على البطن والصدر والظهر وتحت الإبطين

ويتكون من بقع صغيرة حمراء تتحول إلى ارتفاعات جلدية صلبة( حلميات )

تتحول إلى أكياس صغيرة بداخلها سائل مائي رائق تسمى ( الحويصلات ) ثم يتحول

السائل الرائق إلى سائل صديدي عكر عندئذ تسمى ( البثرات ) ويتميز الطفح بظهوره

في مجموعات وعلى دفعات ويلاحظ ظهور مختلف مراحل الطفح في نفس المكان الواحد


الوقاية والعلاج

يجب عزل الطفل لمنع انتشار المرض وقص أظافره حتى لا يحك جلده فتنفجر الحويصلات

وتهاجمها الميكروبات والعناية بنظافة الطفل ويعتمد العلاج على إعطاء الطفل عقاقير من

شأنها تسكين شدة الحكة ومنع وعلاج مضاعفات المرض .

nosa_aic
08 - 02 - 2012, 08:36
5: الحصبة


مرض فيروسي شديد العدوى تحدث عدواها عن طريق الرذاذ المتناثر من فم وأنف المريض


وأعراضها تشبه الأنفلونزا في البداية حيث ترتفع درجة الحرارة مع زكام ورشح وسعال


جاف واحمرار العينين وفي اليوم الثالث للمرض تظهر بقع بيضاء صغيرة بفم الطفل ( بقع كوبلك )


وفي اليوم السابع يظهر طفح جلدي أحمر اللون خلف الأذنين والجبهة ثم ينشر ليغطي الجسم كله


ومضاعفاتها : النزلات المعوية والشعبية ، والالتهابات الرئوية ، والتهاب المخ ومن هنا تأتي أهمية


( الوقاية ) من هذا المرض الخطير وذلك بتطعيم الطفل بطعم الحصبة ( 2/1 سم حقنا تحت الجلد )


في الشهر التاسع مرة واحدة ..


6 : الخناق ( الدفتيريا )

مرض شديد العدوى ، يصيب الحلق أساساً ( 80 % من الحالات ) وبدرجة أقل الحنجرة

والأنف والعين والجلد وتنتقل عدواها بواسطة الرذاذ المتطاير من المرضى أو حاملي الميكروب

ويلعب اللبن دوراً مهماً في نقل العدوى تظهر أعراضها على هيئة وجع بالحلق وصعوبة في البلع

وارتفاع في درجة الحرارة وقيء وفقدان الشهية للطعام

من علامات المرض وجود ( غشاء ) سميك ملتصق بالحلق لونه رمادي ينزف دما عند إزالته

ووجود تضخم في الغدد اللمفاوية في الرقبة وتتم الوقاية ، بتطعيم الطفل بالطعم الثلاثي

( الدفتيريا والسعال الديكي والتيتانوس ) 2/1 سم

حقنا في العضل في الشهور الرابع والسادس والثامن ثم جرعات تنشيطية عند ( 18 ) شهر

و ( 3 ) سنوات و( 6 ) سنوات

nosa_aic
08 - 02 - 2012, 08:39
7 : الدرن


مرض معد تحدث عدواه نتيجة للاختلاط المباشر بالمرضى أو شرب لبن ماشية مصابة بالدرن

أو استنشاق الغبار المحمل بميكروب المرض ويهيئ لانتشاره البيئة غير الصحية والمنازل

المحرومة من الشمس والهواء النقي وسوء التغذية والأمراض المنهكة مثل السكر

وأعراضه

ارتفاع بسيط في درجة الحرارة خاصة في المساء وفقدان الشهية ونقص في الوزن

وكحه جافة وعرق غزير أثناء الليل

الوقاية

بالتطعيم بطعم ( البي . سي . جي ) ويعطى حقناً بجلد أعلى الذراع خلال أول

أربعين يوماً للولادة ، ويكرر التطعيم عند سن ست سنوات مع تهوية المنازل ، وغلي اللبن

جيداً ،والفحص الدوري للأطفال واكتشاف حاملي المرض وعلاجهم .


8: ذبحة الزور


التهاب الحنجرة والقصبة الهوائية مع تقلصهما ، تبدأ أعرضها عادة بعد نوبة

من نوبات البرد أو أي عدوى مشابهة، ويكون الطفل مبحوح الصوت إلى حد

ما ، فيما عدا ذلك يبدو طبيعيا في أثنا النهار وعندما يأوي إلى فراشه تبدأ النوبة

بكحة جافة لها شيء من الرنين الخاص، سرعان ما تصبح شديدة وتتميز بصوت

( النباح ) المميز لها ونظراً لتقليص الحنجرة فإن الطفل يجد صعوبة شديدة في

التنفس ، وعند محاولته التنفس يصدر عنه صوت قوي معروف قلما يُنسى.

العلاج

استنشاق صبغة الجاوة والأكسجين ، ويصف الطبيب المضاد الحيوي

المناسب وقد يحتاج إلى شق حنجري عند انسداد في الحنجرة

nosa_aic
08 - 02 - 2012, 08:43
9: حمى روماتزمية


مرض خطير يصيب الأطفال من سن ( 5 ) سنوات إلى ( 15 ) سنة نتيجة

( لحساسية ) بعض الأطفال للميكروب السبحي الذي يصيب الحلق واللوزتين

والجلد وتختلف الأعراض من حالة إلى أخرى فقد تظهر على هيئة ارتفاع

في درجة الحرارة مع التهاب وتورم بالمفاصل الكبرى مثل مفصل الركبتين

والكاحلين والكتف والكوع ، أو عقد روماتزمية بالجلد أو إصابة عضلات القلب

وصماماته أو قد يكون على هيئة ( كوربا ) روماتزمية ويتميز ورم المفاصل

بأنه يظهر في أحد المفاصل ثم يختفي ليظهر في مفصل آخر ونظرا للعلاقة الوثيقة

بين التهابات الحلق واللوز والإصابة بالحمى الروماتزمية يجب علاج هذه

الالتهابات علاجاً كافياً وتحت إشراف الطبيب .



10: الزكام ( نزلة البرد )



عدوى سريعة الانتشار للجزء العلوي من الجهاز التنفسي بفيروسات معينة

ويساعد على إصابة الطفل ( الإجهاد وسوء التغذية والتعرض للتيارات الهوائية )

الأعراض

زكام ورشح من الأنف ، تدميع العينين ، صداع وجفاف الحلق ،

وقد ترتفع درجة الحرارة ، مع كحة جافة أحياناً .

المضاعفات

التهاب الجيوب الأنفية ، التهاب الأذن الوسطى والحنجرة

nosa_aic
08 - 02 - 2012, 08:49
11: النزلات الرئوية والشعبية.


ويعتمد العلاج على الراحة التامة ، وحسن التغذية ، وتناول فيتامين ( ج )

وسرعة علاج المضاعفات في حالة حدوثها بواسطة الطبيب .



12: السعال الديكي ( الشاهوق )



مرض معد تنقل عدواه عن طريق الرذاذ أثناء السعال ، وتكثر حالاته

في فصل الشتاء ،

وأهم أعراضه : ارتفاع درجة الحرارة ، وسعال قد يعقبه قيء خاصة

أثناء الليل ، وحدوث نوبات من السعال ، تتكون كل نوبة من شهيق

عميق يعقبه زفير قصير متتابع مع صوت يشبه صيحة ( الديك )

ومن هنا جاءت التسمية .

وأهم مضاعفاته : الالتهاب الرئوي الشعبي والفصي وانقباض الرئة

وحدوث فتق سري ، أو سقوط المستقيم

الوقاية : مثل ( الدفتريا ) بواسطة الطعم الثلاثي

nosa_aic
08 - 02 - 2012, 08:54
13 : شلل الأطفال

مرض يحدث نتيجة العدوى بفيروس خاص . وتنتقل عدواه بواسطة

الرذاذ ، أو عن طريق تناول طعام أو شراب ملوث بفيروس المرض

ويلعب الذباب واللبن دوراً مهماً في نقل العدوى .

الأعراض

تشبه في البداية الأنفلونزا فترتفع درجة الحرارة ، مع صداع

ورشح واضطرابات بالجهاز الهضمي . ثم يبدأ ( دور الشلل ) فجأة

حيث لا يقوي الطفل على السير أو الجلوس ثم ينحسر الشلل تدريجياً

ويبدأ الطفل في استعمال أطرافه كما يمكنه الجلوس أو السير ثم يتوقف

الشلل عن التحسن ، ويكون الشلل المتبقي أقل بكثير من الشلل الذي

بدأ به المرض .

الوقاية

بتطعيم الطفل بالطعم الحي المروض ( سابين ) بنقطتين

على اللسان ، وفي نفس مواعيد الطعم الثلاثي . ويجب الاهتمام بتهوية

المنازل ونظافة الطعام والشراب ، ومكافحة الذباب ، وغلي اللبن جيداً

قبل تناوله ، وعدم ارتياد الأماكن المزدحمة .


14 : الصرع


مرض عصبي منتشر ، يحدث نتيجة لعدة أسباب

أهمها: إصابات وأورام المخ

التهاب السحايا ( الحمى الشوكية ) ، التشوهات الخلقية ، الولادة العسرة ، اضطرابات

الغدد والتمثيل الغذائي ، ونقص السكر في الدم وتلعب الوراثة دوراً مهماً في

أنواع معينة من الصرع .

والصرع في الأطفال أنواع:

دور الصرع الصغير ، وهو عبارة عن عدة نوبات تتكرر يومياً كل نوبة تتكون

من غفوة وقتية مصحوبة بالتحديق في الفضاء وصمت لبضع ثوان ، يعود بعدها

الطفل إلى إكمال ما كان عليه قبل النوبة

دور الصرع الكبير ، يبدأ بفقدان الطفل لوعيه مع تشنج توتري في العضلات

مصحوب بتوقف التنفس وظهور زرقة وزبد بالفم ، وقد تبدأ النوبة الصرعية

في جزء محدود من جسم الطفل مثل : زاوية الفم ، أو حركة لاإرادية بالأصبع

الكبير بالقدم ، ثم ينتشر على جانب واحد من الجسم ، وهذا يُعرف ( بالصرع البؤري )

nosa_aic
08 - 02 - 2012, 08:58
15 : ضعف الشهية


قد يعود ضعف الشهية عند الطفل إلى ( أسباب مرضية ) مثل : النزلات المعوية

والشعبية الحصبة ،الأنفلونزا ، نزلات البرد ، التهاب الحلق ، التهابات الفم خاصة

مرض القلاع . كذلك عند التسنين وبعد التطعيمات . أو إلى( أسباب نفسية )

وتعود إلى أخطاء تربوية في تنشئته ، أو عدم انتظام وجبات الطفل وعدم مناسبة

نوعية الطعام وتركيزه لسن الطفل ومزاجه الخاص ، والفطام التأخر .



16: الطفولة ، سكر


مرض يصيب الأطفال تحت سن ( 15 ) سنة ، ويرجع إلى تلف خلايا ( لا نجرهانز )


الموجود في البنكرياس التي تفرز هرمون الأنسولين ، وبالتالي يعجز البنكرياس


عن إمداد الجسم بحاجته من الأنسولين ، ولذا فهذا النوع من السكر يستجيب للعلاج بحقن


الأنسولين ، ويودي ذلك العجز إلى ارتفاع نسبة السكر في الدم عن معدلها الطبيعي ،


وتسرب السكر في البول ، ومن ثم ظهور أعراض المرض المعروفة

nosa_aic
08 - 02 - 2012, 09:25
http://www.shamsqatar.com/up/get.php?filename=1248262153.jpg (http://www.dlu3at.net/vb/article44972.html)

طرق حساب طول و وزن الطفل

تتمنى كل أم أن يكون طول ووزن الطفل متناسباً مع عمره، وفي الحالات الطبيعية يزداد طول الطفل على دفعات وليس بصورة متواصلة ويقاس طول الطفل مرة كل شهر وليس يومياً، وكذلك بالنسبة لوزن الطفل، أما إذا لاحظت الأم توقف في نمو طول ووزن الطفل فعليها أن تلجأ للطبيب فوراً.

لحساب وزن الطفل:


- وزن الطفل بالكيلو جرام= (عمر الطفل بالسنة × 2+8 )

- ويتراوح وزن الطفل الطبيعي من 3 إلى 3.5 كيلو جرام عند الولادة، ثم يفقد الطفل حوالي 5-10% من وزنه خلال أيامه الأولى نتيجة التبول وشفط سائل الميكونيوم.

وعن وزن الطفل يلاحظ ما يلي:

- يستعيد الطفل وزنه الأول خلال العشرة أيام الأولى من عمره.

- يزداد الطفل 0.75 كيلو جرام كل شهر من الولادة حتى الشهر الرابع.

- يزداد الطفل 0.5 كيلو جرام كل شهر من الشهر الخامس حتى الشهر الثامن.

- يزداد الطفل 0.25 كيلو جرام كل شهر من الشهر التاسع إلى الشهر الثاني عشر.


حساب طول الطفل:

يلاحظ أن طول الطفل يسير بمعدلات خلال نموه هكذا:

- في السنة الأولى يكون طول الطفل حوالي من 70-75 سم.

- وفي السنة الثانية يصل إلى 80-85 سم.

- وبعد مرور أول عامين يحسب طول الطفل من خلال (عمر الطفل × 5+80)

وهذا جدول

http://4.bp.blogspot.com/_FGKrrsRY9iY/TQKVH5LQwCI/AAAAAAAAASI/YkYtD-drP2c/s1600/dev_tab.gif (http://www.dlu3at.net/vb/article45662.html)

ابو مالك
09 - 02 - 2012, 02:07
http://tk.files.storage.msn.com/x1pc_jqddVOWRlyVvLgVz-dFBgC9Xm1XM5kp54DdXYyw3xwnfzpBm8BgdEYyvd1lYfPfrUpT srrHqWDxqT_RdW3J5RneLTJDqMkvjr4f2lOcQa1TLjunuK1NLP 7m_FZFn6xqW_vPV_t1ao

nosa_aic
09 - 02 - 2012, 15:57
ما المقصود بالانزلاق الغضروفى وكيفية علاجه؟

ويجيب عن التساؤل الدكتور باسم هنرى استشارى علاج الألم بمعهد ناصر، مشيرا إلى أنه فى البداية الغضروف يتكون من غلاف خارجى من ألياف قوية تحيط بالمركز (النواة) الذى يشبه فى تكوينه مادة الجيلاتين .

ومع مرور السنوات يحدث تغير فى التركيب الكيميائى للغضروف وخصوصا النواة والذى يجعلهم أقل قدرة على تحمل الضغط الخارجى الذى يتعرضون له، أما الشد فى الغلاف الخارجى فيضغط على الجزء المركزى بسبب تأثير وزن الجسم فينزلق الغضروف من مكانه وإلى داخل القناة العصبية، مما يؤدى إلى الضغط على جذور الأعصاب مسببة ألم شديد بالساق أو بالأطراف العلوية (على حسب مكان الغضروف) .

ويوضح هنرى أن هذه الآلام تكون فى البداية بسيطة ولفترات محدودة ثم تتكرر نتيجة للإهمال إلى أن تصبح مستمرة وتعوق قدرة المريض على الحركة والمجهود وتعتبر الفقرات القطنية أكثر الفقرات عرضه للإصابة، وذلك بسبب تعرضها الدائم للضغط والأحمال الثقيلة.

ويؤكد باسم أن الانزلاق الغضروفى فى حد ذاته لا يحدث ألم، ولكن الألم يحدث نتيجة لحدوث التهاب بالعصب المواجه للانزلاق الغضروفى سواء تتم إزالة الغضروف أو عدم إزالته. لابد من إزالة الالتهاب الحادث حول العصب كعلاج للآلام المتكررة فليس بإزالة الغضروف يحدث إزالة الألم حيث إن التهاب العصب لا يكون ناتجا من الضغط من الغضروف بل ناتج عن التهاب كيميائى نتيجة لخروج مواد كيميائية من نواة الغضروف إلى العصب مسببة حدوث التهاب به.

ويمكن ان نلجأ للجراحة فى علاج الانزلاق الغضروفى خاصة فى حالات تأثر فى العصب الحركى، وعدم التحكم فى البول والبراز، وفقد الانعكاسات العصبية، ولكن فى حالات أخرى يتم علاج المريض عن طريق عمليات الإجراءات التداخلية وتجنب المضاعفات الوارد حدوثها عن طريق الجراحة.

nosa_aic
09 - 02 - 2012, 16:00
كيف أعرف أننى مصاب بمرض السكر، وهل يؤثر على العين بشكل كبير؟

يجيب الدكتور إيهاب سعد أستاذ طب وجراحة العيون مدير مستشفى دنيا العيون قائلا: "تختلف أعراض مرض السكر حسب نوعه فالنوع الأول عادة ما يصيب الأطفال، وتكون ظهور الأعراض حادا وعنيفا وينتج عن نقص مستوى الجلوكوز الحاد فى الدم الناتج عن زيادة النشاط والحرق، مما يؤدى إلى غيبوبة سكرية ويعتبر قياس مستوى السكر فى الدم فى أى طفل أو شاب فاقد الوعى ويصاب بغيبوبة من الاختبارات الضرورية لتشخيص الحالة، وتأكيد المرض وتكمن خطورة انخفاض الجلوكوز فى الدم لتأثيره على المخ، حيث يفقد المريض الوعى وقد يصاب بتشنجات وضرر دائم على المخ.

أما النوع الثانى فتكمن مشكلة مرض السكر من النوع الثانى والذى عادة ما يصيب كبار السن، كما يصيب بعض الشباب صغير السن إذا ما توافر الوزن الزائد أو البدانة فى التأخر فى التشخيص، برغم وجود المرض فمن الممكن أن يعيش المريض لسنوات دون معرفة أنة مصاب بداء السكر ويكون تشخيص المرض عند ظهور المضاعفات على الجسم كاملا، ومن أهم الأعراض التى يجب الانتباه لها نقص الوزن بدون تفسير والعطش المستمر، واختلاف النظر والشعور بالزغللة المستمرة المرتبطة بالطعام مع كثرة الذهاب للتبول، ومن هنا أتى اسم البول السكرى، حيث إن ارتفاع نسبة السكر فى الدم يصاحبه نزوله فى البول، وقد لاحظ الأطباء فى أوائل ظهور المرض أن الحشرات خاصة النمل يتجمع حول البول لاحتوائه على مستويات عالية من الجلوكوز، كما تعتبر الالتهابات المتكررة سواء بالجلد أو الأنسجة عموما من المؤشرات المهمة لتحليل مستوى السكر بالدم، حيث يؤدى مرض السكر إلى نقص هرمون الأنسولين فى الدم، مما يؤدى إلى عدم قدرة الخلايا على امتصاص الجلوكوز من الدم إلى داخل الخلية، مما ينتج عنه ارتفاع مزمن فى نسبة الجلوكوز بالدم ونزوله عن طريق الكلى فى البول، وينتج عن الارتفاع المزمن للسكر فى الدم إلى التأثير على شبكة الأوعية الدموية الدقيقة فى كامل الجسم، حيث تفقد الخلايا الجدارية للأوعية الدموية، مما ينتج عنه ارتشاحات لمكونات الدم خارج الأوعية مثل الدهون وبعض الخلايا الحمراء ومكونات البلازما، مما يؤدى إلى ارتشاحات بالأنسجة وتورم بها ومنها أنسجة شبكية العين، وأيضا خروج البروتينات والزلال عن طريق الكلى فى البول، وينتج عن ذلك خلل فى وظيفة الأنسجة ككل كما يؤدى ارتفاع الجلوكوز المزمن إلى انسداد الأوعية الدموية الدقيقة بالجسم كله.

ويؤكد أن مضاعفات مرض السكر على العين ككل بدءا بالجفون وانتهاء بالعصب البصرى، ويؤدى عدم الانتظام فى مستوى السكر فى الدم إلى حدوث التهابات مزمنة بحافة العين والملتحمة تؤدى إلى احمرار مزمن بالجفون مع إحساس بثقلهم والرغبة فى إغلاقهم، فبالإضافة إلى تأثير السكر على التأخر فى التئام الجروح وتتم الوقاية والعلاج، بالإضافة لضبط نسبة السكر فى الدم إلى استخدام كمادات الماء الدافئ على الجفون مع استخدام بعض القطرات المرطبة أو المضادات الحيوية، حسب الحالة.

كما يؤدى مرض السكر إلى اختلاف مستمر فى مستوى النظر ينتج ذلك عن التأثير الاسموزى لمستوى السكر على العدسة البلورية الداخلية للعين حيث يؤدى ارتفاع مستوى الجلوكوز فى الدم والعدسة البللورية إلى امتصاص الماء وزيادة الجلوكوز فى الدم والعدسة البللورية إلى امتصاص الماء وزيادة سمكها وينتج عن ذلك قصر النظر مع عدم وضوح الإبصار عن بعد، أما انخفاض مستوى السكر بالدم فينتج عنه العكس مع طول فى النظر وعدم القدرة على الرؤية الواضحة من قريب، ويفسر ذلك أيضا إصرار طبيب الشبكية المتخصص على معرفة مستوى الجلوكوز فى الدم عند الفحص لعمل مقاس النظارة، حيث إن ارتفاع أو انخفاض مستوى الجلوكوز يؤثر على مقاس النظارة الطبية الدقيق ويفضل الطبيب تأخير عمل مقاس النظارة حتى ينتظم السكر فى الدم لأخذ المقاس المناسب، حيث إذا ما اشتكى المريض بعدها فى النظر فذلك ما يكون عادة ناتجا عن اختلال فى مستوى السكر، وليس عن اختلال فى مقاس النظارة، كما أن مريض السكر يصاب بمياه بيضاء مبكرة تؤدى إلى عدم وضوح الرؤية، ويتم علاجها عن طريق عملية جراحية بسيطة تتم إزالة المياه البيضاء عن طريق الموجات الصوتية أو الليزر.

nosa_aic
09 - 02 - 2012, 16:09
ما هى جلطة الكمبيوتر وما هى أسبابها؟

أن الجلوس أمام شاشة الحاسب الآلى لساعات طويلة يؤدى إلى زيادة احتمالات الإصابة بالجلطات ‏والتى يطلق عليها متلازمة الدرجة الاقتصادية، عندما تحدث فى الطائرات فى رحلات الطيران الطويلة قد تحدث ‏هذه الجلطات حتى لو لم يكن لديك أى عامل خطورة آخر.

ويجب على الشخص ‏أن يقوم ويتمشى فى الطائرة إذا كانت الرحلة طويلة، كما يجب عليك أيضاً أن تقوم وتتحرك من وقت لآخر عندما تجلس أمام حاسبك الآلي. ويزداد خطر الإصابة بالجلطات الناتجة عن الجلوس أمام الحاسب الآلى بسبب استخدامه فى جميع المجالات سواء كان فى العملاء أو الترفيه أو الاتصالات.

‏وينصح أى شخص يجلس لفترات طويلة أمام الحاسب الآلى أن يقوم ببعض تمرينات القدم والساقين وأن يأخذ بعض فترات الراحة ويتحرك بعيداً عن الحاسب.

‏جدير بالذكر أنه من الشائع جداً حدوث جلطات دموية صغيرة جداً فى الأشخاص الذين يجلسون لبضعة ساعات أمام الحاسب والتى سرعان ما تختفى عندما يقوم هؤلاء الأشخاص ويمشون، ولكن إذا استمروا فى الجلوس لفترات طويلة، فلك أن تتخيل حجم الجلطة التى من الممكن أن تتكون، وأن هذه الجلطة من الممكن أن تؤدى إلى تورم الساق أو من الممكن أن تتكسر وتذهب إلى الرئة أو المخ.

‏وهناك أبحاث تقول إذا أضفت إلى ذلك عوامل الخطورة الأخرى مثل كسر سابق فى القدم أو الإصابة بالأمراض التى تساعد على تكوين الجلطات، فإن احتمالات الإصابة بجلطات كثيرة خطيرة تكون كبيرة كما يجب على الشخص أن يتناول بعض المكملات الغذائية التى لها خصائص مضادة للتجلط مثل مكملات مستخلص الثوم ومكملات الناتوكاينيز، كما يجب تنظيف مروحة الحاسب الآلي، إضافة إلى عدم التعرض للميكروبات الضارة عن طريق تنظيف مروحة حاسبك الآلى بشكل منتظم.

كما يساعد تنظيف حاسبك الآلى من الداخل خصوصا حول المروحة على منع تراكم الفطريات ففى أحد الأبحاث تم أخذ عينات حول مروحة الحاسب الآلى حيث تم عزل أنواع عديدة من الفطريات من هذه العينات ‏كما تم أخذ عينات من هواء الغرفة الذى يبعد حوالى 6 ‏أقدام من الحاسب الآلى، وبتحليل هذه العينات وجد أنها تحتوى على أنواع متعددة من الفطريات.

nosa_aic
09 - 02 - 2012, 16:22
طقطقة الاصابع


http://s.alriyadh.com/2007/11/28/img/291074.jpg (http://www.dlu3at.net/vb/article46286.html)



اوضح الباحثون أن من اعتادوا على طقطقة الأصابع يتعرضون
لأضرار بالغة في أربطة ومفاصل الأصابع وان الصوت المرتفع
اثناء طقطقة الأصابع يكون ناتجاً عن انخفاض حاد في الضغط خلال كبسولة المفصل تتسبب في تكوين
فقاعة من السائل حول المفصل,,


على المدى الطويل تتسبب طقطقة الاصابع في خلل مزمن في
المفصل فتجعل الشخص غير قادر على تحريك الاصابع
في حالة الاكثار من الفرقعه او كما تسمى إدمان طقطقة الأصابع

nosa_aic
09 - 02 - 2012, 16:34
http://www.kufur-kassem.com/cms/images/stories/7orkat_ma3de.jpg (http://www.dlu3at.net/vb/article48167.html)


ما هي حرقة المعدة ( فرط الحموضة)؟

هو شعور بالحرقة في الصدر أو الاحساس بطعم مُرّ في الفم، يحدث بسبب ضعف في العضلة العاصرة السفلية في المريء والتي تقع بينه وبين المعدة، وهي تشبه في عملها صماماً يتحرك باتجاه واحد، لذا سميت "بواب المعدة"، وفي حال خللها الوظيفي فإن الحمض يرتجع من المعدة إلى المريء فيُخرش بطانته.

متى يحدث فرط الحموضة وكم يدوم؟

يعاني أغلبية الناس من فرط الحموضة بشكل عرضي فقط، حيث تدوم لمدة قد تصل إلى ساعتين. على كل حال إن كنت تعاني من فرط الحموضة لأكثر من مرتين في الأسبوع فهذا يعني بأنك قد تكون مُصاباً بما يُسمى " الارتداد المعدي المريئي" ويُسمى أيضاً "الارتداد الحمضي".

ما هي مُسببات فرط الحموضة؟

* تناول كمية كبيرة من الطعام، أو الأكل مباشرة قبل النوم.
* تناول الأطعمة الدسمة، أو المبهرة، أو الشوكولا، أو النعناع، أو الحمضيات، أو البندورة ومنتجاتها. كما أن تناول المشروبات الغازية، أو المحتوية على الكافيئين، أو الشاي، أو عصير الحمضيات و عصير البندورة وكذلك المشروبات الكحولية.
* التدخين.
* تناول بعض الأدوية التي تُضعف القدرة الوظيفية للعضلة العاصرة في أسفل المريء، مثل مضادات الاكتئاب، بعض خافضات الضغط، وأدوية الذبحة. كما تُسبب بعض الأدوية تخريشاً مباشراً كالأسبيرين ، والتتراسايكلين، والأدوية التي تعالج ترقق العظام وغيرها.
* الإصابة ببعض الحالات الصحية ، كالفتق الحجابي حيث ينزلق جزء صغير من المعدة إلى ما فوق الحجاب الحاجز في منطقة الصدر مما يؤدي إلى إعاقة عمل العضلة العاصرة.
* الحمل وذلك بسبب النشاط الهرموني وضغط الجنين.
* السُمنة.

ما هي الأدوية المتوفرة؟

تباع أكثر أدوية فرط الحموضة بدون وصفة طبية، ومن الضروري الانتباه إلى تفاعلها مع الأدوية الأخرى وإلى آثارها الجانبية، كما تجب مراجعة الطبيب إذا لم تختف الأعراض بعد أخذ الدواء.

ومن الأدوية المعروفة :

· مضادات الحموضة:
تُعالج فرط الحموضة الخفيف والمتوسط، تعمل موضعياً حيث تُعادل حموضة المعدة. من بين الأسماء التجارية المعروفة نذكر تامز Tums ، مالوكس Maalox ، مايلانتا Mylanta ، روليدز Rolaids ، رايوبان Riopan و الكثير غيره من المتوفر في الصيدليات.ينصح بأخذ مضادات الحموضة خلال 1-3 ساعات بعد تناول الوجبات و قبل النوم.
تُسبب مضادات الحموضة التي تحتوي على الماغنيزيوم الإسهال، أما التي تحتوي على الألمينيوم فتُسبب الإمساك. كما يمكن أن تقلل مضادات الحموضة من فعالية بعض الأدوية إذا تم تناولها معاً لذا يجب أن يُفرق بين تناول مُضاد الحموضة والأدوية بفارق زمني مقداره ساعتين على الأقل.

· الألجينات :
تحتوي بعض مضادات الحموضة مثل الغافيسكون Gaviscon على ألجينات الصوديوم الذي يُشكل رغوة كثيفة تُغطي محتوى المعدة مما يؤدي إلى حماية المريء من التخرش.

· مثبطات إفراز الحمض ( مثبطات مستقبلات إتش2 الهيستامينية):
تُثبط إفراز وإطلاق الحمض وذلك بتثبيط إطلاق المادة الكيميائية المسماة الهيستامين. يُفضل تناول هذا النوع من الأدوية قبل الطعام ويستمر مفعولها لمدة 12ساعة. من هذه الأدوية السايميتيدين Cimetidine ،الرانيتيدين Ranatidine ، الفاموتيدينFamotidin، النيزاتيدينNizatidine.
تتضمن هذه الأدوية بعض الآثار الجانبية مثل: ألم في الرأس، غثيان، إسهال. أما تفاعلاتها مع الأدوية الأخرى فهي قليلة جداً، إلا أن السايميتيدين Cimetidine قد يتفاعل مع الوارفارين Warfarin ( مميع للدم) ومع الفينيتوين Phenytoin (مضاد لنوبات الصرع)، والثايوفيللينTheophylline (دواء للربو).

· مثبطات ضخ البروتون (شاردة الهيدروجين):
تُعطل هذه الأدوية عمل المضخة التي تضخ شاردة الهيدروجين في المعدة مما يجعل الوسط حامضياً. من بين هذه الأدوية الأوميبرازولOmeprazole ، لانزوبرازول Lansoprazole، إيزوميبرازول Esomeprazole ، رابيبيرازول Rabeperazole ، بانتوبرازول Pantoprazole.
تتضمن هذه الأدوية بعض الآثار الجانبية مثل : ألم في الرأس، غثيان، طفح جلدي، دوخة، سعال، إسهال.
يتفاعل الأوميبرازول مع بعض الأدوية مثل الوارفارين Warfarin ( مميع للدم) ،ومع الفينيتوين Phenytoin (مضاد لنوبات الصرع)، وكذلك مع الديجوكسين Digoxin (دواء للقلب)، ومع الديازيبام Diazepam (مهدىء)، ومع الكيتوكونازول Ketoconazole (مضاد للفطريات).

· الأدوية التي تزيد من حركة المعدة:
تعمل هذه الأدوية على زيادة حركة المعدة، حيث تقوم بزيادة ضغط العضلات العاصرة الموجودة في نهاية المريء عن نقطة التقائه بالمعدة مما يسمح بإفراغ محتوى المعدة. من هذه الأدوية الميتوكلوبرامايد Metoclopramide، الدومبيريدون Domperidone ، البيثانيكول Bethanechol.
للميتوكلوبرامايد بعض الآثار الجانبية كالغثيان، والإسهال، والتشوش، والنرفزة، والرجفة.

ما هي سبل الوقاية من فرط الحموضة أو تقليل حدوثها؟

· لعله من المفيد لك أن تقوم بتسجيل يومي للأعراض والأغذية المتناولة وبالتالي يمكنك التعرف على أنواع الأغذية التي تسبب لك فرط الحموضة.

· تجنب الطعام قريباً من موعد النوم. حاول أن تترك فاصلاً زمنياً بين وجبة الطعام وموعد النوم يتراوح بين ساعتين إلى ثلاث ساعات.

· تجنب الاضطجاع بعد الأكل.

· تناول وجبات صغيرة ومنتظمة.

· إذا كان وزنك زائداً، حاول إنقاصه.

· لا ترتدي ملابس ضيقة يمكن أن تضغط على معدتك.

· رفع رأس السرير إلى أعلى بقدر 6 إنشات قد يُساعد في تقليل فرط الحموضة الليلية.

nosa_aic
10 - 02 - 2012, 09:12
الاخطاء العشرة في طهي الطعام

الخطأ الأول في طهي الطعام



من الخطأ استخدام كمية كبيرة من الماء في عملية سلق الخضراوات لأنها تفقد فيتاميناتها في الماء .. ولذا يجب استعمال أقل كمية ممكنة من الماء .

الخطأ الثاني في طهي الطعام


من الخطأ تقطيع الخضراوات قطعًا صغيرة قبل طهيها بمدة .. لأنها تفقد بهذا جزءاً من الفيتامينات وعصارتها أثناء الطهي.. ولذا يجب أن تقطع قطعًا كبيرة وقبل الطهي مباشرة .


الخطأ الثالث في طهي الطعام



من الخطأ نقع الخضراوات والفاكهة في الماء لمدة طويلة ، لأن هذا يساعد في تحلل بعض الفيتامينات وفقدها في الماء .


الخطأ الرابع في طهي الطعام

من الخطأ غلي الخضراوات في الماء لمدة طويلة .. فالغلي لمدة طويلة يفقد الخضراوات كثيرًا من قيمتها الغذائية ، وللتغلب على هذا تضاف الخضراوات للماء المغلي .. أو تستخدم حلة البخار فتحقق السرعة وتحافظ على القيمة الغذائية.



الخطأ الخامس في طهي الطعام

من الخطأ طبخ الخضار واللحوم معًا وتركهما على النار لمدة طويلة .. ويفضل أن يُطهى الخضار أولاً ثم يضاف له اللحم المسلوق بعد ذلك .



الخطأ السادس في طهي الطعام


من الخطأ وضع اللحوم المجمدة أو الخضار المجمد مباشرة إلى الماء المغلي .. بل تترك لإذابة ثلجها ببطء في رف الثلاجة ثم توضع بعد ذلك في الماء المغلي .. فهذا يحافظ على قيمتها الغذائية.



الخطأ السابع في طهي الطعام


من الخطأ تتبيل اللحوم بالملح والبهارات قبل شيها .. لأن هذا يُفقِدُ اللحوم كمية كبيرة من الحديد .. ومن الأفضل أن يشوى اللحم ثم يضاف له الملح بعد ذلك.



الخطأ الثامن في طهي الطعام


من الخطأ استخدام زيت القلي في زيت التحمير لمرات عديدة ، فإن الزيت المغلي لأكثر من مرة قد يسبب أضرارًا صحية كثيرة .. ولذا يفضل استخدام زيت القلي النباتي الذي يتحمل درجات حرارة عالية مثل زيت الذرة ودوار الشمس والنخيل على ألا تزيد مرات الغلى على 10 مرات في عملية الطهى الواحدة .



الخطأ التاسع في طهي الطعام

من الخطأ طهي البطاطس والبطاطا والجزر وباقى النباتات ذات الجذور بعد تقشيرها .. والأفضل أن يتم طهيها بقشرها ثم نزع القشرة بعد الطهى حتى تحافظ على كامل قيمتها الغذائية .

الخطأ العاشر في طهي الطعام


من الخطأ غلي الشاي أكثر من مرة أو لمدة طويلة ، فهذا يفقده بعض فوائده ويزيد من أضراره .. بل يجب غلي الماء أولاً ثم يُضاف إليه كمية معتدلة من الشاي مع تناوله معتدل الحرارة .

nosa_aic
11 - 02 - 2012, 04:54
تناول المشروبات الغازية والمياه المعدنية يزيد من الإصابة بالربو


أكدت دراسة علمية حديثة أجراها باحثون أمريكيون بجامعة (اديليد) الأمريكية أن خطر الإسراف فى تناول المشروبات الغازية والمياه المعدنية يتعدى التأثير السلبى على الجهاز الهضمى حيث يؤثر كذلك على الجهاز التنفسى مزيدا من معدلات الإصابة بالربو الشعبى.
وكشفت الدراسة, التى أجريت على 17 ألف شخص تزيد أعمارهم على 16 عاما أن 10% منهم يشربون أكثر من نصف لتر من المشروبات الغازية والمياه المعدنية هم الأكثر عرضة للاصابة بالربو وأن حوالى 15% منهم يستهلكون أكثر من نصف لتر من المشروبات الغازية بشكل يومى.
وأوضح الباحثون - فى تصريحات لهم على شبكة الانترنت - أن الأشخاص الذين يشربون هذه الكمية من المشروبات الغازية تزيد لديهم فرص الإصابة بالربو والانسداد الرئوى المزمن مقارنة بمن لا يشربون هذه المشروبات على الإطلاق.
وأضافوا "أن التدخين يضاعف الأثر السلبى للمشروبات الغازية على الجهاز التنفسى بمعدل 6 أضعاف".

nosa_aic
11 - 02 - 2012, 05:00
أهمية تناول الألياف عند الأطفال
تعد الألياف تركيبة كربوهيدرات صعبة الهضم وتتواجد بأطعمة مثل الفواكه والخضراوات التي تحتوي على نسب ضئيلة من السعرات الحرارية وتساعد في المحافظة على نظام حركة وعمل الأمعاء وتمنع مشاكل الهضم و الإمساك.


أساسيات كميات الألياف لدى الأطفال

تنصح جمعية القلب الأمريكية للأطفال فوق 5 سنوات بضرورة استهلاك ما يعادل 9 جرامات من الألياف وذلك يعتمد على سن ووزن الطفل (السن زائد 5). ويجب على الطفل استهلاك 25 جرام يومياً عندما يبدء بتناول 1500 سعرة حرارية من خلال 5 إلى 8 وجبات تتكون من الفواكه والخضروات يوميا. على الفتيات 9 إلى 18 عاماً أن يتناولن 25 جرام من الألياف وعلى الصبيان تناول من 31 إلى 38 جرام.

يجب إعطاء جسم الطفل الوقت اللازم ليتوافق مع نظام الألياف وإلا فانه قد يواجه مشاكل مثل الانتفاخ والغازات وعليه بشرب الكثير من الماء لتجنب هده الأعراض. لحسن الحظ أن الجسم لا يمتص الألياف وبذلك لن يواجه الطفل نقص في الغذاء إذا لم يتناول الكميات المطلوبة ولكنه لن يحصل على الفوائد الموجودة في الخضرة والفواكه.

نصائح لإضافة الألياف في أطعمة طفلك

شجعيه على تناول الخضرة والفواكه مع القشر على شرب العصائر.

أكثري من صنع المأكولات الغنية بالخضروات والبقوليات والأرز والباستا والحنطة والحبوب.

شجعي طفلك على الإكثار من شرب الماء ليتجنب مشاكل الإنتفاخ والغازات.

لا تزيدي استهلاك طفلك للألياف فوق الكميات المعتمدة حيث أن ذلك قد يؤثر سلبيا على عملية امتصاص جسمه للحديد و الكالسيوم و الزنك، المعادن الأساسية لنمو العظام.

حاولي أن توفري الخضار الطازجة مثل الجزر والخيار والقرنبيط كوجبات خفيفة وسهلة.

أمنعي طفلك من أكل الوجبات السريعة المعروفة باحتواء كميات عالية جدا من السعرات الحرارية والشحوم.

حاولي أن تقللي من تناول طفلك لمنتجات الألبان حيث أن هذه الأطعمة تزيد من الإصابة بالإمساك وخصوصا عند الأطفال.

إذا كنت تواجهين مشاكل عند إطعام طفلك فحاولي إضافة مقويات الألياف المتوفرة بالأسواق مثل بنيفايبر Benefiber التي يمكن أن تضمن لك حصول طفلك على المقدار اليومي الموصى به وخاصة إذا وجدت صعوبة في الحصول على المقادير الملائمة من الألياف فقط من تناول الأطعمة الغنية بالألياف.

فوائد الألياف

تمتص الماء وتعمل على ليونة الإخراج في حالات الإمساك كما تعمل على التخلص من الإسهال بضبط حركة الأمعاء في الحالتين.

تحافظ الألياف على صحة النظام الهضمي وتمنع المشاكل التي يتعرض لها مثل الآلام وانتفاخ البطن والتوتر والإمساك والإسهال.

تمتص السموم الموجودة بالقولون وتعمل على التخلص منها.

تعمل على تحفيز نمو البكتيريا الطبيعية والمفيدة بالأمعاء، وتزيد كمية وحجم الإخراج وتساعد على منع الأمراض التي تسببها البكتريا.

تساعد في الحفاظ على نسبة السكر في الدم

العناية بصحة أطفالك في سن مبكر يساعد للوقاية من الأمراض في الكبر مثل مرض السكري و أمراض القلب. لقد أعلنت وزارة الصحة في دولة الامارات العربية المتحدة أن 26 بالمائة من الأطفال يعانون من البدانة ودلك سببه قلة ممارسة التمارين الرياضية والاعتماد على الوجبات السريعة. إن هذه الإحصائيات في الدولة تعد كعلامة مهمة لاتخاذ الإجراءات الضرورية وبناءا على إحصائية أجرتها منظمة الصحة العالمية في عام 2000: إن ربع سكان دولة الامارات يعانون من مرض السكري.

أما على الصعيد العالمي، فإن الإجراءات التي تتخذ لمنع زيادة نسبة البدانة لدى الأطفال تتمحور حول إبعادهم عن الإعلانات ونشاطات تسويق الوجبات السريعة والغير صحية سواء كان عن طريق الإنترنت أو في المدارس أو على التلفاز. على المدارس أن تضيف لنظامها التعليمي معلومات عن الأغذية الصحية والخضار والفواكه وعليها أيضا بزيادة النشاطات الرياضية.

nosa_aic
11 - 02 - 2012, 05:05
ألم البطن مشكلة طفلك نفسية أم جسدية؟


http://www.anazahra.com/deployedfiles/Assets/Richmedia/Image/pain_primary_12-05-2011.jpg (http://www.dlu3at.net/vb/article43157.html)

أكثر ما قد يقلق الأم كلمة: "ماما بطني تؤلمني". شعور أطفالنا بآلام البطن، عارض شائع. لكن إن تكررت هذه الآلام، يجدر بالأهل التصرف بسرعة لتدارك الأمر.


في الغالب، لا يستطيع الأطفال الصغار تحديد موضع الألم على وجه الدقة. وفي 90 في المئة من الحالات، يكون شعور الطفل بالألم مجرد وهم أو دلع.


ويفرق الأطباء بين نوعين من آلام البطن: متاعب حادة ومتاعب مزمنة. وغالباً ما تكون الآلام الحادة، الناجمة عن التهاب الزائدة الدودية مثلاً، شديدة جداً، لدرجة تحتم على الأهل اصطحاب طفلهم إلى الطبيب. ويُعرِّف الطبيب بوركهارد روديك، عضو الجمعية الألمانية لطب الأطفال والمراهقين الآلام المزمنة، بأنها آلام تنتاب الطفل مرة واحدة في الأسبوع على الأقل على مدار شهرين.


ويتطلب تشخيص سبب الألم بحثاً جدياً من قبل الطبيب. ويقول البروفيسور الألماني مايكل ميلتر: "نشعر بالقلق حين يشير الطفل مثلاً إلى نفس الموضع الذي يكمن فيه الألم، وعلى نحو دقيق في كل مرة، أو في حال عدم زيادة وزن الطفل خلال الأسابيع والأشهر المنصرمة. ويضيف ميلتر: "بعد ذلك يكون من المهم معرفة موعد حدوث الألم. فإذا استيقظ الطفل ليلاً بسبب الألم، فيعد ذلك مؤشراً على وجود مشكلة عضوية، ويسري ذلك أيضاً إذا توقف الطفل عن اللهو واللعب بسبب الألم".


ويلفت ميلتر إلى أنه إذا كانت المتاعب مصحوبة بحمى أو إسهال أو قيء، فإن ذلك يُعد مؤشراً على وجود التهاب. وإذا لاحظ الأهل وجود دم في براز أو بول الطفل، فيجب معرفة من أين يأتي هذا الدم. ويقول ميلتر: "غالباً ما نسأل عن التاريخ المرضى للأسرة أيضاً، لنعرف مثلاً ما إذا كانت هناك متاعب وظيفية من قبيل تهيج القولون أو المعدة أو عدم تحمل مواد غذائية معينة أو أمراض أمعاء مزمنة أو ما شابه".


ويمكن لآلام البطن الحادة أن تنتج كما قلنا عن التهاب الزائدة الدودية أو عدوى في المعدة والأمعاء أو ما يُعرف باسم "انغلاف الأمعاء"، لاسيما لدى الأطفال الصغار. كما أن العدوى التي تصيب الكُلى ومجاري البول وكذلك الالتهاب الرئوي قد تؤدي إلى ظهور آلام في البطن. وفي حالة الالتهابات المزمنة، يمكن لحصوات الدم أن تظهر ما إذا كان الطفل يعاني مثلاً من عدم تحمل اللاكتوز أو سكر الفاكهة أو الغلوتن.


في كثير من الأحيان، يأتي الأطفال المصابون بآلام حادة في البطن إلى عيادة الطبيب وهم يعانون من إمساك. ويعطي تحسس البطن للطبيب مؤشرات على وجود التهاب.


وإذا كان الطفل يشتكي من حموضة أو حرقة في الجزء العلوي من البطن، فيمكن استيضاح سبب ذلك من خلال منظار للمعدة.

وإذا تم استقصاء جميع الأسباب العضوية وظل الطفل يشكو من المتاعب، فينبغي على الأهل أخذ الأمر على محمل الجدّ، فقد ترجع هذه الآلام إلى أسباب نفسية مثل الخوف من المدرسة أو الامتحانات. وفي هذه الحالات، ينصح الخبراء الأهل بالاستعانة بأخصائي علم نفس والتحري عن أسباب هذه المخاوف.

nosa_aic
11 - 02 - 2012, 05:11
مغص الرضع




من اكثر مايواجه الاطفال الرضع مغص الرضع


يظهرالمغص عند الرضيع على شكل فترات من الهيوجة والبكاء




غالبا في فترات المساء


الطفل صحيح البنية وجيد التغذية


يبدء في الاسابيع الاولى من العمر ويستمر الى نهاية الشهر الثالث





العوامل المسببة للمغص عند الرضيع :



هناك نظريات تعزي سبب المغص الى عوامل تتعلق بالطفل أو الاهل ونسبة



قليلة بعدم التحمل الغذائي ( نوع الحليب)



الارضاع السريع يؤدي الى بلع الهواء والذي يؤدي الى المغص



غالبا يبقى السبب غير معروف



المعالجة:



الاكثر فعالية حمل الطفل وتهدئته



قد يحتاج الامر حمل الطفل لفترات طويلة



تهدئة الاهل حيث يعانوا من التوتر والقلق



استعمال الحركة الخفيفة والهز ( الهز الاوتوماتيكي)



استعمال الموسيقى الهادئة



احيانا الخروج بالطفل الى الشارع او بالسيرة يؤدي الى تهدئته


احيانا يوصف الطبيب بعض المسكنات لفترة قصيرة لكسر حلقة البكاء

nosa_aic
11 - 02 - 2012, 05:16
فوائد العسل للاطفال

يعتبر الاطفال اقل مقاومه للامراض واضعف في جهاز المناعه ،وللعسل دوره الفعال في تقويه جهاز المناعه ووقاية الاطفال من الامراض

وفوائده:


يقضي على التهاب اللوزتين.
يعالج الاسهال المزمن بوضع ملعقه من العسل مع كوب من الحليب الساخن وشربها صباحا ومساءا.
يعالج التبول اللاارادي عند الاطفال فوق سن ثلاث سنوات باعطائهم ملعقة من العسل قبل النوم.
زيد الوزن وكريات الدم الحمراء والهيموجلوبين في الدم باضافة ملعقه من العسل او ملعقتين مع كل وجبه.
يساعد على تحسين نمو العظام والاسنان.
يقوي العقل والذاكره ويكسب الجسم طاقه كبيره.
يعالج شلل الاطفال باخذ ملعقتين من العسل مع كل وجبه.
يعني...العسل يعطي للطفل (قوه-حيويه-نشاط).

ابو مالك
11 - 02 - 2012, 10:49
http://t3.gstatic.com/images?q=tbn:ANd9GcTv0w080ElbIHchRGWqI5NNfWlzyit_6 6S3cbcmFwDsZKg4dDQ0Nw

nosa_aic
13 - 02 - 2012, 07:34
الوصاية العشر لمواجهة نزلات البرد..!! (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/161892-%D8%A7%D9%84%D9%88%D8%B5%D8%A7%D9%8A%D8%A9-%D8%A7%D9%84%D8%B9%D8%B4%D8%B1-%D9%84%D9%85%D9%88%D8%A7%D8%AC%D9%87%D8%A9-%D9%86%D8%B2%D9%84%D8%A7%D8%AA-%D8%A7%D9%84%D8%A8%D8%B1%D8%AF)



http://www.alwafd.org/images/news/1405207006t012zhpj.jpg



يقول الدكتور محمد وفاء عبد المجيد والي استشاري وزميل جراحة الأذن والأنف والحنجرة إن أفضل العلاجات المنزلية التي يقدمها الخبراء يمكن تلخيصها في وصايا عشر هى
أولاً: تناول فيتامين «ج» الذي يعمل كالمكنسة داخل الجسم فينزع كل أنواع الفضلات بما في ذلك مخلفات الفيروس فيمكنه ان يقلل مدة الإصابة بالبرد من سبعة أيام الى يومين أو ثلاثة، كما يعمل فيتامين «ج» على التخفيف من السعال والعطس والاعراض الاخرى، وفي دراسة أجرتها جامعة «ويسكونسين» أكدت أن تناول المصابين بالبرد «500» ميليجرام من فيتامين «ج» أربع مرات يومياً تنخفض الأعراض الى النصف عن أولئك الذين لم يتناولوا الفيتامين، وينبغي الحصول على موافقة الطبيب كي تتناول أي مكمل غذائي قبل تناوله، والأفضل ان تحصل على فيتامين «ج» من العصائر، فعصائر البرتقال والجريب فروت والتوت البري جميعها مصادر غنية بفيتامين «ج».
ثانيا: اقض على البرد «بالزنك» اكتشف الباحثون في بريطانيا وأمريكا أن استحلاب قطع «الزنك» يمكن أن يقلل نوبة البرد الى أربعة أيام كما يمكن للزنك أن يقلل من أعراض جفاف وتهييج الحلق، وهو يباع بالأسواق على شكل قطع تحتوي على طعم العسل والليمون ويسهل ابتلاعها، ولكن لا يجب تناول أكثر من الكمية التي يوصي بها الطبيب.
ثالثا: شعورك بالإيجابية حيال قدرة بدنك على الشفاء يمكن أن تحرك قوى جهازك المناعي.
رابعاً: عليك بالراحة والاسترخاء فذلك يمكنك من تركيز كل طاقتك للشفاء.
خامساً: اطفئ أضواء الحفلات حينما تكون مريضاً فإن الحفلات والمناسبات السعيدة يمكن أن تنهك بدنك وتطيل من فترة إصابتك بالبرد.
سادسا: احرص على تدفئة جسمك بارتداء الملابس التي تقي من البرودة فالملابس الثقيلة تجعل جهازك المناعي يركز على مكافحة عدوى البرد.
سابعاً: مارس رياضة المشي فالتمارين الخفيفة تحسن الدورة الدموية وتساعد جهاز المناعة على انتاج الاجسام المضادة التي تحارب العدوى ونقترح ممارسة المشي لمدة نصف ساعة.
ثامناً: تناول وجبات خفيفة، فتناول الغذاء الدسم يجهد الجسد في عمليات الايض الغذائى مع الإكثار من الفاكهة والخضراوات الطازجة وحساء الدجاج الساخن.
تاسعاً: اكثر من تناول السوائل ما بين ستة الى ثمانية أكواب ماء أو العصير أو الشاي والسوائل الشفافة يومياً.
عاشراً: امتنع عن التدخين الذي يزيد من تهيج الحلق الناتج عن البرد - كما ينصح الدكتور محمد وفاء بتلطيف الحلق بكوب من الماء الدافئ المملح بملعقة واحدة من الملح بالغرغرة صباحاً وظهراً ومساء ويمكن استنشاق البخار الساخن وذلك بوضع إناء به ماء مغلي مع استخدام منشفة وغط رأسك والاناء بالمنشفة واستنشق البخار كما نصح الدكتور وفاء بتناول الدواء اثناء الليل خاصة الادوية المسببة للغثيان والنعاس حتى لا تشعر بالآثار الجانبية أثناء النوم.

nosa_aic
13 - 02 - 2012, 07:44
العسل شفاء لكل داء ...

وصفات طبيه من العسل

1_ العسل وماء الشعير لعلاج الإسهال

المكونات: -

عسل نحل: ملعقة كبيرة. - ماء شعير: مقدار مناسب.

التحضير والاستعمال:

يحلى ماء الشعير بالعسل، ويشرب على جرعات متكررة.



2_ مستحضر العسل والأعشاب المهدئ والمقاوم للأرق

المكونات:

زهر بابونج( 2 ملعقة صغيرة) - أوراق نعناع (طازجة أو مجففة) 2 ملعقة صغيرة - عسل نحل: ملعقة كبيرة.

التحضير والاستعمال:

يجهز (منقوع) من كل من البابونخ والنعناع ثم يمزج الاثنان معاً ويحلى المزيج بعسل النحل, يؤخذ هذا الشراب مساءً.

مرهم طبيعى لعلاج الجروح والتقيحات:

المكونات:

دقيق درة أو قمح - عسل نحل.

التحضير والاستعمال:

تجهز كمية مناسبة متساوية من الدقيق والعسل وبخلط الاثنان ببعضهما، ويستخدم هذا الخليط كدهان موضعى.

3_مستحضر للسعال المتكرر:

المكونات: -

عسل نحل: ملعقة كبيرة. – عصير ليمون: ملعقة كبيرة.

التحضير والاستعمال:

يخلط العسل مع عصير الليمون، ويؤخذ من هذا الخليط على حسب الرغبة (يمكن زيادة كمية هذا المستحضر بشرط تساوى كمية العسل وعصير الليمون).


4_مستحضر للسعال الشديد:

المكونات: -

عسل نحل: ¼ فنجان. - عصير ليمون: ملعقة كبيرة. - جلسرين نقى: ملعقة كبيرة.

التحضير والاستعمال:

تخلط المركبات ببعضها، ويحفظ الخليط فى زجاجة محكمة، ويؤخذ ملعقة كبيرة من الخليط كل ساعتين أو حسب الضرورة.


5_مستحضر لعلاج التهاب وألم الحلق:

المكونات: -

عسل نحل: 2 ملعقة كبيرة. - جلسرين نقى: 2 ملعقة كبيرة. – عصير ليمون: 2 ملعقة كبيرة. - زنجبيل بودرة: ½ ملعقة كبيرة.

التحضير والاستعمال:

توضع المكونات فى برطمان أو وعاء وتسخن فى وعاء آخر مملوء بالماء الساخن حتى يذوب العسل والجلسرين، ثم يرفع الوعاء بعيداً عن السخونة ويقلب الخليط جيداً, يؤخذ ملعقة كبيرة من هذا الخليط مساءً قبل النوم، ويستخدم دافئاً أو معادلاً لدرجة حرارة الغرفة.



6_عسل النحل علاج لحرقان القلب عند الحوامل:

يعتبر عسل النحل علاجاً آمناً وبسيطاً لمقاومة الشكوى من حرقان القلب بمعنى الشكوى من انبعاث حرقان من فم المعدة و خلف الصدر عند الحوامل، وذلك لأن العسل يقاوم الحموضة الزائدة وينشط عملية الهضم. ويؤخذ منه لعلاج هذه الحالة مقدار ثلاث ملاعق يومياً بعد تناول الطعام.



7_لتخفيف السعال وخاصة الناتج عن التدخين:

ينقع فى لتر ماء مغلى مقدار 4 ملاعق من بذر الكتان لمدة 3 ساعات مع تغطية الإناء، ثم يصفى الماء، ويضاف إليه عصير ليمونتين وملعقة من عسل النحل, يؤخذ ملعقة من هذا المستحضر عند نوبات السعال.



8_لبخة العسل لعلاج الخراريج:

لتخفيف الألم والتورم (الالتهاب) بمكان الدمل أو الخراج, يجهز خليط مكون من ملعقة كبيرة من عسل النحل وملعقة مماثلة من زيت كبد الحوت، ويوضع كمية من هذا الخليط على قطعة شاش معقم ويوضع الشاش فوق مكان الإصابة ويثبت بضمادة، وتستبدل اللبخة بأخرى كل 8 ساعات.



9_عسل النحل لعلاج للأرق:

يجهز برطمان زجاجى به ملء فنجان من عسل النحل، ويخلط بمقدار ثلاث ملاعق صغيرة من خل التفاح, يحفظ هذا البرطمان فى غرفة النوم، ويؤخذ منه ملء ملعقة قبل النوم للتغلب على الأرق, ويمكن تكرار نفس الجرعة بعد مرور ساعة فى حالة استمرار الأرق.



10_لمقاومة أعراض الشيخوخة:

لمظاهر الشيخوخة (فى جميع الأعمار) بنسبة 1:1 أو2:1, ويستعمل 55-75 جراماً من تلك العجينة، حيث تحتوى على مادتى "مثيونين" و "كولين", ولهما فائدة عظيمة للجسم, حيث تزيدان استخراج الكوليسترول منه

ابو مالك
14 - 02 - 2012, 08:46
ما هو مرض الكبد الدهنى؟

http://img.youm7.com/images/NewsPics/large/s6201123161847.jpg


يسأل قارئ 60 عاماً ما هو الكبد الدهنى؟

يجيب عن التساؤل الدكتور هشام حسن، أستاذ أمراض الجهاز الهضمى والكبد بجامعة أريزونا، قائلا، إن مرض الكبد الدهنى هو من أكثر أمراض الكبد انتشارا بين الأطفال والكبار، وقد زادت نسبة الإصابة به خلال السنوات الأخيرة، وذلك نتيجة السمنة المفرطة التى انتشرت بشكل كبير.

ويضيف هشام أن هناك شبه إجماع أن الكبد الدهنى ينتج عن زيادة مقاومة الأنسولين فى الجسم، ومع زيادة الوزن تزداد نسبة الدهون فى الجسم، وبالتالى الكبد، فالسمنة تؤدى إلى زيادة الدهون على الكبد، إلى أن نصل إلى السمنة المفرطة فى بعض الحالات، مما يؤدى إلى تحول الكبد حينها إلى قطعة من الدهون.

وتوضح أن نسبة الحالات المصابة بمرض الكبد الدهنى أنه ينتشر عن طريق العوامل الوراثية، وتزيد من احتمالات تطوره إلى التليف الكبدى.

ويضيف هشام أن الكبد الدهنى قد ينشأ نتيجة استعمال المريض العديد من الأدوية كالبريدينزون والإستروجين، وكذلك التاموكسين وهو عقار يستعمل لعلاج سرطان الثدى، بالإضافة إلى الميتوتريكيست، وهو عبارة عن علاج كيماوى يستخدم فى علاج أنواع عديدة من الأورام، وفى العادة تتسبب هذه الأدوية فى الإصابة بالكبد الدهنى عند استعمالها لفترة طويلة تزيد عن ستة أشهر.

وينصح هشام بضرورة متابعة المريض الراغب فى التخلص من السمنة لدى طبيب متخصص، ويحذر أيضا من إنقاص الوزن بشكل سريع وفى فترة قصيرة، لأن إنقاص الوزن بمعدل سريع يتسبب فى زيادة الدهون المترسبة على الكبد، ولذلك ينبغى اتباع أسلوب منظم ومعتدل، واستشارة طبيب متخصص قبل اتباع نظام غذائى بهدف إنقاص الوزن.

nosa_aic
14 - 02 - 2012, 18:14
http://photos.azyya.com/store/up1/080401180112uyYc.gif (http://www.dlu3at.net/vb/article15242.html)
الادوية و الأغذية المفردة التى جاءت على لسانه
صلى الله عليه و سلم

إثْمِدٌ‏:‏
هو حجر الكحل الأسود، يُؤْتَى به من أصبِهانَ، وهو أفضلُه، ويؤتَى به من جهة المغرب أيضاً، وأجودُه السريعُ التفتيتِ الذي لفُتاته بصيصٌ، وداخلُه أملسُ ليس فيه شىء من الأوساخ‏.‏
ومزاجُه بارد يابس ينفعُ العين ويُقوِّيها، ويشد أعصابَها، ويحفظُ صِحتها، ويُذهب اللَّحم الزائد في القُروح ويُدملها، ويُنقِّى أوساخها، ويجلوها، ويُذهب الصداع إذا اكتُحل به مع العسل المائى الرقيق، وإذا دُقَّ وخُلِطَ ببعض الشحوم الطرية، ولُطخ على حرق النار، لم تعرض فيه خُشْكَرِيشةٌ، ونفع من التنفُّط الحادث بسببه، وهو أجود أكحال العين لا سِيَّما للمشايخ، والذين قد ضعفت أبصارُهم إذا جُعِلَ معه شىءٌ من المسك‏.‏


أُتْرُج‏:‏

ثبت في ‏(‏الصحيح‏)‏‏:‏ عن النبىِّ صلى الله عليه وسلم أنه قال‏:‏ ‏(‏مَثَلُ المؤمن الذي يقرأ القرآن، كمَثَلِ الأُتْرُجَّةِ، طعْمُها طَيِّبٌ، وريحُها طَيِّبٌ‏)‏‏.‏
وفى الأُترج منافع كثيرة، وهو مركَّب من أربعة أشياء‏:‏ قشر، ولحم، وحمض، وبزر، ولكل واحد منها مِزاج يخصُّه، فقشره حار يابس، ولحمُه حار رطب، وحمضُه بارد يابس، وبزرُه حار يابس‏.‏

ومن منافع قشره‏:‏ أنه إذا جُعل في الثياب منع السوسَ، ورائحتُهُ تُصْلِحُ فسادَ الهواء والوباء، ويُطيِّبُ النَّكْهَةَ إذا أمسكه في الفم، ويُحلِّل الرياح، وإذا جُعِلَ في الطعام كالأبازِير، أعان على الهضم‏.‏ قال صاحب ‏(‏القانون‏)‏‏:‏ وعُصَارة قشره تنفع مِن نهْش الأفاعى شرباً، وقِشرُه ضِمَادَاً، وحُرَاقةُ قِشره طِلاءٌ جيد للبَرَص‏.‏‏.‏ انتهى‏.‏

وأمَّا لحمه‏:‏ فملطِّف لحرارة المَعِدَة، نافعٌ لأصحاب المِرَّة الصفراء، قامِعٌ للبخارات الحارة‏.‏ وقال الغافِقىُّ‏:‏ أكل لحمه ينفع البواسير‏.‏‏.‏ انتهى‏.‏

وأمّا حمضُه‏:‏ فقابضٌ كاسر للصفراء، ومسكنٌ للخفقان الحار، نافعٌ من اليَرَقَان شرباً واكتحالاً، قاطعٌ للقىء الصفراوى، مُشَهٍّ للطعام، عاقل للطبيعة، نافع من الإسهال الصفراوى، وعُصَارَةُ حمضه يُسَكِّن غِلْمَةَ النساء، وينفع طِلاَءً من الكَلَفِ، ويُذهب بالقَوْباء، ويُستدَل على ذلك مِن فعله في الحِبر إذا وقَعَ في الثياب قَلَعَه، وله قوةٌ تُلطِّف، وتقطع، وتبرد، وتُطفئُ حرارة الكبد، وتُقوِّى المَعِدَة، وتمنع حِدَّة المِرَّة الصفراء، وتُزِيلُ الغمَّ العارض منها، وتسكن العطش‏.‏

وأمَّا بزره‏:‏ فله قوة محلِّلة مجففة‏.‏ وقال ابن ماسويه‏:‏ خاصية حَبِّه، النفع من السموم القاتلة إذا شُرِبَ منه وزنُ مثقال مقشَّراً بماء فاتر، وطِلاء مطبوخ‏.‏ وإن دُقَّ ووضع على موضع اللَّسعة، نفع، وهو مُلَيِّنٌ للطبيعة، مُطَيِّبٌ للنكْهة، وأكثر ُهذا الفعل موجودٌ في قشره‏.‏

وقال غيرُه‏:‏ خاصية حَبُّه النفع مِن لَسعات العقارب إذا شُرِبَ منه وزنُ مثقالين مقشراً بماء فاتر، وكذلك إذا دُقَّ ووُضِعَ على موضع اللَّدغة‏.‏

وقال غيره‏:‏ حَبُّه يصلُح للسُّموم كُلِّهَا، وهو نافع من لدغ الهوام كلها‏.‏

وذُكِرَ أنَّ بعض الأكاسرة غَضِبَ على قوم من الأطباء، فأمر بحبسهم، وخيَّرهم أُدماً لا يزيد لهم عليه، فاختارُوا الأترج، فقيل لهم‏:‏ لِمَ اخترتموه على غيره ‏؟‏ فقالوا‏:‏ لأنه في العاجل ريحانٌ، ومنظره مفرح، وقشرُه طيب الرائحة، ولحمه فاكهة، وحَمْضُه أُدم، وحبُّه تِرياق، وفيه دُهنٌ‏.‏

وحقيقٌ بشىء هذه منافعه أن يُشَبَّهَ به خلاصةُ الوجود، وهو المؤمن الذي يقرأ القرآن، وكان بعضُ السَّلَف يُحِبُّ النظر إليه لما في منظره من التفريح‏.‏

أَرُزُّ‏:‏

فيه حديثان باطلان موضوعان على رسولِ الله صلى الله عليه وسلم ؛ أحدهما ‏:‏ أنه ‏(‏لو كان رجلاً ، لكان حليماً‏)‏ ، الثانى ‏:‏ ‏(‏كُلُّ شىء أخرجتْه الأرضُ ففيه داءٌ وشفاءٌ إلا الأَرُزَّ ‏:‏ فإنه شفاءٌ لا داءَ فيه‏)‏ ذكرناهما تنبيهاً وتحذيراً من نسبتهما إليه صلى الله عليه وسلم ‏.‏

وبعد ‏.‏‏.‏ فهو حار يابس ، وهو أغْذَى الحُبوبِ بعد الحِنْطَة ، وأحمدُها خلطاً ، يَشدُّ البطن شدّاً يسيراً ، ويُقَوِّى المَعِدَة ، ويَدبغُها ، ويمكثُ فيها ‏.‏ وأطباءُ الهند تزعم أنه أحمدُ الأغذية وأنفعُها إذا طُبِخَ بألبان البقر ، وله تأثيرٌ في خِصب البدن ، وزيادةِ المَنِىّ ، وكثرةِ التغذية ، وتصفيةِ اللون ‏.‏

أَرْزٌ بفتح الهمزة وسكون الراء‏:‏

وهو الصَّنَوْبَر‏.‏ ذكره النبىُّ صلى الله عليه وسلم في قوله‏:‏ ‏(‏مَثَلُ المُؤمِنِ مَثَلُ الخامَةِ من الزرع، تُفيئُها الرِّياحُ، تُقيمُهَا مَرَّةً، وتُميلُهَا أُخْرى، ومَثَلُ المُنَافِقِ مَثَلُ الأَرْزَةِ لا تَزَالُ قائمةً على أصْلِها حتى يكونَ انْجِعَافُها مَرَّةً واحدةً‏)‏‏.‏
وَحَبُّه حار رطب، وفيه إنضاجٌ وتليين، وتحليل، ولذعٌ يَذهب بنقعه في الماء، وهو عَسِرُ الهضم، وفيه تغذيةٌ كثيرةٌ، وهو جيدٌ للسُّعال، ولتنقيةِ رطوبات الرِّئة، ويَزِيدُ في المَنِىِّ، ويُولِدُ مغصاً، وتِرْيَاقُه حَبُّ الرُّمان المُزِّ‏.‏

إذْخِرٌ‏:‏

ثبت في ‏(‏الصحيح‏)‏، عنه صلى الله عليه وسلم أنه قال في مكةَ‏:‏ ‏(‏لا يُختَلَى خَلاَها‏)‏، قال له العباس رضى الله عنه‏:‏ إلا الإذْخِرَ يا رسولَ اللهِ؛ فإنه لِقَيْنِهم ولبيوتِهِم، فقال‏:‏ ‏(‏إلا الإذْخِرَ‏)‏‏.‏
والإذْخِرُ حارٌ في الثانية، يابسٌ في الأُولى، لطيف مفتح للسُّددِ، وأفواه العروقُ، يُدرُّ البَوْل والطَّمْث، ويُفَتِّتُ الحصى، ويُحلِّل الأورام الصلبة في المَعِدَة والكَبِد والكُلْيَتين شرباً وضِماداً، وأصلُه يُقوِّى عمودَ الأسنان والمَعِدَة، ويسكن الغَثَيان، ويَعْقِلُ البطن‏.‏

بِطِّيخٌ‏:‏

روى أبو داود والترمذىُّ، عن النبىِّ صلى الله عليه وسلم، أنه كان يأكل البِطيخَ بالرُّطَبِ، يقول‏:‏ ‏(‏نَكْسِرُ حَرَّ هَذَا ببَرْدِ هذا، وبَرْدَ هَذا بِحَرِّ هذا‏)‏‏.‏
وفى البِطِّيخ عدةُ أحاديث لا يَصِحُّ منها شىء غيرُ هذا الحديث الواحد، والمرادُ به الأخضر، وهو باردٌ رطب، وفيه جِلاءٌ، وهو أسرعُ انحداراً عن المَعِدَة من القِثَّاء والخيار، وهو سريعُ الاستحالة إلى أى خلط كان صادفه في المَعِدَة، وإذا كان آكَلُهُ مَحْرُوراً انتفع به جداً، وإن كان مَبْروداً دفع ضررُه بيسير من الزَّنْجَبيل ونحوه، وينبغى أكلُه قبل الطعام، ويُتْبَعُ به، وإلاّ غَثَّى وقيَّأَ‏.‏ وقال بعض الأطباء‏:‏ إنه قبل الطعام يَغسلُ البطن غسلاً، ويُذهب بالداء أصلاً‏.‏

يتبع

nosa_aic
14 - 02 - 2012, 18:22
بَلَحٌ‏:‏

روى النسائى وابن ماجه في ‏(‏سننهما‏)‏‏:‏ من حديث هشام ابن عروةَ، عن أبيه، عن عائشةَ رضى الله عنها قالت‏:‏ قال رسول الله صلى الله عليه وسلم‏:‏ ‏(‏ كُلُوا البلحَ بالتَّمْرِ، فإنَّ الشيطانَ إذا نظرَ إلى ابنِ آدمَ يأكُلُ البَلَحَ بالتمْرِ يقولُ‏:‏ بَقِىَ ابنُ آدمَ حتى أكَلَ الحَديثَ بالعَتِيق ‏)‏‏.‏

وفى رواية‏:‏ ‏(‏كُلُوا البَلَحَ بالتَّمَرِ، فإنَّ الشَّيْطانَ يحزَنُ إذا رأى ابنَ آدمَ يأكُلُهُ يقولُ‏:‏ عاشَ ابنُ آدمَ حتى أكل الجَديدَ بالخَلَقِ‏)‏ رواه البزار في ‏(‏مسنده‏)‏، وهذا لفظه‏.‏
قلت‏:‏ الباءُ في الحديث بمعنى ‏(‏ مع ‏)‏؛ أى‏:‏ كُلُوا هذا معَ هذا‏.‏ قال بعض أطباء الإسلام‏:‏ إنَّما أمر النبىُّ صلى الله عليه وسلم بأكل البلح بالتمر، ولم يأمُرْ بأكل البُسْر مع التمر، لأن البلحَ بارد يابس، والتمرَ حار رطب، ففى كُلٍّ منهما إصلاحٌ للآخر، وليس كذلك البُسْر مع التَّمْرِ، فإنَّ كُلَّ واحد منهما حارٌ، وإن كانت حرارةُ التمر أكثر، ولا ينبغى من جهة الطِّبِّ الجمعُ بين حارَّين أو باردَين، كما تقدَّم‏.‏
وفى هذا الحديث‏:‏ التنبيهُ على صحةِ أصل صناعة الطب، ومراعاةِ التدبير الذي يصلُح في دفع كيفيات الأغذية والأدوية بعضِها ببعض، ومراعاةِ القانون الطبى الذي تُحفظ به الصحة‏.‏
وفى البلح برودةٌ ويبوسةٌ، وهو ينفع الفمَ واللِّثَة والمَعِدَة، وهو ردىءٌ للصدر والرِّئة بالخشونة التي فيه، بطىءٌ في المَعِدَة يسيرُ التغذية، وهو للنخلة كالحِصْرِم لشجرة العنب، وهما جميعاً يُولِّدان رياحاً، وقَرَاقِرَ، ونفخاً، ولا سِيَّما إذا شُرب عليهما الماء، ودفعُ مضرتهما بالتَّمْر، أو بالعسل والزُّبد‏.‏

بُسْرٌ‏:‏

ثبت في ‏(‏الصحيح‏)‏‏:‏ أنَّ أبا الهيثم بن التَّيْهان، لما ضافه النبىُّ صلى الله عليه وسلم وأبو بكر وعمر رضى الله عنهما، جاءهم بِعذْقٍ وهو من النخلة كالعُنُقودِ من العنب فقال له‏:‏ ‏(‏هلاَّ انتقَيْتَ لنا من رُطَبهِ‏)‏ فقال‏:‏ أحببتُ أنْ تَنْتَقُوا من بُسْرِهِ ورُطَبِهِ‏.‏
البُسْر‏:‏ حار يابس، ويُبسه أكثرُ من حرِّه، يُنشِّفُ الرطوبةَ، ويَدْبَغُ المعدة، وَيحبِسُ البطن، وينفع اللِّثة والفم، وأنفعه ما كان هشَّاً وحُلواً، وكثرةُ أكله وأكل البَلح يُحدث السَّدد في الأحشاء‏.‏

بَيْضٌ‏:‏

ذكر البيهقى في ‏(‏شُعَبِ الإيمان‏)‏ أثراً مرفوعاً‏:‏ أنَّ نبياً من الأنبياء شكى إلى الله سبحانه الضعفَ، فأمره بأكل البيض‏.‏ وفى ثبوته نظرٌ‏.‏
يُختار من البيض الحديثُ على العتيق، وبيضُ الدَّجاج على سائر بيض الطير، وهو معتدل يميل إلى البرودة قليلاً‏.‏

قال صاحب ‏(‏القانون‏)‏‏:‏ ومُحُّهُ‏:‏ حار رطب، يُولِّد دماً صحيحاً محموداً، ويُغذى غذاءً يسيراً، ويُسرعُ الانحدارَ من المعدة إذا كان رِخواً‏.‏
وقال غيره‏:‏ مُحُّ البيض‏:‏ مسكن للألم، مملسٌ للحلق وقصبة الرئة، نافع للحلق والسُّعال وقُروح الرئة والكُلَى والمثانة، مذهِبٌ للخشونة، لا سِيَّما إذا أُخِذَ بدُهن اللَّوز الحلو، ومنضجٌ لما في الصدر، ملين له، مسهل لخشونة الحلق، وبياضه إذا قُطِرَ في العين الوارمة ورماً حاراً، برَّده، وسكَّن الوجع، وإذا لُطخ به حرقُ النار أو ما يعرض له، لم يدَعه يتنفَّط، وإذا لُطخ به الوجع، منع الاحتراق العارض من الشمس، وإذا خُلِطَ بالكُنْدُر، ولُطخ على الجبهة، نفع من النزلة‏.‏
وذكره صاحب ‏(‏القانون‏)‏ في الأدوية القلبية، ثم قال‏:‏ وهو وإن لم يكن من الأدوية المطلقة فإنه مما له مدخل في تقوية القلب جداً، أعنى الصفرةَ، وهى تجمع ثلاثة معان‏:‏ سرعة الاستحالة إلى الدم، وقِلَّة الفضلة، وكون الدم المتولِّد منه مجانساً للدم الذي يغذو القلبَ خفيفاً مندفعاً إليه بسرعة، ولذلك هو أوفقُ ما يُتلافى به عاديةُ الأمراض المحلِّلة لجوهر الروح‏.‏

بَصَلٌ‏:‏

روى أبو داودَ في ‏(‏سننه‏)‏‏:‏ عن عائشةَ رضى الله عنها، أنها سُئِلَتْ عن البصل، فقالت‏:‏ ‏(‏إنَّ آخرَ طعام أكلَهُ رسولُ الله صلى الله عليه وسلم كان فيه بَصَلٌ‏)‏‏.‏
وثبت عنه في ‏(‏الصحيحين‏)‏‏:‏ ‏(‏أنه منع آكِلَه من دُخُولِ المَسْجِدِ‏)‏‏.‏
والبصل‏:‏ حار في الثالثة، وفيه رطوبة فَضليَّة ينفعُ من تغير المياه، ويدفعُ ريحَ السموم، ويفتِّق ال****، ويقوِّى المَعِدَة، ويُهَيج الباه، ويزيد في المَنِىِّ، ويُحسِّن اللَّون، ويقطع البلغم، ويجلُو المَعِدَة، وبِزره يُذهب البَهَق، ويدلَّك به حول داء الثعلب، فينفع جداً، وهو بالملح يقلع الثآلِيل، وإذا شَمَّهُ مَن شَرِب دواءً مسهلاً منعه من القىء والغثيان وأذهب رائحة ذلك الدواء، وإذا استُعِطَ بمائه، نَقَّى الرأس، ويُقطَّر في الأُذن لثقَل السمع والطَّنين والقيح، والماء الحادث في الأُذنين، وينفع في الماء النازل في العينين اكتحالاً يُكتَحَل ببزره مع العسل لبياض العين، والمطبوخ منه كثيرُ الغذاء ينفع مِن اليَرَقانِ والسُّعال، وخشونةِ الصدر، ويُدِرُّ البَوْل، ويلين الطبع، وينفع مِن عضة ال*** غير الكَلِب إذا نُطِلَ عليها ماؤه بملح وسَذَاب، وإذا احتُمل، فتح أفواهَ البواسير‏.‏
وأما ضررُه‏:‏ فإنه يورث الشَّقِيقة، ويُصدِّع الرأس، ويُولِّد أرياحاً، ويُظلم البصر، وكثرةُ أكله تُورث النسيان، ويُفسد العقل، ويُغيِّر رائحةَ الفم والنَّكْهة، ويُؤذى الجليسَ، والملائكة، وإماتتُه طبخاً تُذهب بهذه المضرَّاتِ منه‏.‏
وفى السنن‏:‏ أنه صلى الله عليه وسلم ‏(‏ أمَرَ آكِلَه وآكِلَ الثُّومِ أن يُميتَهُما طبخاً‏)‏‏.‏
ويُذهب رائحته مضغُ ورق السَّذَاب عليه‏.‏

باذِنْجان‏:‏

في الحديث الموضوع المختلَق على رسـول الله صلى الله عليه وسلم‏:‏
‏(‏الباذِنجانُ لما أُكِلَ له‏)‏، وهذا الكلام مما يُستقبح نسبته إلى آحاد العقلاء، فضلاً عن الأنبياء، وبعد‏.‏‏.‏ فهو نوعان‏:‏ أبيضُ وأسودُ، وفيه خلاف، هل هو بارد أو حار ‏؟‏ والصحيحُ‏:‏ أنه حار، وهو مُوَلِّد للسوداء والبواسير، والسُّدد والسرطان والجُذام، ويُفسد اللَّون ويُسوِّده، ويُضر بنتن الفم، والأبيضُ منه المستطيل عارٍ من ذلك‏.‏

تَمْرٌ‏:‏

ثبت في ‏(‏الصحيح‏)‏ عنه صلى الله عليه وسلم‏:‏ ‏(‏مَن تَصَبَّحَ بِسَبْعِ تَمَراتٍ‏)‏ وفى لفظٍ‏:‏ ‏(‏ مِن تَمْر العَاليةلم يَضُرَّه ذلك اليَوْمَ سُمٌ ولا سِحْرٌ‏)‏‏.‏
وثبت عَنه أنه قال‏:‏ ‏(‏بيتٌ لا تَمْرَ فيه جِيَاعٌ أهْلُهُ‏)‏‏.‏
وثبتَ عنه أنه أكل التَّمرَ بالزُّبدِ، وأكل التَمْرَ بالخبز، وأكله مفرداً‏.‏
وهو حار في الثانية، وهل هو رَطب في الأُولى، أو يابس فيها ‏؟‏‏.‏ على قولين‏.‏ وهو مقوٍّ للكبد، مُليِّن للطبع، يزيد في الباه، ولا سِيَّما مع حَبِّ الصَّنَوْبر، ويُبرىء من خشونة الحلق، ومَن لم يعتدْه كأهل البلاد الباردة فإنهُ يُورث لهم السّدد، ويُؤذى الأسنان، ويهيج الصُّداع‏.‏ ودفعُ ضرره باللَّوز والخَشْخاش، وهو من أكثر الثمار تغذيةً للبدن بما فيه من الجوهر الحار الرطب، وأكلُه على الريق يقتُل الدود، فإنه مع حرارته فيه قوةٌ تِرْياقيَّة، فإذا أُدِيمَ استعمالُه على الريق، خفَّف مادة الدود، وأضعفه وقلَّله، أو قتله، وهو فاكهة وغذاء، ودواء وشراب وحَلوى‏.‏
تِينٌ‏:‏
لما لم يكن التينُ بأرض الحجاز والمدينة، لم يأتِ له ذكرٌ في السُّـنَّة، فإنَّ أرضَه تُنافى أرضَ النخل، ولكن قد أقسم الله به في كتابه، لكثرة منافعه وفوائِدِهِ، والصحيح‏:‏ أنَّ المُقْسَمَ به‏:‏ هو التينُ المعروف‏.‏
وهو حارٌ، وفى رطوبته ويبوسته قولان، وأجوده‏:‏ الأبيض الناضج القشر، يجلُو رملَ الكُّلَى والمثانة، ويُؤمِّن من السُّموم، وهو أغْذَى من جميع الفواكه وينفع خشونَةَ الحلق والصدر، وقصبة الرئة، ويغسِلُ الكَبِدَ والطِّحَال، ويُنقِّى الخَلْطَ البلغمىَّ من المَعِدَة، ويَغذُو البدن غِذاءً جيداً، إلا أنه يُولِّدُ القملَ إذا أُكثر منه جداً‏.‏
ويابسُه يغذىوينفـعُ العصب، وهو مع الجَـوْز واللَّوز محمـودٌ‏.‏ قال
‏(‏جالينوسُ‏)‏‏:‏ ‏(‏وإذا أُكل مع الجَوْز والسَّذَاب قبْلَ أخذِ السُّمِّ القاتل، نفع، وحَفِظَ من الضرر‏)‏
ويُذكر عن أبى الدَّرْداء‏:‏ أُهْدِى إلى النبىِّ صلى الله عليه وسلم طبقٌ من تينٍ، فقال‏:‏
‏(‏كُلُوا‏)‏، وأكل منه، وقال‏:‏ ‏(‏ لو قُلْتُ‏:‏ إنَّ فاكهةً نزلتْ من الجنَّة قلتُ هذه، لأنَّ فاكهة الجنَّةِ بلا عَجَمٍ، فكُلُوا منها فإنها تَقْطَعُ البَوَاسير، وتنفعُ من النقْرِس‏)‏‏.‏ وفى ثبوت هذا نظرٌ‏.‏
يتبع

nosa_aic
14 - 02 - 2012, 18:27
واللَّحمُ منه أجودُ، ويُعَطِّش المحرورين، ويسكن العطش الكائن عن البلغم المالح، وينفعُ السُّعَال المُزْمن، ويُدِرُّ البَوْل، ويفتحُ سدَدَ الكبد والطِّحَال، ويُوافق الكُلَى والمثانة، ولأكلِه على الريق منفعة عجيبة في تفتيح مجارى الغذاء، وخصوصاً باللَّوز والجَوْز، وأكلُه مع الأغذية الغليظة ردىءٌ جداً، والتُّوت الأبيض قريبٌ منه، لكنه أقلُّ تغذيةً وأضرُّ بالمَعِدَة‏.‏
تَلبينةٌ‏:‏
قد تقدَّم أنها ماءُ الشَّعير المطحون، وذكرنا منافعها، وأنها أنفعُ لأهل الحجاز من ماء الشَّعِير الصحيح‏.‏

ثَلْجٌ‏:‏
ثبت في ‏(‏الصحيح‏)‏ عن النبىِّ صلى الله عليه وسلم أنه قال‏:‏ ‏(‏اللَّهُمَّ اغْسِلْنى مِنْ خطاياىَ بالماءِ والثَّلْجِ والبَرَدِ‏)‏‏.‏
وفى هذا الحديث من الفقه‏:‏ أنَّ الداء يُداوَى بضده، فإنَّ في الخطايا من الحرارة والحريق ما يُضاده الثلجُ والبَرَدُ، والماءُ البارد، ولا يقال‏:‏ إنَّ الماء الحار أبلغُ في إزالة الوسخ، لأنَّ في الماء البارد من تصليب الجسم وتقويته ما ليس في الحار، والخطايا تُوجب أثرين‏:‏ التدنيس والإرخاء، فالمطلوبُ مداواتها بما ينظِّفُ القلب ويُصْلِّبُهُ، فذكر الماء البارد والثلج والبَرَد إشارةٌ إلى هذين الأمرين‏.‏
وبعد‏.‏‏.‏ فالثلجُ بارد على الأصح، وغَلِطَ مَن قال‏:‏ حارٌ، وشُبهته تَولُّد الحيوان فيه، وهذا لا يدل على حرارته، فإنه يتولَّد في الفواكه الباردة، وفى الخَلِّ، وأما تعطيشه، فلتهييجه الحرارةَ لا لحرارتِه في نفسه، ويضرُّ المَعِدَة والعصب، وإذا كان وجعُ الأسنانِ من حرارة مفرطة، سَكَّنها‏.‏

ثُومٌ‏:‏
هو قريب من البصل، وفى الحديث‏:‏ ‏(‏مَن أكَلَهُما فلْيُمِتْهُمَا طَبْخاً‏)‏‏.‏ وأُهدى إليه طعامٌ فيه ثومٌ، فأرسل به إلى أبى أيوب الأنصارىِّ، فقال‏:‏ يارسولَ الله؛ تَكْرهه وتُرْسِلُ به إلىَّ ‏؟‏ فقال‏:‏ ‏(‏إنىِّ أُناجى مَنْ لا تُنَاجِى‏)‏
وبعد فهو حار يابس في الرابعة، يسخن تسخنياً قوياً، ويجفف تجفيفاً بالغاً، نافع للمبرودين، ولمن مزاجه بلغمي، ولمن أشرف على الوقوع في الفالج، وهو مجفف للمني، مفتح للسدد، محلل للرياح الغليظة، هاضم للطعام، قاطع للعطش، مطلق للبطن، مدر للبول، يقوم في لسع الهوام وجميع الأورام الباردة مقام الترياق، وإذا دق وعمل منه ضماد على نهش الحيات، أو على لسع العقارب، نفعها وجذب السموم منها، ويسخن البدن، ويزيد في حرارته، ويقطع البلغم، ويحلل النفخ، ويصفي الحلق، ويحفظ صحة أكثر الأبدان، وينفع من تغير المياه، والسعال المزمن، ويؤكل نيئاً ومطبوخاً ومشوياً، وينفع من وجع الصدر من البرد، ويخرج العلق من الحلق وإذا دق مع الخل والملح والعسل، ثم وضع على الضرس المتأكل، فتته وأسقطه، وعلى الضرس الوجع، سكن وجعه‏.‏ وإن دق منه مقدار درهمين، وأخذ مع ماء العسل، أخرج البلغم والدود، وإذا طلي بالعسل على البهق، نفع‏.‏
ومن مضاره‏:‏ أنه يصدع، ويضر الدماغ والعينين، ويضعف البصر والباه، ويعطش، ويهيج الصفراء، ويجيف رائحة الفم، ويذهب رائحته أن يمضغ عليه ورق السذاب‏.‏
ثريد‏:‏
ثبت في ‏(‏الصحيحين‏)‏ عنه صلى الله عليه وسلم أنه قال‏:‏ ‏(‏فضل عائشة على النساء كفضل الثريد على سائر الطعام‏)‏‏.‏
والثريد وإن كان مركباً، فإنه مركب من خبز ولحم، فالخبز أفضل الأقوات، واللحم سيد الإدام، فإذا اجتمعا لم يكن بعدهما غاية‏.‏
وتنازع الناس أيهما أفضل ‏؟‏ والصواب أن الحاجة إلى الخبز أكثر وأعم، واللحم أجل وأفضل، وهو أشبه بجوهر البدن من كل ما عداه، وهو طعام أهل الجنة، وقد قال تعالى لمن طلب البقل‏:‏ والقثاء، والفوم، والعدس، والبصل‏:‏ ‏{‏أتستبدلون الذي هو أدنى بالذي هو خير‏}‏ ‏[‏البقرة‏:‏ 62‏]‏، وكثير من السلف على أن الفوم الحنطة، وعلى هذا فالآية نص على أن اللحم خير من الحنطة‏.‏

جمار‏:‏
قلب النخل، ثبت في ‏(‏الصحيحين‏)‏‏:‏ عن عبد الله بن عمر قال‏:‏ بينا نحن عند رسول الله صلى الله عليه وسلم جلوس، إذ أتي بجمار نخلة، فقال النبي صلى الله عليه وسلم‏:‏ ‏(‏إن من الشجر شجرة مثل الرجل المسلم لا يسقط ورقها‏.‏‏.‏ الحديث‏)‏‏.‏ والجمار‏:‏ بارد يابس في الأولى، يختم القروح، وينفع من نفث الدم، واستطلاق البطن، وغلبه المرة الصفراء، وثائرة الدم، وليس برديء الكيموس، ويغذو غذاء يسيراً، وهو بطيء الهضم، وشجرته كلها منافع، ولهذا مثلها النبي صلى الله عليه وسلم بالرجل المسلم لكثرة خيره ومنافعه‏.‏
جبن‏:‏
في ‏(‏السنن‏)‏ عن عبد الله بن عمر قال‏:‏ ‏(‏أتي النبي صلى الله عليه وسلم بجبنة في تبوك، فدعا بسكين، وسمى وقطع‏)‏ رواه أبو داود، وأكله الصحابة رضي الله عنهم بالشام، والعراق، والرطب منه غير المملوح جيد للمعدة، هين السلوك في الأعضاء، يزيد في اللحم، ويلين البطن تلييناً معتدلاً، والمملوح أقل غذاء من الرطب، وهو رديء للمعدة، مؤذ للأمعاء، والعتيق يعقل البطن، وكذا المشوي، وينفع القروح ويمنع الإسهال‏.‏ وهو بارد رطب، فإن استعمل مشوياً، كان أصلح لمزاجه، فإن النار تصلحه وتعدله، وتلطف جوهره، وتطيب طعمه ورائحته‏.‏ والعتيق المالح، حار يابس، وشيه يصلحه أيضاً بتلطيف جوهره، وكسر حرافته لما تجذبه النار منه من الأجزاء الحارة اليابسة المناسبة لها، والمملح منه يهزل، ويولد حصاة الكلى والمثانة، وهو رديء للمعدة، وخلطة بالملطفات أردأ بسبب تنفيذها له إلى المعدة‏.‏
حناء‏:‏
قد تقدمت الأحاديث في فضله، وذكر منافعه، فأغنى عن إعادته‏.‏

حبة السوداء‏:‏
ثبت في ‏(‏الصحيحين‏)‏‏:‏ من حديث أبي سلمة، عن أبي هريرة رضي الله عنه، أن رسول الله صلى الله عليه وسلم قال‏:‏ ‏(‏عليكم بهذة الحبة السوداء، فإن فيها شفاء من كل داء إلا السام‏)‏‏.‏ السام‏:‏ الموت‏.‏

يتبع

nosa_aic
14 - 02 - 2012, 18:31
الحبة السوادء‏:‏
هي الشونيز في لغة الفرس، وهي الكمون الأسود، وتسمى الكمون الهندي، قال الحربي، عن الحسن‏:‏ إنها الخردل، وحكى الهروي‏:‏ أنها الحبة الخضراء ثمرة البطم، وكلاهما وهم، والصواب‏:‏ أنها الشونيز‏.‏

وهي كثيرة المنافع جداً، وقوله‏:‏ ‏(‏شفاء من كل داء‏)‏، مثل قوله تعالى‏:‏ ‏{‏تدمر كل شيء بأمر ربها‏}‏ ‏[‏الأحقاف‏:‏ 25‏]‏ أي‏:‏ كل شيء يقبل التدمير ونظائره، وهي نافعة من جميع الأمراض الباردة، وتدخل في الأمراض الحارة اليابسة بالعرض، فتوصل قوى الأدوية الباردة الرطبة إليها بسرعة تنفيذها إذا أخذ يسيرها‏.‏
وقد نص صاحب ‏(‏القانون‏)‏ وغيره، على الزعفران في قرص الكافور لسرعة تنفيذه وإيصاله قوته، وله نظائر يعرفها حذاق الصناعة، ولا تستبعد منفعة الحار في أمراض حارة بالخاصية، فإنك تجد ذلك في أدوية كثيرة، منها‏:‏ الأنزروت وما يركب معه من أدوية الرمد، كالسكر وغيره من المفردات الحارة، والرمد ورم حار باتفاق الأطباء، وكذلك نفع الكبريت الحار جداً من الجرب‏.‏
والشونيز حار يابس في الثالثة، مذهب للنفخ، مخرج لحب القرع، نافع من البرص وحمى الربع، والبلغمية مفتح للسدد، ومحلل للرياح، مجفف لبلة المعدة ورطوبتها‏.‏ وان دق وعجن بالعسل، وشرب بالماء الحار، أذاب الحصاة التي تكون في الكليتين والمثانة، ويدر البول والحيض واللبن إذا أديم شربه أياماً، وإن سخن بالخل، وطلي على البطن، قتل حب القرع، فإن عجن بماء الحنظل الرطب، أو المطبوخ، كان فعله في إخراج الدود أقوى، ويجلو ويقطع، ويحلل، ويشفي من الزكام البارد إذا دق وصير في خرقة، واشتم دائماً، أذهبه‏.‏
ودهنه نافع لداء الحية، ومن الثآليل والخيلان، وإذا شرب منه ثقال بماء، نفع من البهر وضيق النفس، والضماد به ينفع من الصداع البارد، وإذا نقع منه سبع حبات عدداً في لبن امرأة، وسعط به صاحب اليرقان، نفعه نفعاً بليغاً‏.‏


وإذا طبخ بخل، وتمضمض به، نفع من وجع الأسنان عن برد، وإذا استعط به مسحوقاً، نفع من ابتداء الماء العارض في العين، وإن ضمد به مع الخل، قلع البثور والجرب المتقرح، وحلل الأورام البلغمية المزمنة، والأورام الصلبة، وينفع من اللقوة إذا تسعط بدهنه، وإذا شرب منه مقدار نصف مثقال إلى مثقال، نفع من لسع الرتيلاء، وإن سحق ناعماً وخلط بدهن الحبة الخضراء، وقطر منه في الأذن ثلاث قطرات، نفع من البرد العارض فيها والريح والسدد‏.‏


وإن قلي، ثم دق ناعماً، ثم نقع في زيت، وقطر في الأنف ثلاث قطرات أو أربع، نفع من الزكام العارض معه عطاس كثير‏.‏
وإذا أحرق وخلط بشمع مذاب بدهن السوسن، أو دهن الحناء، وطلي به القروح الخارجة من الساقين بعد غسلها بالخل، نفعها وأزال القروح‏.‏
وإذا سحق بخل، وطلي به البرص والبهق الأسود، والحزاز الغليظ، نفعها وأبرأها‏.‏
وإذا سحق ناعماً، واستف منه كل يوم درهمين بماء بارد من عضه *** *** قبل أن يفرغ من الماء، نفعه نفعاً بليغاً، وأمن على نفسه من الهلاك‏.‏ وإذا استعط بدهنه، نفع من الفالج والكزاز، وقطع موادهما، وإذا دخن به، طرد الهوام‏.‏
وإذا أذيب الأنزروت بماء، ولطخ على داخل الحلقة، ثم ذر عليها الشونيز، كان من الذرورات الجيدة العجيبة النفع من البواسير، ومنافعه أضعاف ما ذكرنا، الشربة منه درهمان، وزعم قوم أن الإكثار منه قاتل‏.‏
حرير‏:‏

قد تقدم أن النبي صلى الله عليه وسلم أباحه للزبير، ولعبد الرحمن بن عوف من حكة كانت بهما، وتقدم منافعه ومزاجه، فلا حاجة إلى إعادته‏.‏

حرف‏:‏
قال أبو حنيفة الدينوري‏:‏ هذا هو الحب الذي يتداوى به، وهو الثفاء الذي جاء فيه الخبر عن النبي صلى الله عليه وسلم، ونباته يقال له‏:‏ الحرف، وتسميه العامة‏:‏ الرشاد، وقال أبو عبيد‏:‏ الثفاء‏:‏ هو الحرف‏.‏
قلت‏:‏ والحديث الذي أشار إليه، ما رواه أبو عبيد وغيره، من حديث ابن عباس رضي الله عنهما، عن النبي صلى الله عليه وسلم أنه قال‏:‏ ‏(‏ماذا في الأمرين من الشفاء ‏؟‏ الصبر والثفاء‏)‏ رواه أبو داود في المراسيل‏.‏
وقوته في الحرارة واليبوسة في الدرجة الثالثة، وهو يسخن، ويلين البطن، ويخرج الدود وحب القرع، ويحلل أورام الطحال، ويحرك **** الجماع، ويجلو الجرب المتقرح والقوباء‏.‏وإذا ضمد به مع العسل، حلل ورم الطحال، وإذا طبخ مع الحناء أخرج الفضول التي في الصدر، وشربه ينفع من نهش الهوام ولسعها، وإذا دخن به في موضع، طرد الهوام عنه، ويمسك الشعر المتساقط، وإذا خلط بسويق الشعير والخل، وتضمد به، نفع من عرق النسا، وحلل الأورام الحارة في آخرها‏.‏
وإذا تضمد به مع الماء والملح أنضج الدماميل، وينفع من الاسترخاء في جميع الأعضاء، ويزيد في الباه، ويشهي الطعام، وينفع الربو، وعسر التنفس، وغلظ الطحال، وينقي الرئة، ويدر الطث، وينفع من عرق النَّسا، ووجع حقِّ الوَرِك مما يخرج من الفضول، إذا شرب أو احتقن به، ويجلو ما في الصدر والرئة من البلغم اللزج‏.‏
وإن شرب منه بعد سحقه وزن خمسة دراهم بالماء الحار، أسهل الطبيعة، وحلل الرياح، ونفع من وجع القولنج البارد السبب، وإذا سحق وشرب، نفع من البرص‏.‏
وإن لطخ عليه وعلى البهق الأبيض بالخل، نفع منهما، وينفع من الصداع الحادث من البرد والبلغم، وإن قلي، وشرب، عقل الطبع لا سيما إذا لم يسحق لتحلل لزوجته بالقلي، وإذا غسل بمائه الرأس، نقاه من الأوساخ والرطوبات اللزجة‏.‏
قال جالينوس‏:‏ قوته مثل قوة بزر الخردل، ولذلك قد يسخن به أوجاع الوَرِك المعروفة بالنَّسا، وأوجاع الرأس، وكل واحد من العلل التي تحتاج إلى تسخين، كما يسخن بزر الخردل، وقد يخلط أيضاً في أدوية يسقاها أصحاب الربو من طريق أن الأمر فيه معلوم أنه يقطع الأخلاط الغليظة تقطيعاً قوياً، كما يقطعها بزر الخردل، لأنه شبيه به في كل شيء‏.‏

حلبة‏:‏
يذكر عن النبي صلى الله عليه وسلم، أنه عاد سعد بن أبي وقاص رضي الله عنه بمكة، فقال‏:‏ ادعوا لي طبيباً، فدعي الحارث بن كلدة، فنظر إليه فقال‏:‏ ليس عليه بأس، فاتخذوا له فريقة، وهي الحلبة مع تمر عجوة رطب يطبخان، فيحساهما، ففعل ذلك، فبرئ وقوة الحلبة من الحرارة في الدرجة الثانية، ومن اليبوسة في الأولى، وإذا طبخت بالماء، لينت الحلق والصدر والبطن، وتسكن السعال والخشونة والربو، وعسر النفس، وتزيد في الباه، وهي جيدة للريح والبلغم والبواسير، محدرة الكيموسات المرتبِكَة في الأمعاء، وتحلل البلغم اللزج من الصدر، وتنفع من الدبيلات وأمراض الرئة، وتستعمل لهذا الأدواء في الأحشاء مع السمن والفانيذ‏.‏
وإذا شربت مع وزن خمسة دراهم فُوةٍ، أدرت الحيض، وإذا طبخت، وغسل بها الشعر جعدته، وأذهبت الحزاز‏.‏ودقيقها إذا خلط بالنطرون والخل، وضمد به، حلل ورم الطحال، وقد تجلس المرأة في الماء الذي طبخت فيه الحلبة، فتنتفع به من وجع الرحم العارض من ورم فيه‏.‏ وإذا ضمد به الأورام الصلبة القليلة الحرارة، نفعتها وحللتها، وإذا شرب ماؤها، نفع من المغص العارض من الرياح، وأزلق الأمعاء‏.‏
وإذا أكلت مطبوخة بالتمر، أو العسل، أو التين على الريق، حللت البلغم اللزج العارض في الصدر والمعدة، ونفعت من السعال المتطاول منه‏.‏
وهي نافعة من الحصر، مطلقة للبطن، وإذا وضعت على الظفر المتشنج أصلحته، ودهنها ينفع إذا خلط بالشمع من الشقاق العارض من البرد، ومنافعها أضعاف ما ذكرنا‏.‏
ويذكر عن القاسم بن عبد الرحمن، أنه قال‏:‏ قال رسول الله صلى الله عليه وسلم‏:‏ ‏(‏استشفوا بالحلبة‏)‏ وقال بعض الأطباء‏:‏ لو علم الناس منافعها، لاشتروها بوزنها ذهباً‏

احمد محمد عادل
14 - 02 - 2012, 20:04
فوائد الحرنكش
الكاتب Administrator الأربعاء, 02 فبراير 2011
http://tpmo.org/ar/templates/it_healthcare/images/pdf_button.png (http://tpmo.org/ar/index.php?view=article&catid=118%3A2011-02-19-20-20-06&id=1316%3A2011-02-02-10-57-09&format=pdf&option=com_content&Itemid=785)http://tpmo.org/ar/templates/it_healthcare/images/printButton.png (http://tpmo.org/ar/index.php?view=article&catid=118%3A2011-02-19-20-20-06&id=1316%3A2011-02-02-10-57-09&tmpl=component&print=1&layout=default&page=&option=com_content&Itemid=785)http://tpmo.org/ar/templates/it_healthcare/images/emailButton.png (http://tpmo.org/ar/index.php?option=com_mailto&tmpl=component&link=aHR0cDovL3RwbW8ub3JnL2FyL2luZGV4LnBocD9vcHRpb 249Y29tX2NvbnRlbnQmdmlldz1hcnRpY2xlJmlkPTEzMTY6MjA xMS0wMi0wMi0xMC01Ny0wOSZjYXRpZD0xMTg6MjAxMS0wMi0xO S0yMC0yMC0wNiZJdGVtaWQ9Nzg1)
http://tpmo.org/ar/images/stories/fruit/7arankesh.jpgهذه الثمرة الصغيرة التي تشبه «حبة العنب» بغطائها الجاف والخفيف غالبا ما ينساها الكبار ولا يتذكرها إلا الصغار وهم في سن الم درسة ، حيث يتناو لونها على سبيل الترفيه فقط ، لكن هذا قد يتغير قريبا بعد أن اثبتت دراسة علمية مصرية أخيرا أن تناول 9 جرامات يومياً من هذه الثمرة الصغيرة، يمكن أن يقي من ارتفاع الكوليسترول في الدم ، ومن ارتفاع الضغط ، بل ويمكن ان يحافظ على معدلات أنزيمات الكبد Got و gpt في مستواهما المثالي

وهذا ما أكدته لنا اختصاصية الحاصلات البستانية بمعهد بحوث وتكنولوجيا الأغذية التابع لوزارة الزراعة المصرية الدكتورة، لبنى محمد بقولها أن الحرنكش يعد من الثمار المهمة للغاية في محاربة أنيميا نقص الحديد. فالتجارب التي اجريت على الفئران لمدة 3 أشهر أكدت أنها تحارب الأنيميا وبقوة، لذلك فإن خلط الحرنكش منزلياً في عصائر الفواكه المتنوعة مثل الجوافة أو الفراولة أو المانجو والبرتقال يعتبر امرا جيدا للصحة العامة، إضافة إلى ان خلطه مع باقي الفواكه يحسن طعمه من ناحية ، ويرفع من قيمة العصير الغذائية من ناحية أخرى بخلاف إمكانية تناول الحرنكش طازجاً .

وتذكر الدكتورة لبنى إمكانية صنع المربى أو حتى «الجيلي» من ثمار الحرنكش ذات اللون الأصفر والنكهة المقبولة، مشيرة إلى أن التقييم الكيميائي والبيولوجي لهذه الثمار أثبت أن المستخلص العصيري يمثل 77% وهو غني بحامض الاسكورييك، بما يعادل 120 ملليجراما في الـ100 جرام عصير، وأن السكريات الكلية وصلت إلى 26% والكاروتينويدات 12 ملليجراما في الـ100 جرام ، وأن الغلاف الخارجي للثمار به 11% بكتن وقشرة الثمرة بها 21% بكتن أيضاً، بل أن الغلاف الخارجي احتوى على 10 ملليجرامات كاروتينويدات مقارنة بالقشرة 4 ملليجرامات فقط في الـ100 جرام ، وأن البذور الداخلية بها 16% بروتين ومثلها ليبيدات، وأن المواد الكربوهيدراتية والألياف احتلت المركز الأول كمواد أساسية في البذور والغلاف الخارجي والقشرة للثمار ، الخلاصة أنه مفيد وجيد للصحة .

وتضيف الدكتورة أن ثمرة الحرنكش غنية أيضاً بمواد أثبتت التجارب أنها ذات تأثير مضاد للحساسية أو الالتهاب كونها تحتوي أيضاً على أعلى كمية كاروتين وفيتامين A و c وهي في ذلك تعادل ثمار الليمون، الأمر الذي يجعل الحرنكش يحسن من قدرات الجسم على امتصاص الحديد، مما يقي من انخفاض هيموجلوبين الدم ، بخلاف الألياف الغذائية والسكريات والكربوهيدرات ، والكولين مما يعطي الحرنكش مكانة عالية في السلم الصحي، لا سيما وأن زيادة استهلاكه لا تسبب أية آثار سمية، ويمكن تناوله يومياً وبأي كمية في أمان تام . وهو بهذا يعمل على مد الجسم بعناصر مهمة مثل الحديد والكالسيوم والبوتاسيوم والزنك والفوسفور والبروتين والدهون والرماد والألياف الغذائية والكربوهيدرات. لذلك عليك به ولا تقلق من أي مضاعفات جانبية حتى وإن كنت تتبع نظام حمية للتخسيس، فكل 100 جرام حرنكش
تعطي 31 سعرة حرارية فقط

nosa_aic
15 - 02 - 2012, 04:49
ضعف شهية الطفل مشكلة ولكن لها حل

ضعف شهية الطفل مشكلة توجدها الأم القلقة وينميها الطفل الذى يجد فى قلق أمه وسيلة ناجحة لإشباع رغبته فى إبراز شخصيته للعالم الصغير الذى يعيش فيه.

يقول الدكتور خليل الديوانى أستاذ طب الأطفال بكلية الطب جامعة الأزهر: ضعف الشهية عند الطفل مشكلة كل أم حيث تقابلنى بها الأم بقولها المأثور "إبنى نفسه مسدودة يا دكتور" جملة سمعتها من أمهات الأطفال أكثر مما سمعت "صباح الخير" والواقع أن مشكلة الشهية عند الأطفال تقلق بال الكثير من الأمهات وفى هذى السنة الأولى من عمره تكون شهيتة قوية عادة لكى يتناول الغذاء الكافى لهذا النمو السريع ولكن نمو الطفل لا يستمر بهذى السرعة مدى الحياة وبعد السنة الأولى يبطئ بحيث لا يزيد وزنه أكثر من 3 كيلو سنويا أى 8 جرمات يوميا ومع البطء فى النمو تقل حاجة الجسم وتقل شهية الطفل.

وهناك ثلاثة أسباب لضعف شهية الطفل:

*مرضية: كالنزلات الشعبية أو المعوية أو غيرها من الأمراض التى تصيب الطفل بضعف مؤقت فى شهيته تعود الشهية بعد ذلك إلى ما كانت عليه.

*طبيعية: إذا تناول الحلوى أو أى طعام بين الوجبات أو تقديم الوجبات فى فترات متقاربة جدا .

* نفسية: وهى تشكل الغالبية العظمى من حالات فقد الشهية كتوتر أمه أو تأنيبه.

وتسطيع الأم التغلب على ضعف شهية الطفل بعد أن تتأكد من خلوه من أى سبب مرضى لضعف شهيته وتختلف الشهية وسرعة النمو من طفل إلى آخر فلا داعى للمقارنة بين طفلك وأطفال آخرين.

ووزن الطفل هو الفيصل فهو يزيد ربع كيلو كل شهر بعد السنة الثانية... تجنبى مناقشتة فى مسألة الأكل ولا ترغميه على الأكل بالتهديد أو بالضرب أو بالرشوة والمحايلة بل ضعى الأكل أمامه على السفرة من 20-30 دقيقة يأكل ما يشاء ثم إرفعى الباقى بدون تعليق.

دعيه يختار الطعام الذى يحبه مادام مفيدا.

إمنعيه من تناول الحلوى أو أى طعام آخر قبل ميعاد الطعام بساعتين.

وإليكى بعض النصائح لفتح شهية الطفل:

أولا: حاولى أختى العزيزة أن تصنعى أكل الطفل من طبقات أو ألوان مختلفة فاستخدمي مثلاً الخضراوات كالجزر و البازلاء أو الفواكة كالفراولة و العنب و البرتقال وغيرها ذات الألوان الزهية لكي يبدو الطعام قريباً من شكل الحلوى.

ثانيا: لا تعطيه لبنا قبل الأكل.. فإنه يقوم بملء المعدة.. و تقليل الشهيةوهذى من العادات الخاطئة.

ثالثا: حاولى أن تدعيه يساعدك فى إعداد الطعام.. كأن يقوم بإحضار الخضراوات من الثلاجة.. أو أن يقوم بتقشير البيض.. فقد أثبتت الدراسات أن الطفل يحب أن يأكل من صنع يده.

رابعا: جنبيه الأكل أمام التليفزيون أو الكمبيوتر, لأن ذلك قد يؤدى إلى تقليل الشهية أو إلى الإفراط فى الأكل المؤدى للسمنه


* البصل والعسل يساعدان على فتح الشهية...


وإليكى نصيحة هامة وهى : تزيين أغذية الطفل بطريقة ملفتة ومشجعة على الأكل وهى أحد الطرق اليابانية لفتح شهية الطفل...

nosa_aic
15 - 02 - 2012, 04:55
ارتفاع درجة حرارة الرضع و الأطفال ( الحمى )

الحمى هي ارتفاع درجة حرارة الجسم فوق الحد الطبيعي .
وفي الرضع و الأطفال تعتبر درجة الحرارة الشرجية التي تساوي 38.9 ˚م أو أقل ، أو درجة الحرارة الفمية التي تستوي 37.3 ˚م أو أقل طبيعية .
والدرجات التي تزيد عن هذا هي فقط التي تشكل ما يسمى الحمى .
يجب أن تعلمين أيتها الام أن حرارة الانسان تتغير حتى عندما يكون في حالة جيدة ،فقد تزيد أو تنقص ، وهذا التغير هو أمر طبيعي ، ففي الصباح تكون درجة حرارة المرء أقل عمومآ وتزيد بعد الظهر

لا تعتبر الحمى مرضآ بحد ذاتها ، بل هي إشارة إلى وجود مرض في اغلب الاحيان ، فإرتفاع الحرارة يشير إلى ان أمرآ يحدث داخل الجسد .


اسباب الحمى :


- على الارجح يكون الجسد في صراع مع التهاب ناتج عن البكتريا أو الفيروسات ، وقد تساهم الحرارة في القضاء على الفيروس ( الحمى هي جزء من الطريقة التي يكافح بها جهاز المناعة بالجسم حالات العدوى مثل الانفلونزا أو نزلة البرد الشديد أو حالة عدوى بالأذن )
- ردة فعل تجاه عقار طبي أو اللقاح
- ضربة الحر
- مرض تم التقاطه
- التهاب معين ، كالتهاب جهاز البول ( وذلك يتمثل بتبويل متكرر أو مؤلم ) ، التهاب اللوزتين ( وغالبآ ما يترافق مع التهاب في الحلق ) ، التهاب الجيب ( ألم فوق العين أو تحتهما ) أو خراج في الاسنان ( يتمثل بمتطقة رقيقة في الفم ) ، التهاب الاذن الوسطى (نوبات الحمى المرافقة بشد الاذنين )
- قد تصاحب الحمى أحيانآ نمو الأسنان


الاعراض :


تتمثل اعراض الحمى بما يلي:-

الطفل المصاب بالحمى غالبآ ما تكون جبهته دافئة ، ووجهه متوردآ ، ويعاني القشعريرة ويبدو مرتعشآ ، وحينما تكونين في شك ، فالافضل لك أن تحصلي على قراءة دقيقة لدرجة الحرارة باستخدام ترمومتر طبي .


العلاج :


قد يصف لك الطبيب ادوية مخفضة للحمى مثل الاسيتامينوفين ( الباراسيتامول ) أو الايبوبروفين ، ويجب عدم اعطاء الاسبرين لمن هم دون سن 21 سنة لأنه يمكن أن يسبب متلازمة ري أو فيروس رايز إن هو اعطي في حالة التهاب فيروسي

قد يصف الطبيب تحاميل شرجية لخفض الحرارة تستخدم كل 8 ساعات
من الاسهل عادة اعطاء الاطفال ادوية سائلة ، فالنسبة للاطفال ، استعمل قطارة مرقمة واقطر الدواء في زواية الفم الخلفية

وتأكدي من ابتاعك لتعليمات الطبيب فيما يتعلق بنوع الدواء وجرعته ، والادوية تخفض درجة حرارة الطفل ، وغالبآ ما تجعل الطفل يشعر بتحسن ، ولكنها مجرد مسكنات فهي لا تعالج سبب حالة العدوى التي قد تكون هي سبب الحمى ولا تشفي تلك الحالة .


نصائح لخفض حرارة الطفل في المنزل :


ثمة نصائح أخرى لتبريد الحمى متوسطة الشدة ( أقل من 39˚م ) ويمكن أن تكون بديلآ قويآ عن الادوية المسكنة :

- لا تحاولي على الفور خفض حرارة الطفل بإستخدام الادوية ، إذ من شأنه أن يخفي الاعراض ، ممدآ فترة المرض ومعيقآ تحديد السبب
- اجعلي طفلك يرتدي ملابس خفيفة نوعآ ما ، مع جعل درجة حرارة الغرفة تميل للبرودة المعتدلة
- يمكنك تشطيف طفلك داخل حمام دافيء بالماء الفاتر
- تأكدي أن طفلك يشرب الكثير من السوائل مثل الماء أو العصير تجنبآ للجفاف ، لأن الجسد يفقد كمية أكبر من الماء في حالة الحمى

nosa_aic
15 - 02 - 2012, 08:58
الفرق بين غيبوبة زيادة السكر وغيبوبة نقص السكر




غيبوبة زيادة السكر:

1-التنفس سريع.

2-النبض سريع وضعيف.

3-رائحة الفم: اسيتون.

4- الجلد الجاف





غيبوبة نقص السكر:

1-التنفس طبيعى.

2-النبض سريع وقوى.

3- رائحة الفم عادية

4- الجلد مبلل

nosa_aic
15 - 02 - 2012, 09:37
الطريقة الصحيحه والسليمة لغسل الأسنان بالصور


غسل الأسنان من الأشياء المهمة اليومية التي نقوم بها للمحافظة على سلامتها.لكن لو كانت طريقة الغسل غير صحيحة فبالتالي غير صحية ويمكن أن ينجر عنه عدة مشاكل.

كثير من الناس يجهلون الطريقة السليمة لفرش الأسنان، ولهذا إسمحن لي بتقديم الطريقة المثلى التي ستساعدك إن شاء الله على الحصول على لثة جميلة في صحة جيدة وتجعل أسنانك نظيفة وناعمة.


التنظيف اليومي يجب أن يكون في معدل 3 دقائق، مرتين إلى ثلاث مرات في اليوم الواحد.




1- غسل الأسنان السفلية والعلوية كل على حدة.


2- تنظيف الأسطح الخارجيه للأسنان .

توضع الفرشاه وعليها المعجون على الضرس الأخير من الفك ملامسه اللثه بزاويه 45 درجه.

نبدأ التنظيف بحركه دائريه للفرشاة http://im11.gulfup.com/2012-02-03/1328301378792.gif (http://forum.sedty.com/)

من اللثه للأسنان اى من أعلى إلى أسفل بالنسبه للأسنان العلويه ومن أسفل الى أعلى بالنسبه للأسنان السفليه فى إتجاه واحد فقط دون الرجوع إلى اللثه مره أخرى لتجنب الإحتكاك باللثه فى الإتجاه المضاد مما قد يؤدى الى إنحصار اللثه عن الأسنان بمرور الوقت.

http://im11.gulfup.com/2012-02-03/1328301378833.jpg (http://forum.sedty.com/)http://im15.gulfup.com/2012-02-03/1328301719621.jpg (http://forum.sedty.com/)


نقوم بهذه الحركه على نفس المكان عدة مرات 2 – 3 أسنان فى كل مره ثم ننتقل إلى باقى الأضراس ثم الأسنان حتى نصل إلى أخر ضرس فى الفك و كذالك بالنسبه إلى الفك الأخر .



3- تنظيف الأسطح الداخليه:

نمسك الفرشاه بشكل عمودى و ننظف الأسنان العلويه بحركة سحب من أعلى الى أسفل بواسطة مقدمة الفرشاه و الأسنان السفليه من أسفل الى أعلى .

http://im11.gulfup.com/2012-02-03/1328301378184.jpg (http://forum.sedty.com/)


4- تنظيف السطح الطاحن

توضع الفرشاه على السطح الطاحن للأسنان و نحركها إلى الأمام و إلى الخلف

http://im11.gulfup.com/2012-02-03/1328301378235.jpg (http://forum.sedty.com/)





5- تنظيف اللسان

ينظف اللسان بتحريك الفرشاه من الخلف إلى الأمام لازالة بقايا الطعام و إزالة الطبقه الجرثوميه التى تسبب الرائحه الكريهه للفم .


http://im11.gulfup.com/2012-02-03/1328301379156.jpg (http://forum.sedty.com/)


6- إستعمال الخيط الطبى


إستعمال الخيط الطبى يومياً يعمل على إزالة بقايا الطعام و يمنع تكون الطبقه الجيريه بين الأسنان .
· نقطع حوالى 40 سم من الخيط ثم نلف معظمه حول الإصبع الأوسط لاحدى اليدين و بعض سنتيمترات حول الإصبع الأوسط لليد الأخرى .
· نمسك الخيط بإصبعى السبابه و الأبهام تاركين ما يقرب من 3 سم بينهم .
· ندخل الخيط بلطف بين الأسنان .

http://im11.gulfup.com/2012-02-03/1328301379387.jpg (http://forum.sedty.com/)


· نجعل الخيط على شكل منحنى على سطح كل سنه و حركه إلى أعلى و أسفل مع إحتكاكه بجانب
كل سنه لتزيل بقايا الطعام .
· عندما يصبح الخيط غير نظيف يتم تحرير جزء من الخيط الملفوف حول الإصبع الأوسط للحصول
على جزء أخر نظيف حتى تنتهى من عملية التنظيف .

http://im11.gulfup.com/2012-02-03/1328301379448.jpg (http://forum.sedty.com/)




http://im11.gulfup.com/2012-02-03/1328301379869.jpg (http://forum.sedty.com/)

ابو مالك
16 - 02 - 2012, 08:09
كيف تتخلص من الصداع بدون أدوية


الصداع يأتي نتيجة مرض آخر أو قصور في بعض الوظائف وغالباً ما تكون الجيوب الأنفية أو النظر، لذا فحين يصيبك الصداع فالأفضل أن تلجأ للوسائل الطبيعية، هذه بعض الحيل التي توصلت إليها “الأكاديمية الأميركية لطب الأعصاب” لعلاج الصداع.

1) الإكثار من شرب الماء
يعد الجفاف من أهم أسباب الإصابة بالصداع، لذا يجب عليك تناول الماء من وقت لآخر. وعند الشعور بالصداع يجب عليك شرب الماء ببطء. كما يجب عليك عند القيام بذلك أن تتجنب القيام بأية حركة جسدية حتى يختفي الصداع.

2) ابتعد عن جهاز الكمبيوتر
يؤدي الإشعاع الذي يصدر من جهاز الكمبيوتر إلى الشعور بالألم في رأسك. لذا يجب عليك الابتعاد لفترة من الوقت عن هذا الجهاز وخاصة عند الإصابة بالصداع والذهاب خارج حجرتك لاستنشاق هواءً جديداً.

3) التنفس البطيء
قم بإغلاق عينيك لكي تساعد عضلاتها على الاسترخاء، ثم قم بعملية الشهيق والزفير ببطء شديد كي تريح أعصابك .

4) تناول الشاي بالليمون
قم بتناول كوباً من الشاي مضافاً إليه عصير الليمون الدافئ ببطء، فهو يساعد على التخلص من الصداع.

5) تناول الحساء الساخن
قم بتناول الحساء الساخن ثم بعد ذلك حاول الاسترخاء والحصول على قسط من النوم وخاصة في حجرة ذات ضوء خافت.

6) النقع في الماء الدافئ
لكي تحصل على عقل هادئ وخالي من الصداع، يمكنك القيام بنقع نفسك في حوض من المياه الدافئة.

7) قم بعمل مساج لأنفك
استخدم السبابة والإبهام للضغط على أنفك بلطف ثم على صدغيك لتحصل على مساج يساعدك على التخلص من الألم.

8 ) قم باستخدام الكمادة على رأسك
يمكنك استخدام قطعة من القماش الناعم أو منشفة مبللة بالماء البارد ووضعها على الجزء الخلفي من الرأس والرقبة لأنها تُساعد على الاسترخاء والتقليل من الألم.

9) ممارسة تمارين التأمل
عند الإصابة بالصداع يمكنك الاسترخاء وممارسة تمارين التأمل وذلك بإغماض عينيك ثم أخذ نفس عميق من الزفير وحبسه في رئتيك لمدة خمس ثوان ثم إطلاقه بعد ذلك ببطء شديد، قم في هذه الأثناء بتذكر الأشياء الممتعة والتي تبعث على السعادة للإقلال من التوتر الذي يصيب عضلات الوجه وكل عضلات الجسم الأخرى.

nosa_aic
16 - 02 - 2012, 19:06
دراسة:استنشاق روائح الورد يقوى الذاكرة (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/162591-%D8%AF%D8%B1%D8%A7%D8%B3%D8%A9-%D8%A7%D8%B3%D8%AA%D9%86%D8%B4%D8%A7%D9%82-%D8%B1%D9%88%D8%A7%D8%A6%D8%AD-%D8%A7%D9%84%D9%88%D8%B1%D8%AF-%D9%8A%D9%82%D9%88%D9%89-%D8%A7%D9%84%D8%B0%D8%A7%D9%83%D8%B1%D8%A9)



http://www.alwafd.org/images/news/430169470zigzuegr.jpg




أجرى مجموعة من الباحثين الألمان دراسة علمية حديثة أثبتت أن إستنشاق عبير الورود له تأثير كبير على الذاكرة البشرية خاصة أثناء النوم ، وذلك طبقا لما ورد في دورية " نيتشر " العلمية على شبكة الإنترنت.
وخضع للدراسة التي أجراها فريق من أطباء الأعصاب من جامعة ( لوبيك الألمانية ) ومركز هامبورج ابيندورف الطبي مجموعة من طلاب كلية الطب ، الذين تم تعريضهم لبعض الصور المعلقة في أحد الميادين ثم خضع نصف المجموعة لرائحة قبل النوم وأثناؤه ، بينما لم يتعرض النصف الأخر من العينة للرائحة أثناء النوم .
وتم قياس النتائج في اليوم التالي، حيث وجد الباحثون أن المجموعة التي استنشقت رائحة الورد أثناء النوم ، تذكرت 97 فى المائة منهم أماكن الصور، بينما تذكرت بقية المجموعة 86 فى المائة فقط .
وكانت الدراسات التي أجريت في ثمانينيات وتسعينيات القرن الماضى قد أثبتت أن التعرض لبعض الأصوات أثناء النوم قد يساعد في تعزيز الذاكرة.

nosa_aic
16 - 02 - 2012, 19:33
الجرجير كنز من كنوز الخضروات



http://www.elfagr.org/Portal_News/Big/1754532011710837.jpg (http://www.dlu3at.net/vb/article48101.html)

أصبح الجرجير نباتًا شعبيًا يزرع بكثرة الآن لاستخدامه في المطاعم والسلطة وغير ذلك،إلا أن له فوائد عظي...
أصبح الجرجير نباتًا شعبيًا يزرع بكثرة الآن لاستخدامه في المطاعم والسلطة وغير ذلك،


إلا أن له فوائد عظيمة؛

فهو يساعد على الهضم، وينقي الدم، وينشط، ويقوي، ويفتح الشهية،

ويدر البول، ويحرك الرغبة الجنسية، ويزيد المني، ويستخدم عصير الجرجير

للتخلص من النمش والآثار السود بالوجه، ولتقوية الشعر.

كما أنه مفيد في إفراز الصفراء، وفي حالات نقص فيتامين c وفي آلام الروماتيزم

و الجرجير عشب حولي بقلي أوراقه مستطيلة مفصصة بعمق، حرّيفة لذاعة.

ساقه طويلة تعلو ما بين 15 – 30 سم تقريبًا،

متفرعة، تحمل أوراقًا متتابعة، ملساء، لونها أخضر غامق، غزيرة العصارة،

ملمسها غير رقيق، وهي أقرب إلى نبات السبانخ.

أما الأزهار فتكون في رأس النبات، بيضاء صغيرة تتخللها عروق بنفسجية دقيقة،

أو صفراء تنعقد بذورًا في غلف طولية شبيهة ببذور الخردل.

يكثر الجرجير في أماكن الجداول والمناقع المائية، وهو بري وبستاني،

ويسميه أهل الشام بـقرة العين،

كما يسمى بالتركية روكا ومن أسمائه الأخرى بقلة عائشة، أيهقان

http://www.ghawyy.com/forum/images/imgcache/2010/02/326.jpg (http://www.dlu3at.net/vb/article48101.html)

ومن مواده الفعالة الأملاح المعدنية مثل الفوسفور، اليود، الكبريت،

الحديد، الكالسيوم، ومادة خردلية لاذعة، ومواد مرة، وفيتامينات مثل ( أ ، ج ، ث ، سي ) .

من فوائد واستخدامات الجرجير:

لإدرار البول:

يغلى مقدار ثلاث حفنات من الجرجير مع بصلة كبيرة بيضاء في لتر ونصف لتر من الماء،

ويستمر في الغلي حتى يبقى ثلثه، وبعد تصفيته يشرب وهو فاتر

بمقدار نصف فنجان قهوة صباحًا ونصفه مساء قبل النوم.

لوقف نزيف اللثة:

يعالج نزيف اللثة بمضغ أوراق الجرجير المنقوعة بالخل.

تخفيض نسبة السكر :

أكل الجرجيرمع السلطة يساعد على تخفيض نسبة السكر لدى المصابين بالسكري؛

حيث يعمل على إبطاء امتصاص السكر في الأمعاء.

مرهم الجرجيرلمداواة الحروق:

ـ تدق كمية من الجرجيرمع بصلة متوسطة الحجم وكمية من ورق توت الأرض ( فريز – فراولة )

وتطبخ بزيت كتان، ويصفى بعد ذلك الزيت وتدهن به الحروق

ـ تدق كمية من أوراق الجرجيروتصنع بشكل لبخة وتوضع على

الدمامل والكلوم والسحجات فتطهرها وتسرع في إدمالها وشفائها .


الجرجير يساعد على تنظيف الصدر من البلغم، لذا يوصى بأكله.



يوصى باستعمال عصير الجرجيرلمن يصاب بأعراض التسمم بالنيكوتين، الناتج عن الإفراط في التدخين
http://health.sabayagazine.com/wp-content/uploads/2010/08/5963.imgcache.jpg (http://www.dlu3at.net/vb/article48101.html)


عصيرالجرجيرعلاج ناجع لتنقية الدم، مما يساعد على التخلص من البثور في الجسم.



الجرجير يؤكل بكميات معتدلة فيساعد على إدرار الصفراء والتخلص من الانصبابات أو التجمعات المائية المرضية في الجسم

أوزيما – انصباب .



الجرجير يساعد على إدرار الحيض – الطمث – ولذا تتجنبه الحامل.



الجرجير يساعد على تنشيط الجسم وتقويته في حالات الوهن وهبوط القوى،

ولإثارة الرغبة الجنسية لدى الجنسين، ولذلك تسحق البذور وتخلط بعسل النحل وتؤخذ ملعقة
كبيرة يوميًا لمدة لا تقل عن أسبوع.

الإفراط في تناول الجرجير


غير صحي، ويسبب اضطراب الهضم وحرقة في المثانة والبول،

ويوصى بعدم تناوله من قبل المصابين بتضخم الغدة الدرقية والحوامل.

nosa_aic
16 - 02 - 2012, 19:40
5 محاذير عند علاج الحروق



1- عدم وضع المراهم أو الزيوت أو معجون تنظيف الأسنان أو الزبد أو البيض على الحروق، فهذا قد يمنع تسرب الحرارة من الجلد ويعمل على تحويل درجة الحرق لدرجة أعلى.

2-عدم وضع الثلج مباشرة على الجلد، لأن ذلك يحدث حرق ثلجى وتلف لخلايا الجلد.

3- عدم وضع قطن كغطاء على المكان المصاب مباشرة، لأنه قد يلتصق القطن بالجلد المصاب.
4- عدم محاولة إزالة الملابس الملتصقة بالجلد أو قصها من أطرافها، لأنها قد تسبب بتمزق الجلد لالتصاقها بالملابس.-

5- عدم محاولة تنظيف الحروق أو فتح البثور والفقاعات، حيث يسبب ذلك تلوث الحروق وتعميق أثر الحرق.

nosa_aic
17 - 02 - 2012, 12:34
المهدئات والمنومات SEDATIVES AND HYPNOTICS


كثيراً ما نسمع أن شخصاً ما يعاني من أزمة نفسية وانه راجع الطبيب فوصف له دواء مهدئاً
كذلك نسمع في حياتنا اليومية او برامج التلفاز عبارة " كأنما تناول دواء منوماً "
فما هو المهدي الدواء ؟؟؟؟؟
وما الدواء المنوم ؟؟؟؟؟؟؟؟؟
وهل يقتصر استعمالها على من يعاني ازمة او مشكلة تؤرقه ؟؟؟

تعمل المهدئات والمنومات على تثبيط عمل بعض المراكز في الجهاز العصبي المركزي وتضم هذه مجموعتين رئيستين الاولى
المهدئات والمنومات الباربيتوية
والثانية
المهدئات الصغرى ( مزيلات القلق )

الدواء المهدئ هو الدواء الذي يسبب حالة من الهدوء المصحوب بالاسترخاء والراحة دون احداث النوم ويستخدم للتقليل من التوتر والقلق .
الدواء المنوم هو الذي يسبب نوماً هادئاً شبيهاً بالنوم الطبيعي
ويستخدم للاشخاص المصابين بألارق الناتج من اسباب غير عضوية

ومن ادوية المهدئات والمنومات الباربيتوية
PHENOBARITONE
AMYLLOBARBITONE
SECOBARBITAL
THIOPENTONE

تستعمل هذه الادوية كمنومات في حالات الارق المختلفة
وكمهدئات في حالات التوتر والقلق والضغط النفسي
كما تستخدم للاختلاج في حالات الصرع والكزاز

ومن تأثيرات الجانبية لهذه الادوية
الغثيان - والقياء - وتحسس الجلد - وانخفاض ضغط الدم .

ومن مهدئات الصغرى مزيلات القلق
Diazepam
Nitrazepam
Chlordiazepoxiiide

تستعمل حالات القلق والتوتر وكذلك التهدئة المريض قبل العملية
كمرخ للعضلات كمضاد للصرع والكزاز

تأثيراته الجانبية
الغثيان - القياء - الانحطاط العام والصداع

nosa_aic
17 - 02 - 2012, 12:45
خطر البالونات على الاطفال


تسجيل نسبة مرتفعة من المواد السامة في لعاب أطفال و خصوصا بعد نفخهم للبالونات بالفم

حذرت وزارة الزراعة الألمانية من خطر بالونات الهواء على الأطفال بعد أن كشف خبراؤها ( وجود مواد تسبب السرطان في هذه البلونات)

وذكر متحدث باسم الوزارة أن الخبراء الصحيين فحصوا عينات من لعاب أطفال وخاصتا بعد نفخهم لهذه البالونات بالفم , فتوصلوا إلى وجود ( نسبة مرتفعة من المواد السامة في 13 عينة من أصل 14 عينة تم فحصها ) ... ويمكن لمادة « أن نيتروزاماين » Nitrosamine N السامة والمتطايرة أن تتسرب إلى الهواء مباشرة لتستقر في الرئتين ، أو أن تذوب في اللعاب من خلال نفخ البالون وهي الخطورة الأساسية .

وأثبتت الفحوصات المختبرية أن تركيز مادة ان نيتروزاماين المصنفة كمادة مهيجة للسرطان ( يكون أعلى وأخطر في حالة الأطفال الصغار ) الذي قد يمصون البالون أو يمضغونه في الفم ... وقال المصدر أيضا أن خبراء الوزارة أجروا فحصا مماثلا على البالونات عام 2001 وقد أرسلت الوزارة رسائل توصية إلى الشركات لتقليل نسبة Nitrosamine N ... إلا أن شركات صناعةالبالونات لم تتقيد بتلك التوصيات .


وعلى عكس البالونات أثبتت الفحوصات التي أجريت على( المصاصات والعضاضات التي يستخدمها الأطفال ) أن الشركات المصنعة قد التزمت بالحد الأقصى لوجود مادة « ان نيتروزاماين » في المادة البلاستيكية .

وأوصى الخبراء بضرورة ( إستخدام أجهزة النفخ بدلا من الفم في نفخ البالونات)

كما نصحوا العائلات بعدم السماح للأطفال بوضع البالونات غير المنفوخة لفترة طويلة في أفواههم ... وأن لا تتعرض البالونات لضوء مباشر لفترة طويلة قبل إستخدامها .. كما ينبغي حفظها في أماكن غير حارة.

nosa_aic
17 - 02 - 2012, 16:55
4 نصائح تقلل اصابتك بالصداع

[/URL]

[URL="http://www.dlu3at.net/vb/article57724.html"]http://l.yimg.com/os/401/2012/02/14/110938096-jpg_103909.jpg (http://www.dlu3at.net/vb/article57724.html)
يعتبر الصداع مشكلة صحية شائعة بين كثير من الناس. ويمكن أن يكون في أي وقت من اليوم, الصداع هو نتيجة لأسباب عديدة مثل الإجهاد، ، وقلة النوم والصداع النصفي. لذلك إليك أكثر4 عادات لعلاج الصداع .

القهوة: تعتبر من إحدى الأدوية الأكثر شيوعا التي يستخدمها الناس لعلاج الصداع., وتعتبر القهوة كدواء لأنه يحفز الجهاز العصبي المركزي وحتى بعد طرد السوائل من خلال البول، فسيتمر تأثيرها لمدة أكثر من 5 ساعات, ولكن الكثير من القهوة يؤدي أيضا إلى الجفاف وتعتبر القهوة هي واحدة من العادات السيئة لتخفيف الصداع.

الشاي: وهو من أكثر الأعشاب شيوعا بين الناس الذين يعملون. ولكن عليك استخدام شاي الأعشاب ويستهلك الشاي الأخضر خصوصا، شاي البابونج أو الشاي بالقرفة, ولكنه يمكن أن يضر الجسم ويسبب عسر هضم .

الشوكولاتة: وهي أيضا من العادات الأكثر شيوعا لتخفيف الصداع و يستخدمها كثير من الناس خصوصا النساء وبالأخص الشوكولاتة الداكنة لعلاج الصداع, ولكن استهلاك الكثير من الشوكولاته يمكن أن يزيد من الصداع

الجوز: وهو صحي جدا وبالتالي فهو عادة جيدة, حيث يحتوي الجوز تحتوي على الأحماض الدهنية التي تبقيك نشطة وتوفر وتبعدك عن الاكتئاب والصداع. ومع ذلك، يمكن أن يؤدي الكثير من الجوز إلى عسر هضم وزيادة بالوزن.

nosa_aic
19 - 02 - 2012, 19:32
الوقت و علاقته بأعضاء الجسم


عند إتباع النظام الغذائى المتوازن فى أوقات محددة ومواعيد منتظمة يساعد ذلك الجسم على التخلص من الكيماويات والسموم الموجودة به.

من الساعة 9 – 11 مساءا
هذا الوقت الذى يتم فيه التخلص من السموم الزائدة فى الجهاز اللمفاوى
لذلك فإن هذا الوقت يجب تمضيته فى هدوء.




http://www.pickthebrain.com/blog/wp-content/uploads/2008/08/great-sleep.jpg (http://www.dlu3at.net/vb/article53495.html)



فإذا كانت ربة المنزل لا زالت تعمل فى أعمال المنزل أو فى متابعة الأبناء فى أداء واجباتهم المدرسية
فإن ذلك سيكون له تأثير سلبى على صحتها.


من الساعة 11 مساءا – 1 صباحا
فذلك ميعاد تخلص الكبد من السموم ويكون هذا الوقت المثالى للنوم العميق.
من الساعة 1 – 3 صباحا
فذلك ميعاد تخلص المرارة من السموم وأيضا يكون وقت مثالى للنوم العميق.


من الساعة 3 – 5 صباحا
فذلك ميعاد تخلص الرئة من السموم
http://magazine.msharkat.com/wp-content/uploads/2011/01/lung2.png (http://www.dlu3at.net/vb/article53495.html)
ولذلك سنجد أن المريض الذى يعانى من السعال
فإنه سوف يعانى أكثر فى هذا الوقت
والسبب فى ذلك أن عملية التخلص من السموم قد بدأت فى الجهاز التنفسى فلا داعى لتناول دواء لإيقاف أو تهدئة السعال فى هذا الوقت وذلك لمنع التدخل فى عملية تخلص الرئة من السموم الموجودة بها

وهنا ننصح المدخنين أن لا يقوموا بالتدخين فى هذا الوقت لأن ذلك يمنع أيضا عملية التصريف للسموم عن طريق إضافة سموم جديدة بدلا من تصريف القديم.



الساعة 5 صباحا
فذلك ميعاد تخلص القولون من السموم
http://forum.z88z.com/pic/z88z_pic_1313867012_729.jpg (http://www.dlu3at.net/vb/article53495.html)
لذلك يجب التبول فى مثل هدا الوقت لتفريغ المثانة لمساعدة القولون على التخلص من السموم


وهنا ننصح الأشخاص الذين يعانون من الإمساك المزمن أن يواظبوا على الأستيقاظ فى هذا الوقت (5 صباحا) لكى يساعدوا القولون على العمل والتصريف.
وفى خلال عدة أيام سينتهى الإمساك المزمن مع ضرورة الإلتزام أيضا بالغذاء المتوازن.



الساعة 7 – 9 صباحا
فذلك ميعاد إمتصاص الغذاء فى الأمعاء الدقيقة

فيجب أن يتم تناول وجبة الإفطار فى هذا الوقت.
أما المرضى الذين يعانون من الإنيميا ونقص الهيموجلوبين فى الدم فيجب أن يتناولوا وجبة الإفطار قبل الساعة 6.30 صباحا


أما من يرغب فى المحافظة على سلامة جسمه وعقله
يجب أن يتناول وجبة إفطاره قبل الساعة 7.30 صباحا


والأشخاص الذين لا يتناولون وجبة الإفطار وتعودوا على ذلك يجب أن يغيروا عاداتهم لأن ذلك من أهم أسباب تلف الكبد.
والتأخر فى تناول وجبة الإفطار حتى الساعة 9 – 10 صباحا أفضل من عدم تناولها على الإطلاق.



من منتصف الليل – 4 صباحا
هو الوقت الذى ينتج فيه النخاع العظمى خلايا الدم
http://www.love-m.com/upload/uploads/images/lovem-19e018072e.jpg (http://www.dlu3at.net/vb/article53495.html)
لذلك يجب أن ننام مبكرا ... وننام جيدا وبعمق.


إن النوم المتأخر والإستيقاظ المتأخر يعملان على تعطيل الجسم من التخلص من السموم الموجودة به

nosa_aic
19 - 02 - 2012, 20:11
الزبادي خزانة الدواء الطبيعي

يعتبر الزبادي من أشهر وأشهى المنتجات اللبنية بكافة أنحاء العالم، ويعرف الزبادي بأن له قيمة غذائية عالية، ويتم تحضير الزبادي من لبن متخمر باستعمال سلالات معينة من البكتيريا الحية.
ويعتبر الزبادي أحد الأغذية الأسطورية على مر العصور، وقد استعمله سكان حوض البحر الأبيض المتوسط لقرون عديدة لوقايتهم من الإسهال ولعلاج اضطرابات الأمعاء الأخرى.
وأدت التجارب التي أجراها اختصاصيو الميكروبيولوجي وبخاصة العالم الدكتور إلياس متشنكوف إلى تربع الزبادي على عرش التراث الغذائي الحديث، حيث أعلن متشنكوف أن الزبادي دواء عام لأمراض القلب والخرف والتدهور العام للجسم.
وفي القرن العشرين خضع الزبادي لفحصٍ علميٍ دقيقٍ واتضح أنه علاج متعدد الجوانب.
وتعزى منافعه إلى نشاطه الهائل بالقناة الهضمية، ويتميز الزبادي بما يحتويه من بكتيريا تسمى بـ(اللاكتوباسيلاس) وهي التي تسبب التخمر ومن ثم مذاقه الحامضي، وتعتمد القوى العلاجية للزبادي على نوع البكتيريا الموجودة به، وحيث إن ما كتب في هذا الموضوع يتناوله من الناحية التكنولوجية أو الغذائية فقط، لذا رأيت أن أتناوله من الناحية الصحية.

الفوائد العلاجية للزبادي:

للزبادي فوائد علاجيه كثيرة ومهمة يمكن استعراضها بإيجاز فيما يأتي:-
- يقتل البكتيريا
- يمنع ويعالج العدوى المعوية ومن بينها الإسهال
- يخفض الكوليسترول الضار بالدم


- يزيد من قوة الجهاز المناعي للجسم
- يحسن وظائف الأمعاء
- يحتوي على مواد تمنع الإصابة بالقرح
- يقي من الإصابة بالسرطان

• الزبادي والإسهال:

تعتبر القناة الهضمية ميدان قتال شرس للبكتيريا، وتساعد أي ميكروبات على كسب المعركة البكتيرية في القولون وتحديد حالة الهضم والتخلص من الفضلات والصحة العامة والاضطرابات في القناة الهضمية التي يسببها النشاط الزائد لأنواع معينة من البكتيريا وبخاصة (الاشريشيا كولاي) في الرضع التي يمكن أن تؤدي إلى الإصابة بالإسهال.
ويمكن لقدر أكبر من بكتيريا (اللاكتوباسيلاس) بالزبادي أن تضيف قدراً كافياً من الكائنات الدقيقة المفيدة لقهر الأنواع الضارة بالصحة ويعود ذلك بالنفع على النشاط الهضمي.
ويوضح ذلك إلى أي مدى يستطيع الزبادي أن يحقق وظيفتين متعارضتين وهما:
يخفف من الإسهال ويعمل كملين في آنٍ واحد، حيث يعيد الزبادي التوازن الميكروبي الطبيعي للقناة المعوية، ويقرر عدد من الباحثين أن تناول قدر قليل من الزبادي يساعد على شفاء الاضطرابات المعوية التي يسببها التسمم الغذائي وعوامل العدوى.

• الزبادي مضادات حيوية طبيعية:


يعتبر كوباً من الزبادي كبسولة من المضادات الحيوية الطبيعية؛ فقد اتضح من البحوث التي أجريت في شتى أنحاء العالم أن بكتيريا الزبادي النشطة ونواتجها التي تنطلق بالقناة المعوية ما هي إلا مضادات حيوية طبيعية واسعة المجال.
وقد أمكن للعلماء فصل سبعة من المضادات الحيوية الطبيعية من الزبادي والألبان المتخمرة الأخرى ولبعضها القدرة على قتل البكتيريا بدرجة مساوية أو أكبر من المضادات الحيوية الصيدلانية مثل (التيراميسين)، علاوة على ذلك فإن وجود بكتيريا الزبادي بالأمعاء يزيد من فعالية المواد الكيماوية الأخرى التي تقاوم البكتيريا التي يمكن أن تسبب المرض للمعدة، والإسهال وبخاصة إسهال الرضع.
والمثير للدهشة أيضاً أن الأطفال الذين يتغذون على الزبادي تزيد مقاومتهم للعدوى بالإنفلونزا.
واتضح من العديد من الأبحاث التي أجريت في اليابان وإيطاليا وسويسرا والولايات المتحدة أن الزبادي يقوي المناعة في الحيوانات والإنسان على حد سواء حيث يؤدي إلى تكوين أجسام مناعية أكثر والخلايا القاتلة المسببة للأمراض ومواد مضادة للمرض، لذا فإن الزبادي يمكن أن يقاوم المرض بآليتين مميزتين وهما قتل البكتيريا وتقوية الجهاز المناعي.

• الزبادي عامل مضاد للسرطان:


هناك أدلة قوية تزداد قوتها يوماً بعد يوم على أن الزبادي يساعد على الوقاية من السرطان وبخاصة سرطان القولون، فقد اتضح خلال الربع الأخير من هذا القرن أن الزبادي له عدة خواص تجعله يقاوم السرطان، وهناك أدلة قوية على أن البشر الذين يتناولون قدراً أكبر من الزبادي أقل عرضة للإصابة بالسرطان.
كما اتضح من بعض الدراسات أن النساء اللاتي تناولن كمية كبيرة من الدهن مصدرها الجبن ازدادت مخاطر تعرضهن للإصابة بسرطان الثدي بينما كان خطر الإصابة أقل في نظرائهم الذين كانت كميات الدهون التي يتناولنها مصدرها الزبادي.


• الزبادي مسكن للمعدة:

يوجد في الزبادي مواد هرمونية دهنية تسمى (بروستاجلاندينات e2) التي يعرف عنها أنها مضادة للقرح، كما تحمي أيضاً الغشاء المبطن لجدار المعدة من المواد الضارة مثل دخان السجائر والكحول.
ويحتوي الزبادي المصنوع من لبن كامل على تركيزات أعلى من (بروستاجلاندينات e) النشط بيولوجياً المماثل للعقار المضاد للقرح.
وقد أدى الزبادي في الاختبارات التي أجريت على البشر من ذوي المستوى الطبيعي للكوليسترول بالدم إلى خفض الكوليسترول الضار إلى درجة مدهشة بينما ارتفع مستوى الكوليسترول المفيد بدمائهم.


•الزبادي ويقظة المخ:
ينظر إلى الزبادي على أنه مسكن خفيف بسبب ما يحتويه من التربتوفان، وقد بينت الدراسات أن الزبادي يساعد بالفعل على إفراز المواد الكيميائية للمخ، وبالتالي يجعل المخ أكثر يقظة، ولذلك فإن الزبادي الخالي من الدهون أو المنخفض الدهون يعمل على بقاء المخ يقظاً.

• القدر المناسب من الزبادي:
لم تكن دراسات العلماء تنصب على فوائد الزبادي فحسب بل انصبت أيضاً على الكمية التي يمكن للإنسان تناولها لتحقق تلك النتائج، واتضح أن تناول ثلاثة أكواب من الزبادي يومياً يؤدي إلى خفض الكوليسترول الضار بالدم، أما تناول نصف كوب من الزبادي يومياً (الخالي من الدسم) فيؤدي إلى شفاء الرضع المصابين بالإسهال الحاد.

nosa_aic
19 - 02 - 2012, 20:16
دراسة : الكمبيوتر لا يؤثر على الأم الحامل أو الجنين


http://helwa.makcdn.com/Components/Tools/ExportImage.ashx?Url=aHR0cDovL2kxLm1ha2Nkbi5jb20vb TAwMi9IZWx3YUltYWdlcy9BcnRpY2xlcy9kMzVkYTI4My00OWQ 3LTQzNGUtODk3MC02YzYyODdmOTdhMDIvMS5qcGc/Um5kPTIzMTIz&Burl=aHR0cDovL2kxLm1ha2Nkbi5jb20vbTAwMi9IZWx3YUltY Wdlcy9IZWx3YVNlY3Rpb25zLzQwMDAvMi5qcGc/Um5kPTIzMTIz&Type=RC&W=258&H=217&BgColor=FFFFFF&Valign=M&Halign=C&AuthReq=f414520add9d856e947725c422f8cc61 (http://www.dlu3at.net/vb/article44306.html)

أكدت دراسة أمريكية حديثة بأنه لا يوجد أى ضرر أو خطر من الأشعة المنبعثة من شاشات الحاسب الآلى على الأم الحامل أو الجنين فالأشعة الصادرة من الحاسب الآلى أشعة مماثلة تماماً للأشعة التى تنبعث من أجهزة التلفاز العادية وأشارت الدراسة إلى أنة لا تنبعث من الحاسب الآلى أى أشعة سينية ضارة ولا توجد أى مخاطر تتعرض لها المرأة الحامل أو يتعرض لها الجنين من جراء الجلوس أمام أجهزة الكمبيوتر لكن على الأم الحامل أن تبتعد عن إرهاق العمل أمام شاشة الحاسب الآلى.

وأضافت الدراسة أن على الحامل تجنب الجلوس والعمل أمام الكمبيوتر لمدة طويلة مما يؤدى إلى سكون الرقبة فى حين تتحرك كلاً من اليدان والرسغان حركة محدودة نسبياً حيث يصبح هناك احتمال للإصابة ببعض المشاكل فى أربطة وعضلات الرقبة واليدين.

لهذا لا بد من أخذ قسط من الراحة بعد كل ساعة عمل فى الأوقات العادية وبشكل خاص فى فترة الحمل.وتنصح الدراسة الحامل بتجنب وضع ساق على أخرى أثناء الجلوس واختيار مقعد مريح يسند الظهر والساقين أثناء العمل وذلك للتقليل من التعب والصداع.

nosa_aic
21 - 02 - 2012, 19:21
لماذا نرتجف عند المرض

عندما يصاب الجسم بمرض يرفع درجة حرارة الجسم وتحدث

حالة معروفة هي الرغبة في المزيد من اغطية الفراش

وارتعاش الجسم الى حد اصطكاك الاسنان..


هذا الارتجاف او الارتعاش ينبع من جهاز حيوي يوصف بنظام

مراقبة "مناخ" الجسم يستقر في المخ واسمه(هيبوثلاموس)

وهو المحرك للرعشة فهذا الجزء من المخ اشبه بجهاز تنظيم

الحراره في الثلاجات **ترموستات** فهو يعمل على رفع الحرارة
اثناء الاصابة بغزو فيروسات كوسيلة لمقاومتها وعند اشتداد

الحمى يرسل اشارات لتتحرك كل عضلة في الجسم في صورة

ارتجاف شديد يساعد على حماية الاعضاء الداخلية للجسم.

وجهاز الاشراف على حرارة الجسم يعمل بطريقة معاكسة عند

اشتداد حرارة الجو المحيط بالجسم بدلا من الارتجاف يامر غدد

العرق في الجلد بزيادة نشاطها لتخفيف وطاة الحر..


ملاحظة اخرى :



هي ان الارتجاف يحدث ايضا اثناء الشعور بالخوف الشديد

عندما نواجه فجاة خطرا مباشر عندئد يتدفق هرمون الادرينالين


لمساعدة الجسم على مواجهة هذا الخطر بالقتال او الهروب .


..تمنياتي لكم بدوام الصحة والعافية..

nosa_aic
21 - 02 - 2012, 23:21
يعتقد الكثيرون أن اتباع أنظمة غذائية فقط لمن لديهم مشكلة فى الوزن ويرغبون إما فى فقد بعض الكيلوجرامات أو فى اكتسابها، ولكن الحقيق العلمية تؤكد أننا يجب اتباع نظام غذائى صحى متوازن من أجل الحفاظ على صحة مثالية.

تقدم لنا الدكتورة مها رداميس أخصائى التغذية العلاجية والأمراض الباطنية وعلاج السمنة وعضو الجمعية الأمريكية لعلاج السمنة وعضو الجمعية المصرية لدراسة السمنة، نموذجا لبرنامج صحى متوازن والذى يشتمل على خمس وجبات وهم:

الإفطار:

من أهم الوجبات التى لا يجب الاستغناء عنها لأنها تزيد من معدل الحرق.

ويمكن أن تشتمل على: خضروات خاصة الخضراء + عيش أسمر.

بعد الإفطار بساعتين:

فاكهة + زبادى منزوع الدسم

الغداء:

يجب أن يشتمل على كل العناصر الغذائية ولكن بكميات قليلة، كما أن الأطعمة المقلية يجب أن تكون ليوم واحد فقط فى الأسبوع وليشمل مثلا:

4 معالق من الارز + فنجان من الخصروات

بعد الغذائى بساعتين: تناول طبق سلاطة

العشاء:

يجب أن تكون وجبة العشاء خفيفة خاصة، وأن معدل الحرق لدى الإنسان يقل بعد الساعة الـ9 مساء، وأيضا كى يستريح الجهاز الهضمى الذى يعمل طوال اليوم، وليشمل العشاء طبق صغير من الفروت سلاط.

nosa_aic
22 - 02 - 2012, 18:14
الزبيب كنز عظيم

الزبيب هو العنب المجفف. وينتج في مناطق كثيرة من العالم، مثل الولايات المتحدة وأستراليا وتشيلي والأرجنتين والمكسيك واليونان وتركيا وإيران وتوغو وجامايكا وجنوب إفريقيا. يشكل 90% من وزن الزبيب السكريات.


و لقد اكتشف فريق طبي أمريكي أن ثمرة الزبيب غنية بخمسة مركبات كيميائية نباتية تعمل على مكافحة البكتيريا التي تسبب تسوس الأسنان والتهاب اللثة، بالإضافة إلى كونها مضادة للأكسدة وتمنع التصاق البكتيريا بسطح الفم؛ ما يحول دون تكوّن طبقة البلاك الجرثومية على الأسنان‏.‏


وجاء ذلك الاكتشاف ضمن فعاليات المؤتمر السنوي للجمعية
الأمريكية للأحياء الدقيقة الذي عقد الأسبوع الماضي بمدينة أتلانتا الأميركية.

بحسب ما أوردته "صحيفة الأهرام " الإلكترونية .

وبيّنت التحليلات المعملية، التي أجراها باحثون بجامعة لينوي بشيكاغو، أن الكيماويات ذات الأصل النباتي التي يحتويها الزبيب تمنع نمو عدد من أنواع بكتيريا الفم المسؤولة عن التسوس وأمراض اللثة.

وأظهرت التحاليل الكيميائية الروتينية وجود خمسة مركبات بالزبيب الخالي من البذور، وهي حمض أوليانوليك، أوليانيك ألدهيد، بيتولين، حمض بيتولينيك، ومادة 5–هيدروكسيميثيل – 2 – فورفورال.

وكل هذه الكيماويات النباتية هي مضادات للأكسدة موجودة في النباتات بشكل طبيعي.


ويمنع حمض أوليانوليك مثلاً نمو نوعين من البكتيريا المسببة لتسوس الأسنان ومحيطها، وهو مؤثر على اختلاف درجات تركزه، ويمنع البكتريا من ترسيب لويحات plaque على الأسنان وهي ضارة بصحة الأسنان. وبعد تناول وجبة غنية بالسكريات، تطلق البكتيريا أحماضها التي تؤدي إلى تآكل ميناء الأسنان.

ويرى الباحثون أن معطيات هذه الدراسة تدحض الانطباعات المستقرة لدى الرأي العام بأن الزبيب يفاقم مشكلة تسوس الأسنان؛ ذلك أن الزبيب يعتبر حلوى قابلة للالتصاق وعادة ما تسبب السكريات الملتصقة تسوس الأسنان.


وعلى العكس من ذلك، بينت نتائج هذه الدراسة أن محتويات الزبيب من الكيماويات ذات الأصل النباتي تفيد صحة الفم بمقاومة البكتيريا المسببة للتسوس وأمراض اللثة.

ويتميز الزبيب باحتوائه علي نسبة عالية من فيتامين " سي " ومضادات الأكسدة الأخرى التي تساعد في الوقاية من العديد من الأمراض، ويعتبر من أهم مصادر الفوسفور والبوتاسيوم والكالسيوم والماغنسيوم والحديد والنحاس.

ومن فوائد الزبيب أنه :


يساعد على إزالة السموم من الجسم .

مقاومة الميكروبات والفيروسات .

وعلاج الروماتيزم .

وأمراض الكبد والمرارة .

وضغط الدم المرتفع .

وعلاج السعال الجاف.

والوقاية من أمراض القلب.

وفيه نفع للحفظ "تقوية الذاكرة"

كما يُعد الزبيب مصدرا لعدد من المغذيات الضرورية للصحة مثل البوتاسيوم والالياف والحديد .

فالبوتاسيوم :

هو الذي يساعد على تنظيم ضغط الدم . ويحتوي 56 غراما من الزبيب على 300 ملغم من البوتاسيوم اي تقريبا مثل الكمية الموجودة في موزة صغيرة .

والالياف :

هي التي تمنع سرطان القولون وبقية امراض الامعاء . ويحتوي 56 غراما من الزبيب على 9% من الالياف الذائبة المطلوبة يوميا للجسم .

اما الحديد :

فهو ضروري لتكوين خلايا الدم . ويحتوي الزبيب على نسبة الحديد نفسها الموجودة في لحم البقر والفاصوليا البيضاء

احمد محمد عادل
22 - 02 - 2012, 18:20
4 نصائح تقلل اصابتك بالصداع





http://l.yimg.com/os/401/2012/02/14/110938096-jpg_103909.jpg (http://www.dlu3at.net/vb/article57724.html)

يعتبر الصداع مشكلة صحية شائعة بين كثير من الناس. ويمكن أن يكون في أي وقت من اليوم, الصداع هو نتيجة لأسباب عديدة مثل الإجهاد، ، وقلة النوم والصداع النصفي. لذلك إليك أكثر4 عادات لعلاج الصداع .

القهوة: تعتبر من إحدى الأدوية الأكثر شيوعا التي يستخدمها الناس لعلاج الصداع., وتعتبر القهوة كدواء لأنه يحفز الجهاز العصبي المركزي وحتى بعد طرد السوائل من خلال البول، فسيتمر تأثيرها لمدة أكثر من 5 ساعات, ولكن الكثير من القهوة يؤدي أيضا إلى الجفاف وتعتبر القهوة هي واحدة من العادات السيئة لتخفيف الصداع.

الشاي: وهو من أكثر الأعشاب شيوعا بين الناس الذين يعملون. ولكن عليك استخدام شاي الأعشاب ويستهلك الشاي الأخضر خصوصا، شاي البابونج أو الشاي بالقرفة, ولكنه يمكن أن يضر الجسم ويسبب عسر هضم .

الشوكولاتة: وهي أيضا من العادات الأكثر شيوعا لتخفيف الصداع و يستخدمها كثير من الناس خصوصا النساء وبالأخص الشوكولاتة الداكنة لعلاج الصداع, ولكن استهلاك الكثير من الشوكولاته يمكن أن يزيد من الصداع


الجوز: وهو صحي جدا وبالتالي فهو عادة جيدة, حيث يحتوي الجوز تحتوي على الأحماض الدهنية التي تبقيك نشطة وتوفر وتبعدك عن الاكتئاب والصداع. ومع ذلك، يمكن أن يؤدي الكثير من الجوز إلى عسر هضم وزيادة بالوزن.



5_ كتابة:

بسم الله الرحمن الرحيم بأى من أصابع اليد اليمنى على الجبهة من اليمين إلى اليسار


(مجربة مرات كثيرة)

nosa_aic
22 - 02 - 2012, 18:26
5_ كتابة:

بسم الله الرحمن الرحيم بأى من أصابع اليد اليمنى على الجبهة من اليمين إلى اليسار


(مجربة مرات كثيرة)


6- عدم متابعة اسعار الاسهم يوميا

nosa_aic
22 - 02 - 2012, 18:31
التدخين


أصل الحكاية ؟

عندما وصل كريستوفر كولمبس إلى أمريكا عام 1492م، وجد الهنود الحمر

يدخِّنون نبات (الطّباق)، واسْمه العلمي (نيكوتينيا تباكم)، فَحَمَلَهُ إلى

بلاده. وعرفته أوروبا، كما دخل إلى تركيا في القرن السابع عشر، عن

طريق التجارة، ثم انْتَشَر في باقي الدول العربية.


ماهو التدخين ؟

التدخين سلوك مميت. يدخن الإنسان عندما يَسْتَنْشِقُ دخان أوْراق التبغ،

سواء في السجائر، أو البايب، أو الشِّيْشَة.


كيف يؤثر التدخين على الجسم؟

** يصل النيكوتين في 8 ثوانٍ إلي المخ، ومنه إلي الجسم؛ فيُصيب الرئة بالسرطان.
** يضْعف النيكوتين الإبصار؛ نتيجةً لضيق شرايين شبكة الْعين.
** يقلّل من استفادة الدم بالأكسجين.
** يُحْدث خللاً في الجهاز العصبي.
** يُرسّب الدهون علي جدار الشرايين؛ فيقلّل تدفُّق الدم، و يرفع ضَغْطَه.
** يُقلّل حَرَكَةَ الشُّعَيْرات المبَطِّنَة لممرَّات التنفُّس، والقدرة علي طرد البلْغم والأتربة.
** يسبب زُرْقة الشّفاه، وصفرة الأسنان، والروائح الكريهة للفم.
** كثيراً ما يؤدي إلى عدم إتمام الحمْل، أو ولادة أطفال غير مكتملين النمو.
** يُقلّل لبن الأم، ويضر بصحة الطفل الرضيع.


ما هي الدوافع التي تحمل الشاب أو المراهق على التدخين؟


هناك عدة عوامل دون أن يكون لأي منها أفضلية أو أهمية خاصة على ما عداها ولكل شاب أو مراهق دوافعه الخاصة التي قد تختلف عن دوافع الآخرين. وأهم هذه الدوافع هي كالآتي:

1/ تساهل الوالدين

عندما ينغمس الأهل في مثل هذه العادات يصير سهلا على الولد أن يعتقد بأن هذه السجائر ليست بهذه الخطورة وإلا لما انغمس أهله وأقاربه فيها وبهذا فإن الأهل يشجعون أبنائهم عن سابق إصرار وتصميم على تدخين.

2/ الرغبة في المغامرة

إن المراهقين يسرهم أن يتعلموا أشياء جديدة وهم يحبون أن يظهروا أمام أترابهم بمظهر المتبجحين العارفين بكل شيء، وهكذا فانهم يجربون أمورا مختلفة في محاولة اكتساب معرفة أشياء عديدة. فيكفي للمراهق أن يجرب السيجارة للمرة الأولى كي يقع في شركها وبالتالي يصبح من السهل عليه أن يتناولها للمرة الثانية وهكذا.

2/ الاقتناع بواسطة الأصدقاء

الكثير من المراهقين يخشون أن يختلفوا عن غيرهم لاعتقادهم أن هذا من شأنه أن يقلل من ترحيب رفاقهم بهم.

4/ توفير السجائر

إن أقرب السجائر تناولا للمراهق هي تلك الموجودة في بيته


ما هي امراض التدخين؟


سرطان الرئة:

أثبتت الإحصائيات أن 80% من حالات سرطان الرئة سببها التدخين، وقد اكتشفت العلاقة بين سرطان الرئة والتدخين منذ خمسين عام بواسطة "سير ريتشرد دول" وهو كان عضو شرف في منظمة لأبحاث السرطان في أكسفورد.

- سرطان المثانة:

هناك مادة تسمى (Carcinogens) وهى مادة كيميائية مولدة للسرطان وتوجد في التبغ. يقوم المدخن باستنشاق هذه المادة عبر الرئة إلى مضخات الدم، يتم تنقية هذه المادة بواسطة الكلى وتركز في البول حيث تسبب إصابة في جدار المثانة. وبالطبع هذا التركيز يزيد فرصة الإصابة بسرطان المثانة.
المدخنين معرضون للإصابة بسرطان المثانة بنسبة تفوق مرتين أو ثلاثة بالمقارنة مع غير المدخنين.

- سرطان الكلى:

تصل فرص إصابة المدخنين بسرطان الكلى إلى ضعف النسبة التى يمكن أن يصاب بها غير المدخنين.

- سرطان عنق الرحم:

وجد الباحثين ارتباط وثيق بين سرطان عنق الرحم والتدخين والسبب في ذلك هو أن التدخين يضعف جهاز المناعة ويصبح غير قادر على مواجهة (HPV) وهو فيروس حاد يسبب السنط أو الزوائد الجلدية.
فيروس (HPV) له علاقة كبيرة بسرطان عنق الرحم والاحتمال الآخر هو أن المواد الضارة الموجودة في التبغ تقوم بتدمير (DNA) في خلايا عنق الرحم وهذا يمكن أن يكون له علاقة بتكوين سرطان عنق الرحم.

- سرطان الفم:

تصل فرص إصابة المدخن بسرطان الفم إلى ستة أضعاف بالمقارنة بغير المدخن.

- سرطان البلعوم:

أكدت الإحصائيات أن 40% من سرطان البلعوم له علاقة كبيرة بالتدخين.

- سرطان المعدة:

يزيد التدخين أيضاً من فرصة الإصابة بسرطان المعدة.

- سرطان الدم (لوكيميا):

وجد العلماء أن أكثر من ربع حالات اللوكيميا بسبب التدخين.

احمد محمد عادل
22 - 02 - 2012, 18:34
6- عدم متابعة اسعار الاسهم يوميا



البورصة تمام التمام ماعدا ال aic

إنهاردة اشتريت شوية على .6 قرش

وأكيد ها اصدع طالما اشتريته

nosa_aic
22 - 02 - 2012, 18:37
البورصة تمام التمام ماعدا ال aic

إنهاردة اشتريت شوية على .6 قرش

وأكيد ها اصدع طالما اشتريته


دا اكييييييد :36_1_13:

nosa_aic
22 - 02 - 2012, 19:39
http://asnan.upp.cc/images/milkteeth.gif (http://www.dlu3at.net/vb/article45663.html)



من نعم الله سبحانه و تعالى على خلقه أن و هبهم طقم


كامل من الأسنان ، يضفي جمالا" و روعة على وجوههم


إذا أهتموا بها و بنظافتها منذ الصغر ، تبرز في


الكبر جمال إبتسامة خلابة هي كعقد اللؤلؤ المنظوم


و للمحافظة على صحة هذا العقد وجماله فلابد من


الأهتمام بنظافة ورونق ذلك العقد ، و يتأتى ذلك من


خلال المحافظة على صحة الفم لدى الأطفال


ومن المعروف أن الغذاء السليم والصحي



فمن أساسيات المحافظة على النمو السليم والصحي لدى الطفل


أن ذلك لا يكتمل إلا بأسنان صحية حتى تساعده على تناول الغذاء


بصورة طبيعية





و للـمــحـافــظـة عـلــى أســنـان طـفــلك لــتـبـدو


جــمـيـلــة وبــراقــة فـإن ذلك يــبـدأ بـمــراحـل


مــخــتـلــفـة


** مرحلة الحمل **


فصحة الجنين من صحة الأم ، إذ أن التزام الأم



بالتعليمات الغذائية مهم جدا" لأسنان الطفل ، كأي جزء




آخر من جسمه




فيجب على الأم الحامل المحافظة على الغذاء الصحي



المتوازن والغني بالفيتامينات والمعادن والمحافظة على



تناول الحليب ومشتقاته طوال فترة الحمل


** مرحلة ما بعد الولادة **



تبدأ الأسنان اللبنية في البزوغ منذ الشهر6 إلى 9


وتختلف من طفل لأخر وتلعب الوراثة دورا" كبيرا" في


تحديد عمر السن الأول



و في هذا الوقت يجب على الأم البدء في مسح سن



الطفل و اللثة بقطعة من الشاش أو قطعة قماش ناعمة لإزالة


بقايا الحليب عن اللثة والأسنان

ومــن الــعـادات الــخـاطــئـة الــتـي تــقـوم بــها

الــكـثـيـر مــن الأمــهـات



هي ترك الرضاعة الصناعية في فم الطفل أثناء نومه


مما يجعل الفم مرتعا" مناسبا" للبكتريا المسببة لتسوس


الأسنان ، و لتجنب هذا النوع من التسوس خصوصا"


إذا كان الطفل متعودا" على النوم بالرضاعة الصناعية


فيجب عدم ترك الرضاعة طوال الليل في فمه ، ولكن


بمجرد نومه يتم إزالتها من فمه ومن ثم مسح الأسنان


واللثة بقطعة شاش مبللة بالماء أو تفريشها إن أمكن


والأفضل العمل على إيقاف هذه العادة أو استبدال


الحليب الصناعي بالماء أثناء النوم



كما إنه من الخطأ تناول الطفل العصائر المصنعة



والأفضل استبدالها بعصائر طبيعية

مــرحـلــة 2 إلــى 5 سنوات


في هذه المرحلة تستمر الأسنان اللبنية في البزوغ



وتكتمل في عمر 3 إلى 4 سنوات تقريبا" وعدد


الأسنان اللبنية في هذه السن 20 سنا"


و تـتـمــيـز هــذه الــمـرحــلـة بـمــا يـلــي :


1 ـ في هذه المرحلة يلاحظ عند اكتمال بزوغ الأسنان



اللبنية هو وجود فراغات بين الأسنان الأمامية و هذا


طبيعي جدا" لأنه يعطي مكانا" ملائما" لبزوغ الأسنان


الدائمة الأكبر حجما"



أما إذا كانت الأسنان اللبنية متراصة ومن غير فراغات



فهذا يؤثر لاحقا" في ترتيب الأسنان الدائمة مسببا"



تزاحما" و قد يؤدي في بعض الأحيان إلى ضمور



بعض الأسنان الدائمة


2 ـ من المهم الزيارة الدورية لطبيب الأسنان منذ



اكتمال بزوغ الأسنان والتعود على ذلك كل ستة أشهر



حتى يتم تدارك المشاكل المتعلقة بصحة الفم والأسنان



منذ البدايه ، كما أن له أثر كبير في إزالة الرهبة



والخوف من طبيب الأسنان



وفي هذه المرحلة يجب على الوالدين



تعويد الطفل على تفريش أسنانه بواسطة الفرشاة



والمعجون ، ويكون تعليمه من قبل والديه أو إخوته


بتركه يشاهدهم وهم يفرشون أسنانهم فنظرا" لحب


الطفل للتقليد فإنه سيقوم بتقليدهم



الاستمرار في تعليمه بتفريش الوالدين له و الحرص



على عدم ابتلاع المعجون



وتعليمه المضمضة وبصق المعجون المتبقي ويتم كل



ذلك بتركه يشاهد ثم يقلد ما شاهده


عادة ما يتكون غذاؤنا من بعض المواد الحمضية


و المشروبات الغازية و بعض منكهات الأطعمة


و هذه تجعل الوسط الفمي حامضي و هذا بدوره



يقوم بالتأثير



على الطبقة الخارجية للأسنان و ذوبان الأملاح



منها مما يجعلها عرضة للتآكل


و تفريش الأسنان مباشرة بعد تناول و جبة كهذه


يؤدي إلى تآكل الطبقة الخارجية تدريجيا" و من


ثم الإصابة بحساسية الأسنان



و لذلك يُنصح بالمضمضة بعد الأكل و التريث


قليلا" إلى أن يتم مُعادلة تلك الأحماض في الوسط


الفمي ، ومن ثم القيام بتفريش الأسنان


أو أكل بعض أنواع الفاكهة كالتفاح أو الموز و


التقليل من المشروبات الغازية يساعد في تعديل


الوسط الحامضي



ومن الاعتقادات الخاطئة لدى الكثير من الأمهات


هو أن الأسنان اللبنية ليست مهمة لأنه سيتم

تبديلها عندما يكبر و الصحيح هو العكس تماما"


لأنه عندما يتم تعويد الطفل منذ البداية على


الإهمال وعدم المحافظة على أسنانه سيستمرعلى


ذلك حتى يكبر ، كما و أن الأسنان اللبنية تؤثر


على الأسنان الدائمة ، حيث أن تسوسها وفقدانها


المبكر يؤثر في بزوغ الأسنان الدائمة ، و في


كثير من الحالات يفقد الفراغ المهيأ للسن الدائم و


يسبب ضموره في عظم الفك

nosa_aic
22 - 02 - 2012, 19:45
مـرحلة الـ 6 ســنوات فـمـا فــوق



تبدأ في هذه المرحلة عملية تبديل الأسنان اللبنية


بأسنان دائمه ، و تتفاوت مرحلة التبديل من طفل لآخر


و تـتـمـيز هــذه الـمــرحــلة بـمــا يـلــي



1ـ عدد الأسنان الدائمة 32 سنا" تبدأ ببزوغ السن



الطاحن الأول الدائم و يأتي خلف الطواحن


اللبنية أي أنه لا يتم تبديله بسن لبني


2 ـ يجب تعويد الطفل في هذه المرحلة على


الاعتماد على نفسه في استخدام الفرشاة و




المعجون بالإضافة إلى الخيط السني وتشجيعه


على ذلك


3 ـ استمرارالزيارة الدورية لطبيب الأسنان


حيث يتم فحص الأسنان ومراقبة تبديل الأسنان


اللبنية وتنظيفها ، وقد يتم وضع طبقة واقية


على سطوح الأسنان الدائمة تساعد على الحد من


انتشار التسوس على سطح الأسنان العضي ،
وتشمل أيضا وضع طبقة من الفلورايد حتى


يساعد على تقوية الأسنان


4 ـ لطبيب الأسنان دور مهم في مراقبة نمو


الفكين والأسنان ، وتراص الأسنان مع بعضها


البعض وكذلك الكشف عن وجود بعض


العادات السيئة لدى الطفل والتي قد تؤثر على نمو


الفكين وقد تسبب سوء في إطباق الأسنان


مع بعضها البعض


5 ـ قد يلاحظ الأبوان وجود فراغات بين الأسنان


العلوية الأمامية لدى أطفالهم بالإضافة إلى عدم


تراصها مع بعضها البعض مما يستدعي عرض الطفل


على أخصائي تقويم الأسنان لتصحيحها ،


ولذا من المهم معرفة أن الطفل يمر في مرحلة


تغيير طبيعية ، وتكون في عمر 8-9سنوات



وينصح في كثير من الأحيان بالانتظار لحين


بزوغ الأنياب الدائمة حيث تبدأ بسدالفراغات بين الأسنان


الأمامية

6 ـ ومن التغيرات أيضا والتي قد يلاحظها البعض هي تزاحم في


الأسنان الأمامية السفلية لدى الطفل ، وهي تدل أيضا على


مرحلة طبيعية وقد تزول مع نمو الفك وعند تبديل الطواحن


اللبنية إلى دائمة ، وقد يكون من المستحسن استشارة أخصائي


تقويم الأسنان في الحالات الشديدة لأنها قد تستدعي تدخلا مبكرا


من قبله





عــادة مــص الإصــبـع


حيث أنها لا تؤثر على الفكين والأسنان إذا تم

إيقافها في سن مبكرة كسن 4سنوات ، أما إذا


استمرت إلى سن متأخرة وإلى بعد بزوغ


الأسنان الدائمة فهي بالتأكيد ستؤثر على نمو


الفكين و بالأخص الفك العلوي و يحتاج الطفل


إلى تدخل سريع من قبل أخصائي الأسنان


لإيقاف هذه العادة وعلاج تشوهات الفكين و



الأسنان الناجمة عن ذلك


إن الخلل في إحدى الوظائف الحيوية لدى الطفل



قد يكون له تأثير كبيرعلى نمو الفك و وضعية


الأسنان مع بعضها البعض ، ومثال على ذلك هو


الخلل في وظيفة التنفس بسبب وجود اللحمية أو


حساسية الأنف مما يضطر الطفل إلى التنفس


عن طريق الفم وبذلك يكون الفم مفتوحا" في


معظم الوقت مما يؤثر في نمو الفكين ويؤدي




إلى تكوين العضة المفتوحة وضيق في حجم


الفك العلوي أي حدوث تشوهات في عظم الفك


والأسنان


ويبدأ علاج هذه الحالات بعرض المريض أولا"


على أخصائي الأنف والأذن والحنجرة لمعرفة


سبب الخلل ومن ثم علاجه و بالتالي الوصول


إلى نتيجة طبيعية في التنفس ، ومن ثم يبدأ


أخصائي التقويم في علاج التشوهات في الفك


والأسنان بواسطة أجهزة تقويم الأسنان


http://www.bombayharbor.com/productImage/0173841001228808540/Electric_Toothbrush_Hl248.jpg





و يوجد في الأسواق العديد من أشكال الفرش


والمعاجين المخصصة للأطفال و التي لا ضير من ابتلاعها و


المحتوية على رسومات و شخصيات يفضلونها و محببة لديهم



ومـن الـمــهـم أن تــتوفــر شــروط مـعـيـنـة فـي


الـفــرشــاة الـمــخــتـارة وهـــي





http://sites.google.com/site/tunisvente/_/rsrc/1267353687449/home/siwak_junior.JPG




* أن تكون صغيره لتناسب حجم فم و أسنان الطفل


* أن تكون ذات مقبض كبير يُمكن أن يُساعدالأطفال


على الإمساك بالفرشاة بإحكام


* أن تكون ذات شعر ناعم و طويل لضمان انسيابها مع



منحنيات الأسنان و الفراغات البينية بينها


* أن يكون لها نهايات دائرية أو بيضاوية للحماية والتنظيف


الآمن للأسنان ونسيج اللثة الرقيق


كما توجد فرش أسنان ذات رؤوس مخروطية مخصصة للأسنان


المتباعدة إلى حد ما و ذلك لتنظيف الأسطح البينية



للأسنان
http://img201.imageshack.us/img201/5324/83184397qv1.jpg




لأن هناك بعض الأشخاص الذين لا يستطيعون استخدام


الفرشاة اليدوية بالطريقة الصحيحة أو لديه مشكلة في


يديه من ضعف أو نقص في الأصابع أو غير ذلك من


الأسباب و لهؤلاء يفضل إستخدام الفرشاة الكهربائية


أو الفرش الضاخة للماء و هي مفيدة جدا" و هي


نافعة حتى للأصحاء الذين لا يعانون من أية مشكلة صحية


لأن لها فوائد كثيرة و لأنها تسهل عملية التفريش وتسرعها

nosa_aic
22 - 02 - 2012, 19:49
الــعـــمـر الإفــتـراضــي لــفــرشـــاة الأســنـان



يتم تغيير الفرشاة كل ثلاثة شهور أوعندما ترين أن


شعرها قد بدأ يتآكل ويتفرق


أمــا بـالــنـسـبـة لـلــمـعــاجــين


هناك أنواع كثيرة من المعاجين متوفرة في الأسواق منها ماهو


لمحاربة التسوس ، و منها ماهو للحماية من الجير ومنها ماهو


للأسنان الحساسة ولكن المهم هو أن



1ـ التأكد من احتواء المعجون على نسبة مخففة



من مادة الفلورايد ، لأن الطفل معرض لابتلاع



المعجون أثناء التفريش ، حيث من المهم تجنب



التعرض لكمية كبيرة من الفلورايد في هذه



المرحلة لما قد يسببه من تبقع الأسنان الدائمة




كما أن تناول كميات كبيرة من مادة الفلورايد قد يؤدي



إلى التسمم والتبقع الفلوري ناتج



عن التعرض لكمية كبيرة من الفلورايد في الصغر و



ذلك من خلال شرب المياه المحتوية على كميات كبيرة



من هذه المادة



فيتأثر تكوين الأسنان الدائمة لأنها تتشكل و تتكلس منذ



الولادة وحتى سن 7 إلى 8 سنوات تقريبا"



كما يؤثر الفلورايد الزائد على الخلايا المكونة للأسنان



مما يؤدي إلى تغيير في سطح الأسنان المتأثرة ، و



تتراوح شدة الحالة من بسيطة إلى تبقع شديد



ونخرحسب كمية الفلورايد المستهلكة






http://knol.google.com/k/-/-/1dmzx2xrd2b2a/7yod3q/untitled.bmp


طــريــقــــة تـفــريـش أســنـان الأطــفـال


http://www.alarab.net/data/news/2010/10/20/alarab201010a23.jpg


قومي بغسل الفرشاة ثم ضعي كمية قليلة ( كحجم



البازلاء ) من المعجون و اضغطي عليه بالإصبع ليدخل



بين الشعيرات لضمان الفائدة من المعجون ثم قومي



بتحريك الفرشاة بطريقة دائرية وتنظيف جميع أسطح



الأسنان الظاهرة


الأطــفـال الأكــبـر ســنـا"


لأن الأطفال عادة ما يقومون بتفريش الأسنان الأمامية



فقط و يجهلون الأسنان الخلفية و الأضراس فلابد من



مساعدتك لطفلك حتى يتقن فن التنظيف الصحيح



ضعي نفس كمية المعجون واضغطيه ثم قومي بتحريك



الفرشاة ببطء لضمان تحريك الشعيرات بدون نحت



للأسنان ثم قومي بتفريش أسطح الأسنان بالكامل و



التأكد من تفريش منطقة التقاء المينا باللثة و ذلك



لضمان سلامة اللثة من أي تراكم جيري ، و يجب أن



تصل الشعيرات إلى مناطق مابين الأسنان وتنظيفها


ولا تنسي أن تفرشي اللثة و اللسان و سقف الفم


بخفة و دون ضغط و يوجد أداة لكحت اللسان


متوفرة في الأسواق بأشكال مختلفة




مــن يـعــانـي مــن الــتـهــاب فــي اللــثة


انـحــسـارها


أو حــســاســيـة فــي الأســنـان



فيجب استخدام طريقة تفريش مختلفة ، و ذلك باستخدام



فرشاة أسنان ناعمة و تحريك الفرشاة باتجاه عامودي



ابتداء من الجانب اللثوي باتجاه السطح الطاحن وذلك



لضمان إيقاف الإنحسار اللثوي و التقليل منه ومن



حساسية الأسنان ، و الأسطح البينية غير الظاهرة



يستحسن تنظيفها بالخيط السني ، وهو نوعان مشمع


للمصابين بالتهاب اللثة و غير المشمع ( العادي )


الذي يستخدم عادة لمن لا يعانون مشاكل في الأسنان



أحيانا" يستخدم الخيط السني المشمع للأسنان ذات اللثة



الملتهبة أو المنحسرة و ذلك للتقليل من إصابة اللثة



بمزيد من المشاكل





http://img377.imageshack.us/img377/1580/hpim6944br7.jpg


يوجد خيط طبي سهل


الاستعمال للأطفال تقوم الأم بتعليم الطفل إلى أن يتقنه ثم هو من


سينظف أسنانه بمفرده

إن إستخدام النكاشات بالطريقة العامية مؤذ جدا" حيث



أنه يسبب تآكل اللثة و نزفها خاصة في المنطقة البينية



للأسنان ، و يمكن استخدامها بالطريقة الصحيحة و ذلك



بدون الضغط على اللثة الموجودة بين الأسنان و خاصة



إذا كانت الأسنان متباعده

وأخــــيـرا"



يجب التأكيد على دور الوالدين في تحفيزالطفل على العناية


بصحة فمه ، وتعليمه الطريقة الصحيحة لتفريش أسنانه وطرق


الوقاية من التسوسات وأمراض اللثة عن طريق الزيارة الدورية


لطبيب الأسنان، حتى تصبح عادة تنمو معه حتى يكبر


و الوقاية خير من العلاج

nosa_aic
24 - 02 - 2012, 06:17
الوجبات منخفضة السعرات تقلل إصابة الأطفال بالسمنة (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/166918-%D8%A7%D9%84%D9%88%D8%AC%D8%A8%D8%A7%D8%AA-%D9%85%D9%86%D8%AE%D9%81%D8%B6%D8%A9-%D8%A7%D9%84%D8%B3%D8%B9%D8%B1%D8%A7%D8%AA-%D8%AA%D9%82%D9%84%D9%84-%D8%A5%D8%B5%D8%A7%D8%A8%D8%A9-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84-%D8%A8%D8%A7%D9%84%D8%B3%D9%85%D9%86%D8%A9)



http://www.alwafd.org/images/news/169355462qq1137.jpg





أثبتت دراسة علمية حديثة أجراها باحثون بريطانيون بجامعة أوكسفورد أن أحد أنجح الوسائل للحد من الاعداد المتزايدة للأطفال المصابون بالبدانة والسمنة المفرطة قد يكون بتشجيع الأطفال باختيار الوجبات الغذائية ذات السعرات الحرارية المنخفضة.
وأجريت الدراسة على مجموعة من الاطفال تشمل 38 طفلا تراوحت اعمارهم مابين 8-11 عاما، وتم تقسيمهم إلى مجموعتين ، تناولت المجموعة الاولى وجبة إفطار ذات أغذية منخفضة المؤشر الجلايسيمي ، بينما تناولت الثانية وجبة ذات أغذية مرتفعة المؤشر الجلايسيمي على مدى يومين في الأسبوع لمدة 10 أسابيع.
ووجد الباحثون أنه بالمعدل المتوسط تناول الأطفال 61 سعرا حراريا أقل خلال الأيام التي تم إعطائهم فيها أطعمة منخفضة السعرات الحرارية مقارنة بالأيام التي تناولوا فيها أغذية مرتفعة المؤشر الجلايسيمي.
ولفتوا إلى أنه خلال فترة العشرة أسابيع عندما كان الأطفال يتناولون فطورا يحتوى على أغذية منخفضة المؤشر الجلايسيمي ليومين في الأسبوع، كانوا يأكلون بكمية أقل في الأيام الأخرى عندما كانوا يختارون وجبتهم بأنفسهم.

nosa_aic
24 - 02 - 2012, 06:23
10 أعشاب وخضراوات تساعد في إنقاص الوزن






1. الفلفل الأحمر الحريف المعروف بـ"كايين"Cayenne pepper: يساعد في تسريع حرق الدهون والسعرات الحرارية، بحسب جامعة "بوردو" الأمريكية.


2.القرفة:تلعب القرفة دوراً هاما ًفي إنقاص الوزن فبجانب ما يعرف من خصائصها في خفض مستوى السكر بالدم والكولسترول (السيئ)، الإ أن الدراسات أظهرت أنها تساعد في تعزيز عملية الأيض ورفع مستويات الأنسولين.


3.الفلفل الأسود:الشائع عن الفلفل الأسود أنه يستخدم في المطبخ فحسب، ولكن في الواقع يعمل الفلفل الأسود على المساعدة في عملية الهضم كما يساعد على حرق الدهون بوتيرة أسرع ويساعد في حرق سعرات حرارية توازي المشي لمدة عشرين دقيقة.


4.عشبة الطرخشقون dandelions:وهي نبتة تحتوي على مجموعة مدهشة من الفوائد الصحية، يمكن أن تؤكل أوراقها بإضافتها للسلطة، وتساعد في تنظيف الجسم من السموم وتبطئ من عملية الهضم مما يساعد على الإحساس بالشبع لفترة أطول، وتصنف العشبة كأعلى أربع خضروات من حيث القيمة الغذائية.


5.الخردل: ويعرف عنه أنه من أبرزالأعشاب التي تساعد في خفض الوزن، ووجد الباحثون أن ملعقة شاي من الخردل تزيد وتيرة الأبيض بقرابة 25 %.


6.الكركم: يساعد في تفكيك الدهون وينظم عملية الأيض بالجسم، كما يساعد في خفض إمكانية الإصابة بداء السكري، بحسب بحث من جامعة كولومبيا.


7.الزنجبيل: يساعد في كبح الشهية والهضم والعمل على إزالة السموم ورفع حرارة الجسم لتعزيز الأيض.


8.الحبهان (الهيل): يساعد في تعزيز الأيض، وفي عملية الهضم.


9.الكمون: يساعد في عملية الهضم وإنتاج الطاقة وتعزيزجهاز المناعة، كما قد يساعد في تخفيف أمراض الكلى والأزمة وسرطان ولون والتهاب المفاصل، كما كشفت أبحاث.


10.الجينسينج: تساعد في تسريع الأيض metabolism وتعزيز الطاقة، إلا أن النوع الذي يعرف بـ"باناكس جينسينغ" له خصائص المساعدة في تقليل الوزن، وفق أبحاث من جامعة "ميرلاند" الأمريكية.

nosa_aic
24 - 02 - 2012, 09:02
http://im15.gulfup.com/2012-01-20/132701427421.jpg (http://forum.sedty.com/)




http://im16.gulfup.com/2012-01-20/132701431821.jpg (http://forum.sedty.com/)



http://im21.gulfup.com/2012-01-20/1327014348121.jpg (http://forum.sedty.com/)


http://im14.gulfup.com/2012-01-20/1327014383201.jpg (http://forum.sedty.com/)



http://im13.gulfup.com/2012-01-20/132701442281.jpg (http://forum.sedty.com/)


http://im14.gulfup.com/2012-01-20/1327014469441.jpg (http://forum.sedty.com/)


http://im14.gulfup.com/2012-01-20/1327014514161.jpg (http://forum.sedty.com/)




http://im10.gulfup.com/2012-01-20/1327014553431.jpg (http://forum.sedty.com/)



http://im14.gulfup.com/2012-01-20/1327014587511.jpg (http://forum.sedty.com/)

nosa_aic
24 - 02 - 2012, 13:48
الكاكاو مفيد لعلاج ضغط الدم و تحسين الاوعية الدموية

http://4.bp.blogspot.com/-sTtfLLLjNfQ/TokyZpX7r2I/AAAAAAAAAmg/XdBZJpp5_mk/s200/%25D8%25B4%25D8%25B1%25D8%25A7%25D8%25A8+%25D8%25A 7%25D9%2584%25D9%2583%25D8%25A7%25D9%2583%25D8%25A 7%25D9%2588+cocoa+%25D8%25A8%25D8%25A7%25D9%2584%2 5D8%25AD%25D9%2584%25D9%258A%25D8%25A8.jpg (http://4.bp.blogspot.com/-sTtfLLLjNfQ/TokyZpX7r2I/AAAAAAAAAmg/XdBZJpp5_mk/s1600/%25D8%25B4%25D8%25B1%25D8%25A7%25D8%25A8+%25D8%25A 7%25D9%2584%25D9%2583%25D8%25A7%25D9%2583%25D8%25A 7%25D9%2588+cocoa+%25D8%25A8%25D8%25A7%25D9%2584%2 5D8%25AD%25D9%2584%25D9%258A%25D8%25A8.jpg)

ما أجمل ان تبدأ يومك بكوب من الكاكاو فقد أثبتت دراسة حديثة أن الكاكاو مفيد جداً في علاج ضغط الدم وتحسين الأوعية الدموية بالإضافة إلى تحسين مستويات الكولسترول في الدم، وهو ما يعني أن كوب من الكاكاو يساعد في حمايتك من الكثير من الأعراض المرضية وقد أثبت أختبارات أخرى بأن كوبا من الكاكاو يحتوي على ضعف المواد المضادة للأكسدة المتواجدة في الشاي، كما تزيد نسبة المواد المضادة للأكسدة في الكاكاو ثلاث مرات عنها الشاى الاخضر، وخمس مرات عن الشاى الاسود.

nosa_aic
24 - 02 - 2012, 13:51
فوائد الماء الذي يقدم مع القهوة

اعتاد الناس على تقديم كوب من الماء عند تقديم القهوة و يقوم البعض بشرب الماء قبل شرب القهوة أو بعدها و لكل من الحالتين فوائدها التي قد لا يعيها الكثيرين
شرب الماء بعد شرب القهوة يساعد على ازالة أو تخفيف اللون الذي قد يعلق على الأسنان ، كما أنها تساعد على تخفيف تركيز الرواسب التي تترسب في الكلى و الناتجة عن القهوة و تساعد على عدم منع جفاف الجلد و تمنع تكوين الحصى في الكلى
أما إذا شرب الماء قبل البدء في شرب القهوة يساعد على تخفيف تركيز الكافيين

nosa_aic
24 - 02 - 2012, 13:56
معلومات طبية


http://www.3eshq1.net/vb/imgcache/762.imgcache.jpg


هل تعلم :

أن شبكة العين تحتوي على نحو 135 مليون خليه حسيه
مسئوله عن ألتقاط الصور وتمييز الألوان



http://sr-a7.com/vb/cachimg/img_1315855204_885.jpg
هل تعلم :
أن أقوى عضله في جسم الإنسان هي اللسان




http://www.kingvip.com/up/uploads/images/VIP-7021278a52.jpg
هل تعلم :
أن متوسط أستهلاك الفرد من البيض يبلغ نحو 230 بيضه سنويا





http://enayh.com/images/stories/body-lab-food/62.jpg



هل تعلم :
أن قلب المرأه ينبض على نحو أسرع من قلب الرجل




http://t0.gstatic.com/images?q=tbn:ANd9GcQyhVMvbKXtA6lQ8oM1CSb7FI71dID4r nuY0Z5PYKAFzELdoo_w
هل تعلم :
أن الكبد هو العضو الوحيدالذي يمكن أن يحول البروتينات وماتحويه
من أحماض أمينيه إلى مادة الجلوكوز أو السكر





http://t0.gstatic.com/images?q=tbn:ANd9GcQcMfqeKaCkcQNQaANVqeulVDDAN8rP1 GlGDgWwps3Ck1cdS6AM0VinZoaLdw
هل تعلم :
أن المخ يحتاج إلى سدس كمية الدم التي يضخها القلب وخمس الأوكسجين
الذي يدخل الجسم رغم أن المخ لايزن أكثر من واحد
على خمسين من الجسم كله




http://up.qloob.com/upfiles/NWn03532.gif



هل تعلم :
أنه يوجد في جسم الإنسان نحو 32 بليون خليه




http://www.otaifi.com/vb/imgcache/25198.imgcache.gif



هل تعلم :
أن في جسم الإنسان أكثر من مليوني غده عرقيه
تفرز كميه من العرق تترواح مابين نصف لتر ونصف
كل 24 ساعه بلا توقف صيفا وشتاء
مع المجهود والحركه ومع أرتفاع درجة الحراره




http://upload.wikimedia.org/wikipedia/commons/thumb/b/b4/Normal_Epidermis_and_Dermis_with_Intradermal_Nevus _10x.JPG/800px-Normal_Epidermis_and_Dermis_with_Intradermal_Nevus _10x.JPG



هل تعلم :
أن سمك جلد الإنسان لايزيد عن 2 ملم
وسمك جلد الفيل يبلغ 25 ملم
وجلد الإنسان يحتوي على عدة الآف من الغدد
التي تفرز العرق بينما جلد الفيل
خال من هذه الغدد بإستثناء جفون العينين




http://img.webme.com/pic/s/smsome-doctor/ba4cdac9b6.jpg
هل تعلم :
أن الإنسان يفقد نحو 85 في المائه من حاستي الشم
والتذوق عند بلوغه سن الستين






http://www.ibti.org/media/lib/pics/1271201089.jpg
هل تعلم :
أن الجسم يحتمل حراره حتى 128 درجه مئويه

nosa_aic
25 - 02 - 2012, 07:30
عملية استئصال اللوزتين



http://www.ghorayeb.com/files/tonsillectomy_labeled_580x432.jpg (http://www.libyanyouths.com/vb/t132724.html)

http://a6.sphotos.ak.fbcdn.net/hphotos-ak-snc6/167304_10150116709934439_31200169438_7582830_66539 24_n.jpg (http://www.libyanyouths.com/vb/t132724.html)


تكثرالأمراض والمشكلات الصحية التي يتعرض لها الأطفال في مختلف فصول السنة مما يتطلب انتباهاً شديداً من الأهل لتجنب المضاعفات. ومن أكثر المشكلات الصحية التي يتعرض لها الأطفال التهابات اللوزتين مع ما ينتج عنها من مشكلات صحية وتأخر في النمو وتشوه في الفم وغيرها من المضاعفات المهمة التي قد لا يكون كل الأهل على علم بها، فيؤجلون فكرة اللجوء إلى عملية استئصال اللوزتين مع ما ينتشر من أقاويل حولها في ما يتعلق بتأثيرها على مناعة الطفل وجعله أكثر عرضة للالتهابات والأمراض.

متى يمكن أن تكون هناك حاجة إلى استئصال اللوزتين؟

يتخذ قرار إجراء عملية استئصال اللوزتين على أساس تكرار الالتهابات في اللوزتين ثلاث مرات أو أربع في السنة في سنوات عدة. كما يمكن أن تسبب هذه الالتهابات التهابات في المفاصل وأعضاء أخرى في الجسم واشتراكات ، وفي هذه الحالات تجرى الفحوص اللازمة وعلى أساسها يقرر الطبيب ما إذا كانت هناك حاجة إلى إجراء العملية. كما أن شكل اللوزتين لدى فحصهما ووجود تجاويف كبيرة فيهما وقيح وحجمهما الكبير الذي يسبب ضيقاً في النفس كلّها أمور قد تشير إلى ضرورة إجراء العملية.

ما السن التي يمكن إجراء العملية فيها؟

لا سن معينة لإجراء العملية، إذ أصبح يمكن إجراؤه للأطفال من سن السنتين أو الثلاث سنوات، فيما كانت تجرى سابقاً فقط بعد الثلاث سنوات. علماً إنه في حال وجود مشكلة، من الأفضل إجراء العملية في سن مبكرة نظراً إلى المضاعفات التي يمكن أن تنتج عن المشكلات في اللوزتين وتأثيرها المهم على صحة الطفل ونموه. وأشير إلى أن مشكلة اللوزتين

هل تجرى العملية فقط في مرحلة الطفولة؟

يمكن أن تجرى العملية أيضاً في مراحل متأخرة، لكنه تجرى في معظم الحالات للأطفال.

ما المشكلات التي يمكن أن يعانيها الطفل نتيجة الالتهاب المتكرر في اللوزتين؟

كون التهابات اللوزتين تترافق مع اللحمية لدى الأطفال في سن مبكرة، تحصل مشكلات مهمة خصوصاً أن للحمية أهمية كبرى فهي تسبب التهابات في الأذن وتأخراً في النمو إلى جانب الالتهابات المتكررة في اللوزتين والحاجة إلى تناول الأدوية. إضافةً إلى تأثيرها على شكل عضّة الفم. وأحياناً قد تكون هناك حاجة إلى استئصال اللحمية وحدها بسبب الشخير وتشوّه شكل الفم.

كيف تتم العملية وما مدى صعوبتها؟

في الماضي كانت تُفصل اللوزتان وتتم العملية بالكي أو بالتقطيب لاستئصال اللوزتين. لكن يمكن إجراؤها حالي أيضاً بالليزر حيث يتم تحجيم اللوزتين أو استئصالهم وبالتالي هي عملية سهلة لا تدعو إلى القلق.

أليس فيها أي خطر؟

ليس في العملية أي خطورة ، ولا تسبب إلا القليل من الإزعاج في البلع حتى يلتئم الجرح.

هل تجرى العملية بالتخدير العام أم الموضعي؟

تجرى العملية بالتخدير العام للأطفال، أما بالنسبة إلى الكبار في السن فيمكن إجراؤها بالتخدير الموضعي.

ما الإجراءات التي يجب اتباعها والخطوات بعد العملية؟

بعد الخضوع للعملية يجب البقاء في المنزل مدة عشرة أيام وتناول السوائل الباردة خلال بضعة أيام.

ما النتائج الإيجابية للعملية وهل تظهر مباشرةً؟

تظهر النتائج الإيجابية خلال فترة قصيرة بعد العملية إذ يلاحظ تحسّن في صحة الطفل وازدياد وزنه ونقاء في دمه وتنفسه وفي نومه بشكل أفضل. كما إنه لا يعود بحاجة إلى تناول المضادات الحيوية .

هل هناك حالات خاصة يستحسن عدم إجراء العملية فيها؟

قد نتحفّظ عن إجراء العملية للأطفال الذي يعانون مشكلة الربو، إلا إنه يمكن إجراؤها وقد لاحظت شخصياً تحسّن في مناعة الطفل ووضعه الصحي في الحالات التي أجريت العملية فيها.

يخشى البعض إجراء العملية لأطفالهم فيفضلون تأجيلها وتركها كخيار أخير بعد العلاجات التقليدية، خصوصاً أنه يقال إنها تلعب دوراً أساسياً في مناعة الطفل وأن إجراءها يجعله أكثر عرضة للالتهابات، هل هذا صحيح؟

ليست اللوزتان وحدهما المسؤولتان عن المناعة في الجسم، إذ توجد غدد لمفاوية أخرى تشكل القسم الأهم من المناعة. أما اللوزتان فتشكلان جزءاً بسيطاً من المناعة. وأشير إلى أنه من المهم إجراء تشخيص صحيح لتحديد الحاجة إلى استئصال اللوزتين لأنه ليس كل التهاب في الحنجرة يعني التهاباً في اللوزتين، إذ يمكن الإصابة بفيروس الأنفلونزا. علماً أن وجود القيح الأبيض يشير إلى الإصابة ببكتيريا تعالج بالمضادات الحيوية. أما الإصابة بفيروس فيسبب احمراراً في اللوزتين والحنجرة ويعالج للقضاء على الأعراض مع مطهرات للحنجرة. وفي هذه الحالة لا تفيد المضادات الحيوية.

هل ثمة أعراض معينة مسبقة تحدد ما إذا كان الطفل بحاجة إلى عملية استئصال اللوزتين، وهل يمكن تحديد هذه الحاجة منذ الطفولة المبكرة؟

يمكن تحديد الحاجة إلى عملية استئصال اللوزتين بحسب شكل اللوزتين في سن الستة أشهر أو السبعة أشهر، علم أن الطفل قد يعاني اختناقاً في التنفس أثناء النوم بسب حجم اللوزتين الكبير.

هل تعتبر مشكلات اللوزتين وراثية؟

تلعب الوراثة دوراً في شكل اللوزتين وحجمهما الكبير، فإذ كان أحد الوالدين يعاني المشكلة يكون الطفل أكثر عرضة. وبالتالي هناك استعداد عائلي للمشكلة.

هل ثمة إجراءات معينة يجب اتباعها قبل العملية؟

الأهم ألا تكون اللوزتان ملتهبتين لدى إجراء العملية، وإلا فلا بد من الانتظار حتى تشفيا. كما تجرى قبل العملية فحوص الدم اللازمة، خصوصاً لسيلان الدم لكي يكون الوضع معقولاً.

هل هناك فترة معينة في السنة يجب إجراؤه فيها؟

ليس ضرورياً إجراؤها في فترة معينة في السنة إلا أنه غالباً ما تجرى خلال العطل المدرسية كونها تتطلب فترة من الراحة.

هل هناك علاجات معينة يجب اتباعها بعد العملية؟

يجب تناول المسكنات وأدوية الالتهابات بعد العملية.

كيف يلاحظ تحسّن حالة المريض بعد العملية؟

في حال وجود التهابات متكررة في السنة وتشخيص الحالة بالطريقة الصحيحة واستئصال اللوزتين، يلاحظ أن الطفل لا يمرض ولا يعود بحاجة إلى الأدوية. كما يلاحظ أنه ينمو بشكل أفضل، خصوصاً أن الالتهابات المتكررة في اللوزتين تؤخر النمو فيزداد طولاً وتتحسّن حالته العامة.

nosa_aic
26 - 02 - 2012, 16:44
الجلوس 7 ساعات يعرض السيدات للإصابة بالسكر (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/168239-%D8%A7%D9%84%D8%AC%D9%84%D9%88%D8%B3-7-%D8%B3%D8%A7%D8%B9%D8%A7%D8%AA-%D9%8A%D8%B9%D8%B1%D8%B6-%D8%A7%D9%84%D8%B3%D9%8A%D8%AF%D8%A7%D8%AA-%D9%84%D9%84%D8%A5%D8%B5%D8%A7%D8%A8%D8%A9-%D8%A8%D8%A7%D9%84%D8%B3%D9%83%D8%B1)



http://www.alwafd.org/images/news/858487576y20v3c2y.jpg





حذرت دراسة طبية من أن جلوس السيدات لأكثر من سبع ساعات يوميا يضاعف من فرص إصابتهن بمرض السكرمن النوع الثانى .
وأوضحت الأبحاث أن السيدات اللاتى يعتدن الجلوس لفترات طويلة على مدار الأسبوع دون مزاولة نشاط حركى يكن الاكثر عرضة للإصابة بمرض السكر النوع الثانى .
وكانت الابحاث قد أجريت على مجموعة من السيدات والرجال تم دراسة عاداتهم السلوكية والغذائية ليتم تتبعهم لنحو أربعة أعوام. ولوحظ أن السيدات اللاتى بلغت ساعات جلوسهن مابين 4 إلى 7 ساعات يوميا ارتفعت بينهن فرص الاصابة بالسكر فى الوقت الذى لم تلاحظ هذه الظاهرة بين الرجال الذين يجلسون لنفس الفترة الزمنية يوميا .

nosa_aic
28 - 02 - 2012, 07:22
التهاب الجيوب الانفية

- الجيوب (sinuses) شكل من التجاويف المملوءة بالهواء(مساحات مليئة بالهواء) تحيط بالعينين والأنف،
وتوجد داخل عظام الجمجمة، وهي ترتبط بتجاويف الأنف عبر فتحات صغيرة.
- إلتهاب[/URL] ا الجيوب لأنفية هو إلتهاب الغشاء المحيط بالجيوب.
- هذه التجاويف معقمة ومبطنة بغشاء رقيق يفرز المخاط ،وتقوم خلايا شعرية بكسح المخاط لطرد الجسيمات
الغريبة والكائنات الدقيقة مثل البكتيريا والفيروسات وكذلك ذرات الغبار.
- في الأحوال الطبيعية يحدث تصريف المخاط من خلال فتحات صغيرة بين الجيوب الانفية الأنف.
ويحدث إلتهاب الجيوب الأنفية عندما يقع إنسداد لهذا النظام الطبيعي في الصرف
- يعتقد الأطباء أن (http://www.libyanyouths.com/vb/t133248.html) الجيوب لها دور في تعديل نوعية الصوت.
- يرافق غالبآ إلتهاب الجيوب لعداوي التي تصيب السبيل التنفسي العلوي كالزكام أو حمى الكلأ،
ويكون الوضع مؤلمآ ومزعجآ في كلا الحالتين.
- يشفى إلتهاب الجيوب عادة بدون علاج لكن قد يعاود الظهور بأعراض أكثر حدة.
- في الحالات الحادة قد تستمر نوبات إلتهاب الجيوب أشهر عديدة.
- نادرآ ما يعاني الصغار من هذه الحالة لأن (http://www.libyanyouths.com/vb/t133248.html) الجيوب لا يكتمل نموها حتى عمر الأربع أو الخمس سنوات.

العلامات والأعراض

- الصداع(ألم في الرأس)
- الحمى(إرتفاع في الحرارة)
- إنسداد الأنف وتفريغ أنفي ملطخ( أنف مسدود ومتقرح مع إفراز كثيف)
- الإحساس بالألم فوق الجيب المصاب.
- إحمرار حول العينين في بعض الأحيان.
- الشعور بإمتلاء الرأس عند الإنحناء إلى الأمام.
- ألم في العينين أو الخدين.
- في بعض الأحيان يرافق الحالة ألم في الأسنان الموجودة أسفل الجيب الأنفي مباشرة.
- رعشات القشعريرة.
- وهن يبلغ من الشدة حدآ يجعل المريض يلازم الفراش.

مواضع وأسماء الجيوب

تسمى الجيوب المختلفة بإسم العظام الموجودة فيها، فالجيوب الفقمية تقع في عظام الخد
أما جيوب الجبهة فتقع في الفسحة الموجودة فوق الحاجبين
في حين تقع الجيوب (http://www.libyanyouths.com/vb/t133248.html) الغربالية والوتدية داخل الجمجمة

ماالذي يسبب إلتهاب الجيوب؟

- بشكل عام يحصل إلتهاب الجيوب الأنفية نتيجة العدوى بإحدى فيروسات الزكام الشائعة( نتيجة إلتهاب الأنف
الناجم عن الزكام أو الإنفلونزا) وقد تنسد هذه الجيوب وتمتليء بالسوائل مسببة ألمآ في الوجه.
وتحدث معظم الأعراض بعد ثلاثة إلى عشرة أيام من الإصابة بالزكام.
- يمكن لحمى القشع والحساسيات الأخرى أن تسبب إلتهاب الجيوب الأنفية.

تدابير بسيطة للمساعدة والعناية الذاتية

- مسكنات الألم البسيطة.
- ابق في الداخل في حرارة معتدلة.
- إمتنع عن الإنحناء مع إمالة الرأس إلى الاسفل.
- إستعمال كمادات دافئة على الوجه.
- أخذ قسط من الراحة إذا كان المريض محمومآ وغير مرتاح.
- تجنب الأجواء المليئة بالدخان.
- تجنب التعرض الطويل للغبار والمواد المهيجة.
- عدم التمخط بشدة أثناء الإصابة بالزكام لأن هذا يمكن أن يدفع العدوى بإتجاه الجيوب.
- تناول الأقراص المزيلة للإحتقان التي تتوفر في الصيدليات.
- إستعمل قطرة الماء والملح.
- إشرب الكثير من السوائل (8 اكواب يوميآ ، وكل كوب يكون على الاقل سعة 200 مل) حتى تحافظ على سيولة المخاط وتدفقه.
- تجنب ركوب الطائرة عندما تكون مصابآ باحتقان، فالتغير في الضغط الجوي قد يدفع المخاط إلى إلى داخل الجيوب (http://www.libyanyouths.com/vb/t133248.html) الانفية
واذا اضطررت لركوب الطائرة فاستعمل مزيل الاحتقان قبل الاقلاع واستعمل بخاخ الانف المزيل للاحتقان قبل هبوط الطائة بحوالي 30 دقيقة.
- تجنب ممارسة رياضة الغوص الى ان تشفى من الاتهاب الجيوب الانفية تمامآ
- خذ دشآ دافئآ.
- احتس طبقآ من الشوربة الساخنة.
- إستنشاق البخار مستخدمآ فوطة لتصنع خيمة فوق مصدر البخار
(أفضل علاج لترخية الإفرازات الموجودة في الجيوب ويساعد على تصريفها بشكل أسهل)
حيث يتم إستنشاق البخار من وعاء فيه ماء مغلي لمدة بضع دقائق كل مرة.


متى يجب زيارة الطبيب؟

- إذا إستمرت أو لم تتحسن الأعراض خلال 3 إلى 7 أيام .
- إذا تكررت الأعراض بشكل مفاجيء(ثلاث مرات في السنة) مع ألم شديد وحمى
( وينشأ هذا الداء الثانوي نتيجة عدوى بكتيرية).
- إذا أصبت بإلتهاب في العين.

إجراءات التشخيص

- يقوم الطبيب بالضغط على الوجنتين والجبهة للتأكد من عدم وجود أي إيلام فيهما.
- يقوم أيضآ بفحص فمك وزورك والممرات الأنفية.
- وقد يقوم بتسليط ضوء عبر الجلد للتأكد ما إذا كانت الجيوب شفافة ورائقة.
- سوف يطلب لك أيضآ صوة للجيوب بالأشعة السينية (أشعة مقطعية) إذا إشتبه بوجود إلتهاب جيوب مزمن.

إلتهاب الجيوب المزمن

عندما تصاب بعدوى قصيرة الامد وبشكل متكرر في (http://www.libyanyouths.com/vb/t133248.html) الجيوب، فهي تبدو وكأنها غير قابلة للشفاء،
ويسمى هذا الشكل من المرض بإلتهاب [URL="http://www.libyanyouths.com/vb/t133248.html"] الجيوب الانفية المزمن.
ورغم أن السبب غير معروف إلى حد الان، لكن يلاحظ أن التدخين والتعرض للملوثات الصناعية
يجعلان الحالة تسوء أكثر.
وتتحسن الأعراض عادة عن طريق رذاذ الأنف الستيرودي.
وفي بعض الحالات الحادة جدآ يتم غسل الجيوب وصرف السائل منها عند طبيب أنف أذن حنجرة.
وقد تحتاج إلى إجراء عملية جراحية لتحسين جريان المادة المخاطية في الأنف.

العلاج الطبي

- إذا كان الإلتهاب لا يحوي أي عدوى بكتيرية فقد يصف لك الطبيب الأقراص المزيلة للإحتقان و بخاخات الأنف
لتقليص الأغشية المخاطية المتضخمة والسماح بصرف المخاط، أو حبوبآ مضادة للهستامين أو كورتيزن أنفيآ
على شكل بخاخ لتخفيف حدة الإلتهاب.
- إذا تبين أنك تعاني من عدوى بكتيرية ثانوية فسيصف لك مضادآ حيويآ لمدة 7 إلى 14 يومآ.
- الجراحة(بإستخدام مناظير دقيقة تدخل من المنخرين إلى فتحات الجيب دون عمل أي قطع جراحي بجلد الوجه)
عندما تتكرر نوبات العدوى الميكروبية التي تصيب الجيب الأنفي بالرغم من العلاج.
وتهدف الجراحة إلى توسعة فتحات الجيب الأتفي التي إعتراها الضيق على جلب الراحة.

ابو مالك
28 - 02 - 2012, 07:54
http://t0.gstatic.com/images?q=tbn:ANd9GcQJeUVUKK7apdZPILC3FqlmS59SIr8jg JExFGSF0Tyf88PzXzVlBg

nosa_aic
29 - 02 - 2012, 05:29
الإفراط فى الحبوب المنومة يؤدى للإصابة بخمسة أنواع من السرطان


حذر الباحثون بمركز "سكريبس كلينيك فيتبرى" المتخصص فى اضطرابات النوم بولاية كاليفورنيا الأمريكية، من الإفراط فى تناول الحبوب المنومة الذى انتشر مؤخرا بين الأمريكيين، مؤكدين أن استخدامها يرتبط بزيادة خطر الإصابة ببعض أنواع السرطانات.
وأشار الباحثون بالمركز -فى تصريح على شبكة الانترنت- إلى أن خطر الإفراط فى تناول الحبوب المنومة لايقف عند هذا الحد بل يتجاوزه إلى تهديد حياة مستهلكيها بالوفاة بمعدل أربعة أضعاف، وأن الخطر كان أعلى بين من تراوحت أعمارهم بين 18 و55 عاما.
وذكروا أن الحبوب المنومة رائجة الاستخدام ترتبط بزيادة هائلة فى الوفيات وزيادة مروعة فى إصابة الأشخاص بسرطان المرىء والغدد اللمفاوية والرئة والقولون والبروستاتا، حيث كشف إحصاء أجرى خلال عام 2010 أن واحدا من بين كل 20 أمريكيا يتناولون هذه الحبوب بدرجة تصل إلى الإدمان.
وتابع فريق البحث بالمركز على الطبيعة أكثر من عشرة آلاف و500 شخص فى أعمار حول الرابعة والخمسين تناولوا الحبوب المنومة لمدة سنتين ونصف بسبب معاناتهم من
مشاكل صحية، وقارن العلماء خطر الموت والإصابة بالسرطان لدى هذه الفئة مقارنة بفئة أخرى لم تتناول هذه الحبوب.
وأظهرت المقارنة أن من وصفت لهم الحبوب المنومة كعلاج بمعدل 18 جرعة فى السنة، كانوا أكثر عرضة للموت بمعدل 3.5 مرات بالمقارنة مع من لم توصف لهم هذه الحبوب،
فيما سجل من وصفت لهم بمعدلات تجاوزت 18 جرعة إلى 132 جرعة فى العام، فقد كانوا أكثر عرضة للموت 4 مرات، ومن تخطت الجرعات لديهم هذا المعدل زاد الخطر لديهم 5 مرات.

nosa_aic
29 - 02 - 2012, 05:42
القرفة تحارب الوزن الزائد والكوليسترول والسكرى (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/169701-%D8%A7%D9%84%D9%82%D8%B1%D9%81%D8%A9-%D8%AA%D8%AD%D8%A7%D8%B1%D8%A8-%D8%A7%D9%84%D9%88%D8%B2%D9%86-%D8%A7%D9%84%D8%B2%D8%A7%D8%A6%D8%AF-%D9%88%D8%A7%D9%84%D9%83%D9%88%D9%84%D9%8A%D8%B3%D 8%AA%D8%B1%D9%88%D9%84-%D9%88%D8%A7%D9%84%D8%B3%D9%83%D8%B1%D9%89)



http://www.alwafd.org/images/news/1220737356ser555.jpg





القرفة من البهارات التي تستعمل كثيراً في العالم العربي إذ تضفي مذاقاً رائعاً على الأطعمة، وفوائدها عديدة وتحتوي على كمية كبيرة من المواد الغذائية الجيدة مثل البروتينات والدهون والألياف والكالسيوم والفوسفور والحديد والصوديوم والبوتاسيوم.
تملك القرفة فعالية سحرية في الحدّ من الشهية تجعلها من أكثر الأغذية مقاومةً للبدانة وزيادة الوزن كما تساعد في تذويب الدهون. لذا فهي تساعدك في الحصول على جسم رشيق وتسهم في خفض مستوى الكوليسترول في الدم.
من جهة أخرى، أثبتت دراسة أمريكية باكستانية أنّ القرفة تساعد في تحسين مستوى السكري في الدم، خصوصاً لدى الأشخاص الذين يعانون من السكري من النوع الثاني. فالقرفة تساعد في رفع إنتاج الإنسولين في الجسم وتدفع خلايا الجسم إلى امتصاص السكر بطريقة أفضل.
يذكر أنّ القرفة تقوّي جهاز المناعة، وتحول دون إصابة الجسم بالبكتيريا، وتعالج الالتهابات، وتريح الأعصاب وتقضي على نزلات البرد الحادة.

nosa_aic
02 - 03 - 2012, 19:14
قرح الفم المؤلمة


الكل بلا استثناء حدثت له قرحة الفم في وقت من الاوقات بالطبع كان لا يعلم السبب ..

ولا يعلم لماذا خفت دون علاج ..ولا يعرف انواعها .. سنتطرق الي هذه القضيه الان ..


ما هي ..؟

هي جروح صغيره مؤلمه تتكون داخل الفم [/URL] . تكون على حدود اللثه او مقابل الفكين او في سقف الفم هذه مشكله تحدث لكل الناس ولكنها تتكرر كثيرا عند بعض الناس ..هي غير معدية ولا يمكن ان تنتقل من شخص الي اخر .
معظم هذه القرح تزول وحدها في فتره من اسبوع الي اثنين ولكن العلاج يقي من المضاعفات ويقلل الاحساس بالالم


الاسباب ..

معظم القرح الفرديه ..تكون بسبب جرح في الفم (http://www.libyanyouths.com/vb/t133351.html) ..بعض العائلات تتكرر لهم قرح الفم ومعظم الاطفال والبالغين اكثر عرضه لحدوث القرح . الطلبة الذين يتعرضون لضغط شديد ايام الامتحانات معرضون للاصابه وكذلك الحوامل .. وهنا اسباب اخري مثل
- الحراره الساخنه للطعام او المشروبات ..
- ان يعض الانسان نفسه من الداخل
- غسل الاسنان بطريقه عنيفه
- الاسنان المصابه
- القلق والضغط النفسي الشديد
- بعض الادوية ..


الاعراض ..


معظم القرح مدورة الشكل واقل من 1 سم وتاخذ اللون الاصفر او الابيض او الرمادي وتكون حمراء ومنتفخه ولها حاجز
قد تكون مؤلمه جدا عند الاكل او الشرب


العلاج ..


تزول وحدها خلال فتره من اسبوع الي اسبوعين بدون علاج ..ولكن العلاج يقلل من الاصابه بعدوي بكتيريه

- مرهم .. بعض المراهم التي تحتوي على مضادات الالتهابات
- الجيل .. من الطبقه الواقيه للقرحه مرورا بالقرحه نفسها ولا ينصح باستخدام كميات كبيره
- غسول للفم .. مفيده اذا كان صعب الوصول الي القرحه وتستطيع ان تمنع العدوي البكتيريه وتقلل من الالم
- من الممكن اخذ باراسيتامول مسكن للالم ..


وسائل طبيعيه للتخفيف من الالم ..


- امتصاص اي منتج ثلجي يفيد في تقليل الالم
- تجنب الشطه والاكل الحارق
- تجنب الاكل الحار جدا وكذلك المشروبات الساخنه
- ترفق وانت تغسل اسنانك بالفرشاه
- من المستحب اخذ فيتامين ب و سي
- حاول ان تشرب الكثير من الماء لتمنع جفاف الفم

متي تزور الطبيب ؟

يجب ان تزور الطبيب على وجه السرعه اذا كان
- مساحه القرحه اكبر من 1 سم او انك مصاب بعده قرح صغيره وتجمعت مع بعضها
- لم تزول خلال من 3 الي 4 اسابيع بالعلاج
- تنزف
- اذا كانت تتكرر في وقت قصير كل اسبوع مثلا
- تاتي بالتهاب في الحلق
- اذا كانت غير مؤلمه ابدا


الوقاية ..

الاهتمام بنظافه [URL="http://www.libyanyouths.com/vb/t133351.html"] (http://www.libyanyouths.com/vb/t133351.html)الفم.. الغذاء المتوازن .. تقليل استهلاك الحلوى والسكريات
تجنب الشرب والاكل الساخن جدا
تجنب الاكلات الحامضيه او الحراقه
تجنب الامراض التي تنقل عن طريق الجنس لانها تسبب بعض انواع القرح
لو كنت تدخن ..تمتنع عن التدخين ..

ابو مالك
04 - 03 - 2012, 08:37
http://img.dreamtype.com/i/island/a/4c9c/jpg?quality=90&msg=nosa_aic%0D%0A%20%D8%B5%D8%A8%D8%A7%D8%AD%20%D 8%A7%D9%84%D9%81%D9%84%20%D9%88%D8%A7%D9%84%D9%8A% D8%A7%D8%B3%D9%85%D9%8A%D9%86



(http://www.dreamtype.com/#)
(http://www.dreamtype.com/#)
(http://www.dreamtype.com/#)
(http://www.dreamtype.com/#)
(http://www.dreamtype.com/#)

nosa_aic
05 - 03 - 2012, 15:43
http://img.dreamtype.com/i/island/a/4c9c/jpg?quality=90&msg=nosa_aic%0D%0A%20%D8%B5%D8%A8%D8%A7%D8%AD%20%D 8%A7%D9%84%D9%81%D9%84%20%D9%88%D8%A7%D9%84%D9%8A% D8%A7%D8%B3%D9%85%D9%8A%D9%86



(http://www.dreamtype.com/#)
(http://www.dreamtype.com/#)
(http://www.dreamtype.com/#)
(http://www.dreamtype.com/#)
(http://www.dreamtype.com/#)
مساء الخير اخى الفاضل

و شكرا جزيلا لحضرتك


http://dl3.glitter-graphics.net/pub/1454/1454583ng4euc3mnl.gif

nosa_aic
06 - 03 - 2012, 20:09
مشروب غازى واحد فى اليوم يزيد مخاطر أمراض القلب (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/172554-%D9%85%D8%B4%D8%B1%D9%88%D8%A8-%D8%BA%D8%A7%D8%B2%D9%89-%D9%88%D8%A7%D8%AD%D8%AF-%D9%81%D9%89-%D8%A7%D9%84%D9%8A%D9%88%D9%85-%D9%8A%D8%B2%D9%8A%D8%AF-%D9%85%D8%AE%D8%A7%D8%B7%D8%B1-%D8%A3%D9%85%D8%B1%D8%A7%D8%B6-%D8%A7%D9%84%D9%82%D9%84%D8%A8)



http://www.alwafd.org/images/news/594957564uurfe6m4.jpg




أظهرت دراسة طبية حديثة أجراها باحثون أمريكيون بجامعة بوسطن الأمريكية أن مجرد تناول مشروب غازي واحد في اليوم سواء كان محلى أو لا (دايت) قد يزيد من مخاطر التعرض لأمراض القلب والشرايين.
وأرجع الباحثون ذلك إلى أن عادة تناول المشروبات الغازية تزيد من مخاطر تدهور عملية "التمثيل الغذائي" التي تحفز القلب وتعرض الجسم لأمراض مختلفة مثل السكر والضغط والأزمات القلبية.
وقال الباحث بجامعة بوسطن الامريكية "فاسان" إن تناول مشروب غازي واحد فقط في اليوم قد يزيد من مخاطر تدهور "التمثيل الغذائي" بمعدل قد يصل إلى 50 فى المائة..مشيرا إلي أن تلك الدراسة أضافت للأدلة العلمية أن المشروبات الغازية المحلاة بالسكر تزيد من سوء التمثيل الغذائي.
وأضاف: أن زيادة استهلاك المشروبات الغازية يساهم فى الاصابة بالسمنة المفرطة ومرض السكر، والذى ينتشر بصورة ملحوظة بين شريحتي الأطفال والمراهقين بخلاف ارتفاع ضغط الدم لدى البالغين والذى يهدد حياتهم بشكل كبير.

nosa_aic
06 - 03 - 2012, 20:20
دراسة تحذر من النوم مباشرة بعد سماع الاخبار السيئة

كشفت دراسة علمية حديثة أجراها باحثون أمريكيون بجامعة "ماساتشوستس أمهرست" بالولايات المتحدة الامريكية النقاب عن أنه من الافضل عدم ذهاب الانسان للنوم بعد وقوع إحدى المشكلات الصعبة أو بعد سماع أيا من الاخبار غير السارة لأن الذاكرة تقوم بتخزين تلك الافكار السيئة الامر الذى قد يؤثر على صحة الانسان النفسية والبدنية ويعكر صفو الحياة فيما بعد .


وقال الباحثون أن الدراسة الحديثة تناقض بعض الدراسات السابقة التى كانت تؤكد أن الخلود الى النوم مباشرة بعد التعرض للمشاكل الاجتماعية أو النفسية يساعد على التخلص من المشاعر السلبية ويصبح الانسان أكثر قدرة على إتخاذ القرار والتفكير بعد الاسيتقاظ مباشرة.

وأظهرت الدراسة أن الانسان إذا تعرض مثلا لرؤية مشهد مفزع لإحدى الحوادث اليومية وطلب منه تذكر هذا المشهد من جديد فقدرته على تذكر تفاصيل المشهد وأحداثه السيئة ستكون أقل بكثير إذا ظل هذا الشخص مستيقظا بعد رؤيته للحادث ، وسيكون أقل توترا وإنزعاجا على عكس ما إن ذهب للنوم بعدهامباشرة[/URL] فستطارده الكوابيس والرؤى والمزعجة حول الحادث لعدة أيام.

وأشار الباحثون الى أن تلك الدراسة ستعود بالنفع على الاشخاص الذين يعانون من إضطرابات ما بعد الصدمة والاشخاص الذين تستعن بهم المحكمة كشهود عيان فى القضايا والجرائم لأخذ أقوالهم .

وأجريت الدراسة على مجموعة من الشباب بلغ عددهم 106 شباب عن طريق عرض بعض الصور التى تحتوى على مناظر مزعجة وطلب منهم التعبير عن إختلاف استجابتهم العاطفية نحو تلك الصور وتم عرض مجموعة من الصور الاخرى بعد 12 ساعة كاملة لمعرفة إستجابتهم العاطفية نحو مجموعة الصور .

وجاءت نتائج الدراسة موضحة أن الاشخاص الذين خلدوا الى النوم مباشرة[URL="http://www.libyanyouths.com/vb/t127459.html"] (http://www.libyanyouths.com/vb/t127459.html) بعد رؤيتهم لتلك الصور تخزنت بعقولهم المشاعر السلبية وكانوا أكثر معاناة من الاشخاص الذين ظلوا مستيقظين بعدا بفترة كافية .

اميره اميره
07 - 03 - 2012, 07:21
http://n4hr.org/up/uploads/n4hr_13232510123.gif





http://www.mkgedu.gov.sa/up//uploads/images/mkgedu-6a5a3f5117.jpg







http://www.greenandcleanmom.org/wp-content/uploads/2008/08/breakfast.jpg

boomakady
08 - 03 - 2012, 10:31
صبـــاح الخيــر
صباح النور والامل


http://i3.tagstat.com/image07/6/131f/00u3055hxcv.gif http://j4.tagstat.com/image04/1/8469/00bY053IohF.gif



http://i0.tagstat.com/image04/9/ecad/00en052KuOJ.gif

اميره اميره
08 - 03 - 2012, 15:22
بسم الله الرحمن الرحيم
http://www.noorfatema.net/up/uploads/12988442461.gif

nosa_aic
09 - 03 - 2012, 05:15
صبـــاح الخيــر
صباح النور والامل


http://i3.tagstat.com/image07/6/131f/00u3055hxcv.gif http://j4.tagstat.com/image04/1/8469/00bY053IohF.gif


http://i0.tagstat.com/image04/9/ecad/00en052KuOJ.gif



بسم الله الرحمن الرحيم
http://www.noorfatema.net/up/uploads/12988442461.gif


و عليكم السلام و رحمة الله و بركاته

http://www.lamst-a.net/upfiles/8ww74250.jpg


:cgiving:

nosa_aic
09 - 03 - 2012, 05:56
البصل يتصدر قائمة الأطعمة الجالبة للسعادة (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/174284-%D8%A7%D9%84%D8%A8%D8%B5%D9%84-%D9%8A%D8%AA%D8%B5%D8%AF%D8%B1-%D9%82%D8%A7%D8%A6%D9%85%D8%A9-%D8%A7%D9%84%D8%A3%D8%B7%D8%B9%D9%85%D8%A9-%D8%A7%D9%84%D8%AC%D8%A7%D9%84%D8%A8%D8%A9-%D9%84%D9%84%D8%B3%D8%B9%D8%A7%D8%AF%D8%A9)



http://www.alwafd.org/images/news/34198102amuy46uw.jpg




أفادت دراسة طبية بريطانية حديثة بأن البصل يعد من أكثر الأطعمة التي تجلب السعادة والشعور بالمرح والسرور يليه الجزر والفول والموز ثم البطاطس.
وفندت الدراسة التي أجريت على 100 من السلع الغذائية الأساسية رخيصة الثمن لمعرفة مدى السعادة التي يشعر بها الإنسان بعد تناولها ،حسبما ذكرت صحيفة "الديلي أكسبرس" البريطانية، المقولة السائدة بأن الشيكولاته هي سر السعادة ، مشيرة إلى أن البصل تصدر رغبات من شملتهم الدراسة وتفوق على أطعمة أخرى مشهورة بجلب السعادة مثل الشيكولاته والكعك.
من جهة أخرى ، قال باحثون بجامعة برن في سويسرا أن تناول البصل باستمرار يفيد في الوقاية من هشاشة العظام خاصة عند السيدات المسنات ، مشيرين إلى أنهم اكتشفوا من خلال تجارب معملية أجروها على الفئران مركبا طبيعيا موجود في البصل له دور فعال في تقوية العظام وتقليل خطر إصابتها بالهشاشة.

ابو مالك
09 - 03 - 2012, 12:05
http://t3.gstatic.com/images?q=tbn:ANd9GcQSFyu1P1bkKLrW6qCjsnZnecy6RpQvF TTRqmJR0c8KtuBVpzLXyLiXrfCEwg

hanan desoky
09 - 03 - 2012, 12:40
http://www.geek4arab.com/vb/imgcache/2/17025_geek4arab.com.gif (http://www.geek4arab.com/vb/showthread.php?t=18446)

boomakady
09 - 03 - 2012, 13:56
اللهم إني أسالك .. بعدد من سجد لك في حرمك المكرم من يوم .. خلقت الدنيا إلى يوم القيامة .. أن تعافي قارئ هذا الدعاء وتحفظ أسرته وأن تبارك عمله وتسعد قلبه و تفرج كربه و تيسر أمره وأن تبارك جمعته وسائرأيامه... آمين وجمعة مباركة

nosa_aic
10 - 03 - 2012, 12:52
http://t3.gstatic.com/images?q=tbn:ANd9GcQSFyu1P1bkKLrW6qCjsnZnecy6RpQvF TTRqmJR0c8KtuBVpzLXyLiXrfCEwg


http://www.geek4arab.com/vb/imgcache/2/17025_geek4arab.com.gif (http://www.geek4arab.com/vb/showthread.php?t=18446)


اللهم إني أسالك .. بعدد من سجد لك في حرمك المكرم من يوم .. خلقت الدنيا إلى يوم القيامة .. أن تعافي قارئ هذا الدعاء وتحفظ أسرته وأن تبارك عمله وتسعد قلبه و تفرج كربه و تيسر أمره وأن تبارك جمعته وسائرأيامه... آمين وجمعة مباركة


اللهم اميييييييين


http://up.ejaaba.com/uploaded/20120129/QDL8_1327863386.gif (http://up.ejaaba.com/uploaded/20120129/QDL8_1327863386.gif)

nosa_aic
11 - 03 - 2012, 04:30
سرطان القولون يمكن الشفاء منه فى حالة اكتشافه مبكرا



http://img.youm7.com/images/NewsPics/large/smal3201010213431.jpg

ينصح أطباء المعدة والأمعاء فى فرنسا المرأة والرجل على حد سواء فى الفترة العمرية مابين 50 عاما حتى 74 عاما، بضرورة استشارة الطبيب المختص وعمل فحص كل عامين، للكشف عن حالات الإصابة بسرطان القولون، حيث أثبت الدراسات أنه من بين 10 حالات إصابة بسرطان القولون يمكن شفائها فى حالة الكشف المبكر.


ويرى الأطباء أن الأشخاص الذين لديهم أحد من أفراد الأسرة مصاب لديهم بنسبة تتراوح مابين 15\% إلى 20\% احتمال بالإصابة، لذلك يجب الفحص المبكر خاصة بعد بلوغهم الخمسين من العمر، حيث إن سرطان القولون يصيب 94\% من هؤلاء وأن هناك 40 ألف حالة سرطان قولون فى فرنسا سنويا.

nosa_aic
11 - 03 - 2012, 04:48
ثلاث حبات من الفستق لقوام رشيق (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/175588-%D8%AB%D9%84%D8%A7%D8%AB-%D8%AD%D8%A8%D8%A7%D8%AA-%D9%85%D9%86-%D8%A7%D9%84%D9%81%D8%B3%D8%AA%D9%82-%D9%84%D9%82%D9%88%D8%A7%D9%85-%D8%B1%D8%B4%D9%8A%D9%82)



http://www.alwafd.org/images/news/1772822776ser1781.jpg




أظهرت دراسة أمريكية حديثة أن تناول المكسرات بصورة منتظمة خاصة "الفستق" يساهم بصورة كبيرة في خفض مخاطر الاصابة بالامراض الخطيرة بالاضافة إلى المساعدة على الحصول على جسم رشيق متناسق.
وأوضحت الابحاث أن تناول ثلاث حبات من المسكرات يوميا يلعب دورا مهما فى الوقاية من الامراض الخطيرة مثل أمراض القلب والسكر واختلال آلية التمثيل الغذائى فى الجسم.
وكانت الابحاث الطبية قد قامت بدراسة وفحص أكثر من 13 ألف شخص خلال الفترة من 1999 - 2004 ودراسة عاداتهم الغذائية حيث وجد أن تناول ثلاث حبات من المسكرات خاصة "الفستق" يساعد فى تخفيض فرص الاصابة بالبدانة خاصة فى منطقة البطن وضغط الدم المرتفع ونسبة السكر فى الدم بالاضافة إلى تراجع مستوى الكوليسترول السيئ فى الدم.
وتشير البيانات إلى أن تناول الفستق باعتدال يخفض بنسبة 22% فرص الاصابة بالبدانة وفى مقابل 17% خفض فى تراكم الدهون والسمنة فى منطقة البطن بالمقارنة بالاشخاص الذين لم يتناولوه.

nosa_aic
14 - 03 - 2012, 05:45
التوت مفيد للدماغ لاحتوائه على مضادات الأكسدة (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/177278-%D8%A7%D9%84%D8%AA%D9%88%D8%AA-%D9%85%D9%81%D9%8A%D8%AF-%D9%84%D9%84%D8%AF%D9%85%D8%A7%D8%BA-%D9%84%D8%A7%D8%AD%D8%AA%D9%88%D8%A7%D8%A6%D9%87-%D8%B9%D9%84%D9%89-%D9%85%D8%B6%D8%A7%D8%AF%D8%A7%D8%AA-%D8%A7%D9%84%D8%A3%D9%83%D8%B3%D8%AF%D8%A9)



http://www.alwafd.org/images/news/1247717032as16.jpg




كشفت الأبحاث الطبية أن تناول التوت بصورة منتظمة يعمل على إبقاء خلايا الدماغ فى حالة جيدة ويحمي من العديد من الأمراض لاحتوائه على كميات وفيرة من مضادات الاكسدة التى تعمل على حماية خلايا الدماغ من التلف.
وتوصل الباحثون إلى أن التوت يعزز كفاءة الخلايا العصبية بالدماغ وهي المسؤولة عن حماية الدماغ من الإصابة بالالتهابات . وعلى الرغم من هذه النتائج الايجابية، يرى الباحثون أن هناك حاجة لإجراء المزيد من الابحاث لمعرفة المزيد من الفوائد الصحية التى يوفرها تناول التوت وايجابياته في حماية خلايا الدماغ ووظائف الجسم.

nosa_aic
14 - 03 - 2012, 05:47
العلماء يتغلبون على حساسية البيض (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/177465-%D8%A7%D9%84%D8%B9%D9%84%D9%85%D8%A7%D8%A1-%D9%8A%D8%AA%D8%BA%D9%84%D8%A8%D9%88%D9%86-%D8%B9%D9%84%D9%89-%D8%AD%D8%B3%D8%A7%D8%B3%D9%8A%D8%A9-%D8%A7%D9%84%D8%A8%D9%8A%D8%B6)



http://www.alwafd.org/images/news/1322183610as75.jpg




كشفت دراسة حديثة أن العلماء استطاعوا التغلب على مشكلة الحساسية التي يسببها بياض البيض عند تناوله خاصة عند الأطفال والرضع.
وذكر الباحثون من "جامعة ديكن" في مدينة "جيلونج" الأسترالية أنهم استطاعوا إيقاف تأثير المواد المسببة للحساسية في البيض والتي من الممكن أن تسبب صدمة حساسية قاتلة عند الآلاف من الأطفال، حيث قام فريق البحث بعزل المواد الأربعة الأساسية المسببة للحساسية والموجودة في بياض البيض ثم إعادة إدخال البروتين مرة أخرى في البيض الذي يعمل على إنتاج الدواجن والتي بدورها تضع بيض خالي من المواد المسببة للحساسية.
ومن جانبه، قال "سينك سوفيوجلو" أستاذ بجامعة "ديكن" وأحد أعضاء فريق البحث "إن إنتاج بيض خال من المواد المسببة للحساسية يشعر آلاف الآباء والأمهات بالراحة تجاه طعام أبنائهم، ومن المضحك أن الآباء يغذون أطفالهم الرضع بأي من منتجات البيض لأول مرة في مواقف السيارات بجوار المستشفيات الكبرى لكي يكونوا بالقرب من العناية الطبية خوفا من حدوث أي أضرار إثر تناول البيض."
وأضاف البروفسير "تيم دوران" مدير مشروع البحث الذي دام لثلاث سنوات "نحن لانقوم بإنتاج دجاج معدل وراثيا كجزء من هذا البحث، بل نحن لا نقوم سوى بتعديل البروتينات الموجودة في زلال البيض لإنتاج دواجن تضع بيضا خاليا من المواد المسببة للحساسية."
ويأمل الفريق أن يملأ البيض الخالي من المواد المسببة للحساسية أسواق الطعام والمولات التجارية في فترة تتراوح من 5 إلى 10 سنوات.

nosa_aic
15 - 03 - 2012, 03:03
تناول العصائر يؤدى إلى الإصابة بأمراض القلب (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/177903-%D8%AA%D9%86%D8%A7%D9%88%D9%84-%D8%A7%D9%84%D8%B9%D8%B5%D8%A7%D8%A6%D8%B1-%D9%8A%D8%A4%D8%AF%D9%89-%D8%A5%D9%84%D9%89-%D8%A7%D9%84%D8%A5%D8%B5%D8%A7%D8%A8%D8%A9-%D8%A8%D8%A3%D9%85%D8%B1%D8%A7%D8%B6-%D8%A7%D9%84%D9%82%D9%84%D8%A8)



http://www.alwafd.org/images/news/1182436551jzvuo78c.jpg



كشفت دراسة أمريكية حديثة أجراها باحثون بكلية الصحة العامة بجامعة هارفارد أن تناول الأشخاص للعصائر ومشروبات الطاقة له تأثير ضار على الصحة
العامة للانسان حيث يؤدى إلى الإصابة بأمراض القلب وتراكم الشحوم فى البطن وانخفاض معدل الكولسترول "الجيد" إضافة إلى زيادة نسبة السكر فى الدم.
وأرجع الباحثون ذلك لاحتواء تلك المشروبات على سعرات حرارية مرتفعة تتراوح ما بين 120 و200 سعر حرارى، حيث أجروا دراسة على عينة ضمت 43 ألف شخص أسفرت عن زيادة فرص الاصابة بالنوبات القلبية بين الأشخاص الذين اعتادوا على الاسراف فى تناول تلك المشروبات بنسبة 20% مقارنة بالأشخاص الذين لم يتناولوها.
وقال "فرانك هو" أخصائى علم التغذية والاوبئة بالجامعة فى تصريح اليوم إن زيادة استهلاك العصائر ومشروبات الطاقة بين عامى 1990 و2000 فى الولايات المتحدة فقط أدى إلى إصابة حوالى 130 ألف شخص بمرض السكر، و14 ألف إصابة بأمراض الشريان التاجى إضافة إلى 50 ألف حالة أصيبوا بأمراض القلب المختلفة.

nosa_aic
15 - 03 - 2012, 03:38
معلومات لمن يستخدم يده اليسرى (الاعسر[/URL] )

أثبت العلم أن تركبية الأعسر البيولوجيه جعلت منه بارعا ًفي علم الرياضيات وكافة أنواع الرياضة البدنية التي تتطلب مجهودا عاليا

تقول التقارير أن 60 % من الأطفال الأعسريون يبرعون في المواد التي تتطلب جهدا ذهنيا وجسمانيا وكان الاهل والمربون فيما مضى يربطون يد الطفل الأعسر خلف ظهره ليجبرونه على استخدام اليد اليمنى مما يتسبب في معاناته وعناده وكرهه لما يفعل

هذه طبيعة وتركيبة بيولوجية خلقه الله عليها ..ولا ضرر ابدا عليه منها بل على العكس فإنها سوف تكون مستقبلا مدعاة لنبوغه في عدة مواد دراسية تحتاج ذهنا متقدا وذكاءً عاليا ..

ويقول العلماء ربما يكون الأعسر متميزا في مهن معينة مثل الموسيقى وعلوم الرياضيات و يكون متفوقا رياضيا في العاب مختلفه مثل المبارزة بالسيف والتنس والكريكيت والبيسبول..

يعتقد علماء فرنسيون بأن الشخص الأعسر هو أكثر قدرة على المواجهة وله ميزة قتالية تفوق الشخص (http://www.libyanyouths.com/vb/t76770.html) الذي يتعامل بيده اليمنى.

وفي دراسة أجراها فريق من العلماء الفرنسيين نشرت في مطبوعة علمية قالوا أن الأعسر بطبيعته لديه قدرة أكبر على البقاء في المجتمع الذي يطغى عليه العنف..

و أوضحوا أنه نظرا لأن الأعسر يعتبر نفسه من الأقلية لذلك تكون دائما لديه ميزة إستراتيجية عند القتال .

و لم يكتشف العلم للآن الأسباب التى تؤدى الى العسرحيث أنها تعتبر حالة جسدية تجعل الشخص[URL="http://www.libyanyouths.com/vb/t76770.html"] يستعمل تلقائياً يده اليسرى بدلاً من اليمنى ولكن قد يرجع هذا لأسباب جينية وراثية .

حيث أن هناك دراسة علمية أجريت على 270 جنيناًَ (من عمر 3 الى 9 أشهر) وأظهرت أن حوالى 92% منهم يضع أصبعه الأيمن في فمه حتى قبل أن يولد.


دماغ الأعسر :

الشخص الذي يستخدم يده اليسرى هو عادة ما يتحكم به الفص الايمن من الدماغ حيث أن دماغ الانسان ينقسم الى كرتين منفصلتين - يربط بينهما جسر عصبي ضخم.. وكل نصف يهتم بوظائف ومواهب معينة وغالباً مايسيطر أحدهما على تصرفات الانسان. ويمكن بسهولة تحديد النصف المسيطر بتحديد اليد الاكثر استخداماً؛ فان كنت من مستعملي اليد اليسرى فهذه اشارة الى أن دماغك الأيمن المعاكس هو النصف المسيطر في رأسك. وان كنت من مستعملي اليد اليمنى فهذه اشارة الى سيطرة النصف الأيسر على تصرفاتك..

hanan desoky
17 - 03 - 2012, 16:48
http://imagecache.te3p.com/imgcache/3fa2be827df613dc131cbf82bd69f71b.gif

http://up.esgmarkets.com/uploads/images/esgm-97bf6b529b.gif (http://up.esgmarkets.com/)

اميره اميره
18 - 03 - 2012, 10:49
http://bullies.b.u.pic.centerblog.net/9e3a09ae.gif (http://bullies.b.u.pic.centerblog.net/9e3a09ae.gif)

nosa_aic
18 - 03 - 2012, 19:00
http://imagecache.te3p.com/imgcache/3fa2be827df613dc131cbf82bd69f71b.gif

http://up.esgmarkets.com/uploads/images/esgm-97bf6b529b.gif (http://up.esgmarkets.com/)


http://bullies.b.u.pic.centerblog.net/9e3a09ae.gif (http://bullies.b.u.pic.centerblog.net/9e3a09ae.gif)






http://forum.our-d.net/imgcache/2/172alsh3er.gif (http://www.dlu3at.net/vb/article46861.html) (http://www.dlu3at.net/vb/article46861.html)

nosa_aic
18 - 03 - 2012, 19:09
ملوثات الهواء تسبب الربو للأجنه في بطون الأمهات

http://imagecache.te3p.com/imgcache/0bd3a0c3f58b17627e783c4659dc8dab.jpg (http://www.dlu3at.net/vb/article55827.html)
ذكرت دراسة دنماركية
ان تعرض الام خلال فترة حملها
للملوثات الموجودة في الهواء
في عملها ربما يزيد من احتمال ان يصاب ابنها
الذي لم يولد بالربو فيما بعد.
وخلصت مراجعة بيانات مسجلة لعدد 45658 من الاطفال
في سن السابعة وامهاتهم الى ان 18.6 بالمئة
من اطفال الامهات اللائي تعرضن لجزيئات منخفضة
الوزن الجزيئي في العمل خلال فترة الحمل
اصيبوا بالربو
مقارنة بنسبة 16.1 بالمئة تعرضوا للتلوث العام.
وقال بريت كريستنسن
من كلية الصحة العامة بالدنمارك
الذي ترأس الدراسة في بيان
هذه اول دراسة على نطاق واسع توضح
وجود ارتباط بين تعرضات الامهات
خلال العمل والربو في الاطفال”.
وقدمت هذه الدراسة في الاجتماع السنوي
للجمعية الاوروبية للجهاز التنفسي في امستردام.
وبعد الاخذ في الاعتبار العمر
ومؤشر كتلة الجسم والحساسية
والحساسية المفرطة والتدخين
والعلاج والحيوانات الاليفة كان هناك خطر اعلى
بصورة طفيفة بنسبة حوالي 11 بالمئة للاصابة
بالربو في الاطفال عندما تتعرض امهاتهم الحوامل
لجزيئات منخفضة او مرتفعة الوزن الجزيئي.
ولم يجد الباحثون صلات بين الاصابة بالربو
في مجموعات التعرض الاخرى.
واستقبل الخبراء النتائج بحذر.
وقال كلاوس بونيليكي من مركز ربو الاطفال الدنمركي
الذي لم يشارك في البحث “نتائج مثل هذه
يجب ان يتم تفسيرها دائما بحذر حيث ربما
تتسبب في ارباك من عوامل حياة اخرى
ليس من السهل تعديلها”.
وقال لرويترز هيلث بالبريد الالكتروني “
على الرغم من ذلك فان هناك دليلا متزايدا
على ان فترة ما قبل الولادة ربما تكون فترة حاسمة
وتؤثر على خطر اصابة النسل فيما بعد بالربو
وامراض (الحساسية) الاخرى”.

mohamed_gad
18 - 03 - 2012, 19:22
الصحة: سعر قرص الفياجرا عشر جنيهات
القاهرة- أ ش أ: منذ 4 ساعة 58 دقيقة
قررت وزارة الصحة خفض سعر عقار الفياجرا بنسبة 60 % ليصل سعر القرص إلى 10 جنيهات بدلا من 27 جنيها حاليا، وذلك بناء على طلب الشركة المنتجة ومساهمة منها فى مكافحة الأدوية المغشوشة والمقلدة، وكذلك الأدوية مجهولة المنشأ ونظرا للوضع الاقتصادي للمواطن المصري في ظل الظروف الراهنة والذي يستخدم فى حالات الضعف الجنسي.
أعلن ذلك اليوم الأحد أمام المؤتمر الطبي حول "القدرة الجنسية بين الوهم والحقيقة" الذي تنظمه جمعية الشرق الأوسط للصحة الجنسية تحت شعار "المخدرات لزيادة القدرة الجنسية.. موروثة شعبية لخرافة رومانية " ويستمر لمدة يوم واحد .
وقال الدكتور حسين غانم أستاذ الأمراض التناسلية والذكورة في كلية طب القاهرة ، إن هناك دراسة للمركز المصري لمكافحة الإدمان تشير إلى أن تعاطي المخدرات وصل إلى 8 % ، أما عن الترامادول فبالرغم من عدم توافر احصائيات مؤكدة عنه فالأغلب أن إنتشاره يفوق هذه الاحصائيات بكثير، وذلك بناء على الزيادة فى أعداد المرضى المترددين على العيادات والأخبار المتكررة عن ضبط عشرات الملايين من الأقراص المهربة من هذا العقار.
وأضاف غانم أن الحقائق العلمية تؤكد أن المخدرات لاتزيد القدرة الجنسية بل على العكس تضرها ضررا بالغا .. مشيرا إلى أن هناك دراسة دانماركية أجريت على أكثر من 5500 رجل وامرأة عن تأثير المخدرات والحياة غير الصحية على القدرة الجنسية أوضحت أن استخدام المخدرات والتدخين والكحوليات وعدم ممارسة الرياضة تزيد من فرص حدوث
الضعف الجنسي بدرجة تصل إلى 22 ضعفا.
اقرأ المقال الأصلي علي بوابة الوفد الاليكترونية الوفد - الصحة: سعر قرص الفياجرا عشر جنيهات

nosa_aic
19 - 03 - 2012, 02:20
البطيخ يخفض ضغط الدم (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/179928-%D8%A7%D9%84%D8%A8%D8%B7%D9%8A%D8%AE-%D9%8A%D8%AE%D9%81%D8%B6-%D8%B6%D8%BA%D8%B7-%D8%A7%D9%84%D8%AF%D9%85)



http://www.alwafd.org/images/news/263926872sczxz.jpg



ذكر الباحثان في جامعة فلوريدا الدكتور أرتورو فيجويروا وبهرام أرجمندي أن البطيخ يحتوي على الحمض الأميني أرجينين وسيترولين الذي يحسن عمل الشرايين ويخفض ضغط الدم في الشريان الأبهر.
وقال فيجويروا إن البطيخ هو أغنى مصدر طبيعي بالسيترولين المرتبط بشكل وثيق بالأرجينين وهو الحمض الأميني الضروري لتكوّن حامض النتريك المساعد على تنظيم عمل الشرايين والحفاظ على معدل طبيعي لضغط الدم.
وأوضح فيجويروا أن السيترولين يتحول إلى أرجينين في الجسم، مشيراً إلى أن البطيخ هو أفضل مصدر طبيعي لحمض السيترولين المتوفر أيضاً بشكل صناعي على شكل أقراص

ابو مالك
19 - 03 - 2012, 08:38
http://3.bp.blogspot.com/-6SaWDucqa40/TvYURZvJPNI/AAAAAAAAA0w/eUYpryzl5LY/s1600/3bdc44bb2a053761d99f2a4979d7a2a9.gif

nosa_aic
23 - 03 - 2012, 09:20
اسعافات اولية لكى لا نسبب موت احدهم

غالبا ما نواجه طوارئ من شأنها تعريض حياتنا، وحياة آخرين للخطر. وكم نأسف، في أحيان كثيرة لوفاة شخص في حادث

مفاجئ بسبب عجزنا عن إسعافه. هنا حالات من الطوارئ اليومية يترجح فيها المرء بين الحياة والموت، مع نصائح

وارشادات لطريقة مواجهتها، حيثما يحضر الطبيب أو الجهاز الاختصاصي المسعف


آلام البطن

أول الاعراض الرئيسية لالتهاب الزائدة الدودية هو شعور بالانزعاج في منطقة البطن. مدد الشخص المصاب في فراشه وضع كيساً من قطع الثلج على الناحية التي تؤلمه. لا تعطيه أي طعام أو شراب قبل استشارة الطبيب ، فذلك قد يزيد احتمال انفجار الزائدة الملتهبة ويخلق وضعاً أشد خطورة. ولا يجوز اطلاقاً اعطاء المصاب مسهلات لدى الشعور باي الم في البطن


الاختناق

تم انقاذ شخص من بيته الذي تلتهمه النار، وهو في حال غيبوبة من جراء الدخان الذي تنشقه. في حالات الاختناق، عملية الانعاش بالتنفس الاصطناعي من الفم الى الفم تتطلب اولا فتح مجرى التنفس لدى المصاب باحناء رأسه الى الخلف ورفع فكه الاسفل. بعد ذلك أقفل منخريه بسبابتك وابهامك وانفخ في فمه بقوة كافية ليرفع صدره، تابع الانعاش بمعدل 12 نفساً في الدقيقة. لا تيأس وتتوقف عن مهمتك بسرعة. فكثيراً ما أنتعش ضحايا اختناق بعد ساعات من مباشرة عملية التنفس الاصطناعي


عضات الكلاب

كلب شارد يهاجم شخص ويعض ساقه. اعتبر ان اي كلب هو مصاب بدأ الكلب حتى يثبت لك العكس، سارع الى اتخاذ الاجراءات اللازمة. اغسل موضع العضة بالماء الجاري لأزالة آثار لعاب الكلب. بعد ذلك استخدم الشاش الطبي لتنظيف الجرح بالصابون والماء. غطي الجرح بظماد معقم وحاول القبض على الكلب لفحصه والتأكد من عدم اصابته بدأ الكلب


الحروق

أصيب شخص بحروق بالغة. هنالك انواع مختلفة من المعالجات للحروق البسيطة. أسكب الماء المثلج على الحرق ثم ضع فوقه كيساً يحوي قطعاً من الثلج على الحرق او ضمادات مبللة بالماء البارد، وذلك بعد ازالة بقايا الثيلب المحترقة لتحاشي التلوث بالجراثيم، ثم طهر الحرق بمادة معقمة، اما حروق الدرجة الثالثة، اي نوع الاعمق، فهي خطيرة ويجب ان يعالجها اختصاصي فوراً. في مثـل هذه الحالات تنبغي تغطية المنطقة المحروقة بضماد غير لاصق او بقطعة قماش نظيفة، ويمكن التعرف الى حروق الدرجة الثالثة من لونها الفحمي او الابيض


آلام الصدر

أجلس في وضع منحن إلى الوراء بمقدار 45 درحة تقريباً . اذا كان الألم شديداً ومتواصلا، خصوصاً اذا امتد الى الكتفين او الذراعين او العنق ، فربما انت امام أزمة قلبية. استدع للحال سيارة اسعاف

الغص بالطعام

يغص احد الاشخاص بقطعة من اللحم. أسأله اذا كان يستطيع الكلام . اذا امكنه ذلك فمعناه ان الهواء يدخل الى رائتيه وبالتالي ففي وسعه ان يسعل ويقذف العائق الذي يغص به الى الخارج. اما اذا عجز عن الكلام، فأضربه بعقب يديك ضربات سرية وقوية على ظهره بين عظمتي الكتفين. لا تحاول ازاحة العائق باصبعك او دفع ماء او شراب في بلعومه. اذا بقي مجرى التنفس مسدوداً، استخدم " مناورة هيمليخ ". قف وراءه ولف ذراعيك حول خصره ، ثم اقبض احدى يديك وضع جانب الابهام على بطنه بين القفص الصدري والسرة . امسك بيديك الاخرى قبضة يدك الاولى واضغط بحركة سريعة مع دفع الى اعلى. كرر الحركة حتى ينزاح العائق


الجروح

جرح شخص يده فأخذت تنزف بغزارة. انزع من معصمه واصبعه الخاتم والساعة، وارفع ذراعه المصابة فوق مستوى القلب ثم اضغط الجرح مباشرة . اذا لم يكن احد الاوردة الرئيسية مقطوعاً، فان النزف يتوقف عادة بالضغط المباشر. اما اذا لم يتوقف، فاضغط على الوريد من الداخل ( في جروح الساق يكون الضغط على الوريد في اعلى الفخذ من الداخل ). لا تستعمل المرقأة (ضاغط لوقف النزف) الابعد اخفاق جميع الوسائل الاخرى، لأن هذه تمنع وصول الدم الى الطرف المصاب كله وربما سبب ذلك عطلا دائماً

نوبة السكري

شخص مصاب بدأ السكر في الدم بأ يتفصد عرقاً ويرتجف ويتصرف في حال من التشتت الفكري. لا تعطه حقنة انسولين او جرعة من العقاقير المضادة للسكري، اذ ربما تكون حالة ناجمة عن هبوط سريع في مستوى السكر في الدم ، وهذا ينتج عادة من تناول جرعة مفرطة من الانسلين. حاول ان ترفع مستوى السكر في دمه بان تدعه يتناول شرابا يحتوي على السكر او قطعة حلوى او يمص قطعة سكر

الصدمة الكهربائية

سلك كهربائي خارجي ينقل تياراً يسقط على شخص . قبل اي شيء يجب فصل جسد المصاب عن التيار الكهربائي . استخدم خشبة جافة او غصن شجرة لابعد السلك ، او اعقد بعض ثيابك حول المصاب و اجذبه بعيداً عن السلك. اذا امسكت بثيابه او حذائه، فربما عرضت نفسك للخطر لأن جسده قد يكون ناقلا للكرباء. تأكد من ان اي شيئ تستعمله هو جاف وغير ناقل للكهرباء وانك تقف على أرض جافة. اذا جست نبض صديقك وكان متوقفاً، فقد تضطر الى انعاشه بالتنفس الاصطناعي من الفم إلى الفم، وربما استدعت الضرورة اللجوء الى الانعاش القبي - الرئوي، وهذا يستوجب تدريباً خاصاً

الصدمات

احد المصابين بحادث يبدو جلده ممتـقعاً وندياً ونبضه متسارعاً وتنفسه سطحيا او سريعاً او غير منتظم. هذه الاعراض تدل على الصدمه التي تأتي غالباً نتيجة اصابة جسدية خطيرة. تأكد من بقاء المصاب دافئاً وممدداً عل ظهره ومن بقاء قدميه مرتفعتين نحو 30 سنتمتراً فوق مستوى رأسه. هذا الوضع يحافظ حرارة الجسم ويساعد الدورة الدموية حتى وصول الاسعاف

حوادث السيارات

انت اول الواصلين الى موقع حادث اصطدام خطير. لا تنقل المصابين من اماكنهم الا اذا كان ذلك ضرورياً لسلامتهم مخ خطر آت. حاول ان تهديء روعهم وتبقيهم في وضع مريح. اذا كان أحدهم ينزف من أذنيه أو انفه أو فمه، فقد تكون جمجمته متصدعة وبقائه بلا حراك تخفف من احتمال تفاقم النزف. اذا كان يحس بخدر او نمل في ساقه او احد اطرافه، فذلك يدل على اصابة خطرة في ظهره او رقبته، وفي هذه الحال فان اي حركة قد تسبب له شللا او حتى الموت. اذا لم يقم لديك شك في ان رقبته مصابة،حاول أن تخفف صعوبة تنفسه باحناء رأسه الى الوراء لفتح مجرى التنفس. حاول اذ تيسر ذلك ،معالجة النزف او الحرق او الصدمة او الغيبوبة بالاساليب التي سبق ذكرها


ضربة الشمس

شخص ظل ساعات تحت اشعة الشمس الحادة. وفجأة شعر بعياء ودوار واصبح جلده حاراً وجافاً. الجلد الحار والجاف المترافق مع بلبلة عقلية دلالة على ضربة شمس. اعط الشخص شراباً بارداً ولكن لا تعطه منبهات (شاي او قهوة ). اخفض حرارة جسمه بوضعه في مغطس ماء دافىء تبرده تدريجياً باضافة قطع الثلج. ان ضربة الشمس أو لفحة الحرارة قد تكون مميتة خلال ساعات. اما نهك الحرارة فهو حال اقل خطراً ويتميز بظاهرة الجلد البارد المندي بالعرق. ضع المصاب في أبرد مكان ممكن واسقه ماء او عصير برتقال. ضع على راسه منشفة باردة

الغرق

سحبت شخص كاد ان يغرق. يبدو لك انه لا يتنفس، لكنك تشعر بنبضه الخفيف.ابدأ فوراً افراغ الماء من مجرى التنفس ثم باشر عملية الانعاش بالتنفس الاصطناعي، انك تضيع وقتاً ثميناً اذا انصرفت الى افراغ جوفه ايضاً من الماء الذي ابتلعه قبل المبادرة الى التنفس الاصطناعي


التسمم

ابتلع طفل مستحضر تلميع الاثاث وهو يشير بانه يحس حريقاً في فمه. الحروق حول الفم والتشنجات المعدية هي اعراض التسمم بالاحماض والمواد القلوية. بادر الى تخفيف مفعولها باعطاء الطفل اكواباً من الحليب او الماء فهذا يبطئ امتصاص الجسم لتلك المواد. لاتحاول ابداً ان تجعله يتقيأ لأن ذلك قد يسبب اذى اضافياً للمريء. أقراء التوصيات المدونة على علبة المستحضرات واتبع ارشادها

محتويات صندوق الأسعافات الأولية :

تحتوي صناديق الأسعافات الأولية على المواد الرئسية التالية التي تلزم لأجراء معظم الأسعافات الأولية وهي :ــــــــــ

**محلول معقم : مثل Benzal konsum أوأي محلول معقم يمكن شراءه من الصيدلية.ْْ{ ويستعمل لتطهير الجروح المفتوحة والخدش ,ولكن لا يستعمل لتطهير الحروق}

.ا**مركب عطري من زيت الأمونيا : { ويستعمل لحالات الأغماء , حيث تستعمل 1/2ملعقة مع كوب ماء للكبار , أما الأطفال فتستعمل 10 نقاط داخل نصف كوب من الماء ويوضع أسفل أنف المصاب للأستنشاق}

**حبوب ملح الطعام : {يستعمل لمعالجة الصدمة حيث تذاب ملعقة صغيرة في كوب من الماء ويسقى للمريض أكبر كمية ممكنة ولكن لا يعطي للمصاب

**بيكربونات الصوديوم أو مسحوق الخبز أو سترات الصودبوم(ليمونات الصوديوم): {ويستعمل للحماية ضد الغاز العصبي " غازمؤذ للاعصاب والرئتين " ويذاب منه أربعة ملاعق صغيرة مع كمية من الماء ويغسل بها الجزء المعرض للغاز العصبي ,أو تشبع ملابس المصاب , وتوضع قرب الوجه كقناع للغاز}

**عصابة مثلثة(رباط) : ْ{وتستعمل كغطاء للغبار في منطقة الصدر أو البطن}

**ضمادات معقمة متوسطة الحجم , مطرية ومغطاة بقماش الموسلين:{تستعمل لتغطية الجروح المفتوحة أوالحروق , وتشترى هذه الضمادات داخل عبوات وتكون معقمة ولا يتم عملها في المنزل}

**ضمادات لاصقة : {ويستعمل على الجروح الصغيرة وتضميد مكان وخزة الأبرة لعزلها عن الهواء}

**أكواب من الورق : {تستعمل للشرب ولخلط الأدوية}

**قطرة للعين : { تستعمل للحكة التي تصيب العين بسبب الغبار أو الدخان , مع عمل كمادات ماء بارد كل 20دقيقة}

**حبوب تعقيم الماء: {لتعقيم الماء عند عدم التمكن من غليه}

**ميزان حرارة طبي لقياس الحرارة عن طريق الفم : {ويستعمل لقياس حرارة الجسم للكبار}

**ميزان حرارة طبي لقياس الحرارة عن طريق الشرج : {ويستعمل لقياس حرارة الجسم للصغار}

**حافظة لسان خشبية: {تستعمل لفحص الحلق, وكذلك لتثبيت كسور الأصابع ,أو العظام الصغيرة في الجسم}

**مقص صغير حاد أوموسى بسلاح واحد : {ويستعمل لقص الأربطة والشريط اللاصق}

**قفازات طبية معقمة : {وتستعمل لارتدائها عند القيام باجراء تغطية على الجروح أو الجروح ويستعمل مرة واحدة فقط}



هذه الإسعافات و هذه المتطلبات من المفروض ان توضع بكل بيت و سياره

وذلك لحفظ سلامة الانسان او لانقاظ من يحتج لنا


وفي النهاية نسأل الله العفو والعافية

اميره اميره
24 - 03 - 2012, 09:32
http://im10.gulfup.com/2012-01-28/1327772046881.gif (http://www.arab75.com/vb/showthread.php?t=27840)

nosa_aic
24 - 03 - 2012, 10:23
http://im10.gulfup.com/2012-01-28/1327772046881.gif (http://www.arab75.com/vb/showthread.php?t=27840)

و عليكم السلام و رحمة الله و بركاته

:cgiving:

ابو مالك
26 - 03 - 2012, 08:04
صباح الخير يا مصر

http://imagecache.te3p.com/imgcache/d74580a6340172a977ce0d2e9c656e77.gif

اميره اميره
26 - 03 - 2012, 10:00
http://sewar.panet.co.il/images/2011/03/06/00v5054pya.gif


لأنه ليس كأي صباح
صباح مميز
يقطر نعومة
يطل بأشعة شمس دافئة
تحمل بين طياتها الكثير
مما كنت أفتقده من مدة

nosa_aic
26 - 03 - 2012, 16:52
صباح الخير يا مصر

http://imagecache.te3p.com/imgcache/d74580a6340172a977ce0d2e9c656e77.gif


http://sewar.panet.co.il/images/2011/03/06/00v5054pya.gif


لأنه ليس كأي صباح
صباح مميز
يقطر نعومة
يطل بأشعة شمس دافئة
تحمل بين طياتها الكثير
مما كنت أفتقده من مدة


http://www.majalisna.com/gallery/4001/4001_221927_1311866615.jpeg

sabah
28 - 03 - 2012, 10:43
http://www.v4orkut.com/greetings-sms-messages/good-morning-scraps/22.gif

nosa_aic
30 - 03 - 2012, 14:57
http://www.v4orkut.com/greetings-sms-messages/good-morning-scraps/22.gif

http://www.arabsys.net/pic/arbwelocm/84.bmp

nosa_aic
30 - 03 - 2012, 14:59
أضرار الميكرويف


http://mykoreankitchen.com/wp-content/uploads/2006/10/tefal-mini-oven.jpg (http://www.libyanyouths.com/vb/t138423.html)


حذر بروفسور متخصص بالهندسة الكهربائية من الإفراط باستخدام أجهزة "الميكروويف" لتسخين
الطعام مؤكدا إن من شأن ذلك التعرض "لنقص" في عدد كريات الدم الحمراء.. يقابله زيادة في عدد
كريات الدم البيضاء وذلك لان هذه الاشعه لاتقوم بقتل الميكروبات وبالتالي تزيد معدلات الأجسام
الغريبة في الجسم.وازدياد نسبة الكولسترول بالدم والإصابة بأمراض الحساسية ونقص الفيتامينات
وبعض المعادن.وحذر البروفسور من ترك جهاز الميكروويف بالقرب من الصغار والمراهقين مشيراً
ان من شأن ذلك ان يتعرضوا أثناء عبثهم لتلف الأنسجة أو الصعقة المميتة والضارة جداً.

ما هي الإحتياطات اللازمة عند التعامل مع الميكروويف؟

1- لابد من ترك مسافة نحو 60سنتيمتراً على الأقل من جهاز الميكروويف
2- والتأكد من إغلاق باب فرن الميكروويف.
3- والتأكد من كمية التسرب الأقصى المسموح به من جهاز فرن الميكروويف.
4- وعدم استعمال الأواني المعدنية داخل الميكروويف.
5- وعدم العبث بمحتويات جهاز فرن الميكروويف الداخلية.
6- وعمل الصيانة اللازمة له وإصلاحه لدى المختصين عند تعطله

استخدام الميكروويف بين الحقيقة والوهم

كثر في الآونة الأخيرة استخدام الميكروويف في المطبخ وتسخين الطعام، وأصبح هذا الجهاز من الأجهزة المهمة في المطبخ، وذلك لاختصاره لوقت تسخين الطعام وسهولة التعامل معه.. ولكن هل استخدام الميكروويف مأمون صحياً؟ وهل يؤثر على القيمة الغذائية للطعام؟ وكيف يمكن استخدامه بدون حدوث أي مضاعفات؟

سنحاول في هذا المقال الإجابة عن هذه التساؤلات وغيرها..

كيف يعمل الميكروويف؟

يعمل جهاز الميكروويف بواسطة إصدار أشعة كهرومغناطيسية، مثل موجات التليفزيون والراديو، تقوم بتحويل الطاقة من تردد قليل إلى تردد عال، والغذاء له قابلية لامتصاص هذه الترددات وبالتالي يتم تسخين جزيئات الطعام وترتفع حرارته.

استخدام الميكروويف في طبخ الطعام

• يجب تغطية الطعام عند تسخينه؛ لأن ذلك يمنع من تطاير الدهون ويسرع من عملية الطبخ ويساعد على نضج الطعام.
• يمكن تغطية الطعام بالأوراق الخاصة (بلاستيك) أو بصحن زجاجي.
• تستخدم بعض الأخوات الميكروويف لطبخ الطعام، وفي هذه الحالة يجب مراعاة تحريك وتقليب الطعام مثل الكباب والهمبرجر.

تذويب الطعام في الميكروويف

• ضعي الميكروويف على التذويب أو الحرارة المعتدلة ـ البطيئة.
• أزيلي أي سوائل للحم أو للسمك أو الدجاج وضعي اللحم في وعاء خاص.
• غطي اللحم بأوراق الشمع أو أوراق لا تمتص الدهون؛ فإن ذلك يسرع من تذويب الطعام.

تأثير الميكروويف على القيمة الغذائية للطعام

وجد من العديد من الدراسات أن تأثير التسخين باستخدام الميكروويف على القيمة الغذائية للأطعمة لا يختلف عن استخدام طرق الطبخ الأخرى، فلم يوجد تأثير يذكر في حالة تركيب البروتين والدهون والفيتامينات والأملاح المعدنية.

نصائح مهمة عند تسخين الطعام بجهاز الميكروويف

• لا يتم إشعال الميكروويف بدون وجود طعام داخله، وفي حالة عمل ذلك، ضعي كوباً من الماء بداخله لامتصاص الأشعة لمدة خمس دقائق.
• لا يستخدم الفرن في تجفيف أشياء أخرى غير الطعام مثل قطع قماش أو مناديل أو غير ذلك.
• اختاري الحرارة المناسبة حسب نوع الطعام.
• إذا كان الميكروويف يشتعل مع أجهزة أخرى في المطبخ في الدائرة الكهربائية نفسها، فإن ذلك يؤثر على كفاءة الميكروويف وقدرته على التسخين.

وإذا وجدت أن الطعام ينضج بسرعة فإن ذلك يرجع إلى عدة أسباب:

• قد تكون درجة حرارة الفرن عالية.
• قد تكون قوة الميكروويف عالية مثلا "700 وات بدلا من 500 وات".
• نوع الغذاء، فإن بعض الأغذية تنضج بشكل أسرع "بيض، جبن" ولتخفيف سرعة الطبخ ضعي كوباً
من الماء داخل الميكروويف، فإن ذلك يجذب الأشعة وبالتالي يخفف من قوة الأشعة للغذاء.

nosa_aic
30 - 03 - 2012, 15:13
معلومات طبية


هل تعلم

أن خليط من عصير الليمون وفصان من الثوم والزنجبيل وملعقة من زيت الزيتون النقي يعتبر خليط ممتاز لتنظيف الكبد ، حيث يؤخذ هذا الكوب من الخليط على الريق قبل الافطار بساعة .. وينصح باستعمال هذه العملية مرة كل ستة شهور..




أن الفراولة مفيدة للقلب ، وذلك لأنها من أفضل مضادات الأكسدة، وغنية بالألياف الغذائية القابلة للذوبان، وهذه الألياف تعمل على تخفيض معدل الكوليسترول في الدم، وزيادة كفاءة الدورة الدموية..



أن الملح الزائد = ترقق العظام :

نظن جميعاً أن الافراط في تناول الملح يسئ الى الضغط الدموي، لكن الملح ليس سبب ارتفاع الضغط الا لدى 30 في المائة من المصابين بهذا المرض. إلا أن ضرر الملح يصيبنا في عظامنا، فعندما يتخلص الجسم من الملح الزائد، يرمي معه الكالسيوم فيسئ الى العظم. يعجل الافراط في تناول الملح في حصول ترقق العظام. ولذا علينا قصر استهلاكنا من ملح الطعام على 2400 ملليغرام يومياً، علما أن في قطعة واحدة من الجبن الأمريكية 300 ملليغرام من الملح، وفي قطعتين من الخبز الأبيض 269 ملليغرام من الملح، وفي نصف كوب من صلصة الطماطم المعلبة 740 ملليغرام ..



أن تناول كمية من الألياف بين 25 الى 35 جراما يومياً يخفف من خطر الاصابة بأمراض السرطان وأمراض القلب، والسمنة، وداء السكري، والاسهال..




أن حبوب زيت السمك يمكن أن تفيد في التخلص من أعراض مرض التهاب المفاصل الروماتزمي الذي تشمل الكثير من الآلام والتعب وتيبس المفاصل في الصباح اضافة الى تورمها. التهاب المفاصل الروماتزمي يصيب الأشخاص في مختلف الأعمار، وحتى الأطفال منهم ويتم تشخيص هذا المرض بواسطة تحليل خاص للدم. وقد وجد أن هذه الحبوب تحتوي على مواد مضادة للالتهاب ومع التخلص من الالتهاب يمكن التخلص من الآلام المصاحبة لالتهاب المفاصل.



ان جزرة واحدة متوسطة الحجم تحتوي على أربعة أضعاف حاجة الانسان اليومية من فيتامين-أ . وهناك أطعمة أخرى تحتوي على قدر كبير من هذا الفيتامين مثل اليقطين واليام (نوع من البطاطا بعضه حلو) والبطيخ الأصفر والسبانخ والكرنب ..




ان نصف طبق من الفليفلة الحمراء الحلوة يحتوي على أكثر من مثلي الجرعة اليومية الموصي بها من فيتامين ج. كما أن الأطعمة التالية زاخرة بهذا الفيتامين (البرتقال، الجوافة، القرنبيط الأخضر والبازيلاء)..



ان نصف كيلوا جرام من سمك ال-هلبوت يحتوي على مثلي حاجة الانسان اليومية من فيتامين د، ويليه سمك الرنجة..



ان طبق واحد من اللوبيا الجافة المطبوخة، يمد الانسان بـ 90% من حاجة الانسان اليومية من مادة الفولات ويليها فول الصويا المطبوخ..



ان ثلاث رخويات من البطليموس البحري المطهوة بالبخار تمد الانسان بكامل حاجته اليومية من الحديد ولا يجاريها في ذلك أي طعام آخر، مع العلم أن هناك أطعمة كثيرة تحتوي على مقادير جيدة من الحديد، ولكنها لا تنافس البطليموس في وفرة الحديد..




ان شاي الأعشاب طريقة غير فعالة للتخلص من السمنة .. إنما الطريقة الفعالة والوحيدة للتخلص من السمنة هي ممارسة الرياضية والعناية بنوعية وكمية الغذاء التي نتناولها يومياً.




أن الثوم والبصل علاج شاف وناجع لكثير من الأمراض، حيث أنهما يحتويا على مركبات السلفايد (الكبريت)، وهذه المركبات تعمل على ابعاد خطر الجلطة الدموية، كما أنها تخفض من مستوى الكوليسترول في الدم وخاصة النوع الضار من نوع ldl ، كما أنها تعمل على خفض احتمال الاصابة بأمراض السرطان.




أن أن تناول موزتين الى خمس موزات في اليوم يبعد خطر ارتفاع ضغط الدم، ويمكنه أن يخفض ضغط الدم المرتفع الى المعدل الطبيعي خلال أسبوع واحد فقط ودون استعمال أدوية خافضة للضغط، حيث أن الموز يحتوي على نسبة عالية من البوتاسيوم ونسبة قليلة من الصوديوم وهو النوع الموجود في ملح الطعام، ومن الجدير بالذكر أن الطعام المحتوي على عنصر البوتاسيوم يساعد على التخلص من مادة الصوديوم التي تساعد على ارتفاع ضغط الدم.




أنه يمكن الآن تشخيص الأمراض عن طريق قزحية العين، وهو ما يسمى بعلم القزحية iridology ومن خلاله يمكن للمعالج تشخيص كثير من الأمراض الوراثية والالتهابات التي تصيب الجسم. حيث تظهر بقعة صغيرة أو علامة على القزحية يعرف منها الطبيب مكان ونوع المرض، والعلم يعني بتشخيص الأمراض وليس علاجها.



أندلت الأبحاث على أن زيت النعناع يساعد على التخلص من اضطرابات الأمعاء ، وذلك بسبب فاعليته كمضاد للتقلصات والتشنجات، وهو يعمل على استرخاء عضلات المعدة والأمعاء ، ويعمل أيضا كمضاد بكتيري ..



أن حفنة من اللوز تزن حوالي 25 جراما ويصل عدد حبات اللوز فيها الى حوالي 25 حبة توفر للانسان حوالي 12% من البروتينات اللازمة لصحته يوميا، وحوالي 35% من فيتامين e ، و 25 جراما من الكالسيوم . واللوز أيضا غني بالألياف الغذائية والحديد والزنك والنحاس، وهي كلها لازمة لنظام غذائي سليم وصحي.




أن الشاي يحتوي على مادة (الفلافونويد) وهي مادة ثبت أنها تحارب سرطانات الرئة والقولون والجهاز الهضمي والثدي.



أن الأشخاص الذين يشربون كوباً أو أكثر من الشاي يومياً تقل لديهم احتمالات الاصابة بالأزمات القلبية عن غيرهم.



أن الشاي هو مصدر غني من مصادر المغنيسيوم (الذي يساعد في تقوية العضلات) وكذلك البوتاسيوم الذي يساعد في تخفيض ضغط الدم، والزنك المفيد في علاج حب الشباب.



أن شرب أربعة أو خمسة أكواب من الشاي يومياً يمكن أن يقلل من احتمالات الاصابة بالسكتة القلبية بنسبة تصل الى 69 بالمائة.



أن الشاي مصدر لمادة (الفلورويد) وشرب كوبين ونصف كوب من الشاي يومياً يضيف مقدار 1.3 مللي جرام من الفلورويد الى النظام الغذائي وذلك يساعد في تفادي تسوس الأسنان.

اميره اميره
02 - 04 - 2012, 11:22
http://sewar.panet.co.il/images/2011/03/08/jb12763461.jpg (http://vb.m3m7.com/32763-%D8%B5%D9%80%D8%A8%D9%80%D8%A2%D8%AD%D9%80%D8%A2%D 8%AA-%7E-sms.html)
السلام عليكم ورحمه الله وبركاته
(http://vb.m3m7.com/32763-%D8%B5%D9%80%D8%A8%D9%80%D8%A2%D8%AD%D9%80%D8%A2%D 8%AA-%7E-sms.html)

اميره اميره
05 - 04 - 2012, 10:44
http://www.sh22y.com/vb/imagehosting/6764b68b0aa20ecb.gif

السلام عليكم ورحمه الله وبركاته

nosa_aic
06 - 04 - 2012, 06:59
http://sewar.panet.co.il/images/2011/03/08/jb12763461.jpg (http://vb.m3m7.com/32763-%D8%B5%D9%80%D8%A8%D9%80%D8%A2%D8%AD%D9%80%D8%A2%D 8%AA-%7E-sms.html)
السلام عليكم ورحمه الله وبركاته
(http://vb.m3m7.com/32763-%D8%B5%D9%80%D8%A8%D9%80%D8%A2%D8%AD%D9%80%D8%A2%D 8%AA-%7E-sms.html)



http://www.sh22y.com/vb/imagehosting/6764b68b0aa20ecb.gif

السلام عليكم ورحمه الله وبركاته


و عليكم السلام و رحمة الله و بركاته



http://up.2sw2r.com/upfiles/hh337500.png

nosa_aic
06 - 04 - 2012, 07:01
الشاى والتوت للوقاية من أمراض الجهاز العصبى (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/190458-%D8%A7%D9%84%D8%B4%D8%A7%D9%89-%D9%88%D8%A7%D9%84%D8%AA%D9%88%D8%AA-%D9%84%D9%84%D9%88%D9%82%D8%A7%D9%8A%D8%A9-%D9%85%D9%86-%D8%A3%D9%85%D8%B1%D8%A7%D8%B6-%D8%A7%D9%84%D8%AC%D9%87%D8%A7%D8%B2-%D8%A7%D9%84%D8%B9%D8%B5%D8%A8%D9%89)



http://www.alwafd.org/images/news/708281485ser4390.jpg




وجدت دراسة جديدة أن الاستهلاك المنتظم للأغذية والمشروبات الغنيّة بمواد تعرف بالفلافونويد، مثل التوت والتفاح والشاي يمكن أن تخفّض خطر إصابة الرجال بمرض باركنسون بنسبة 40%..
وأفاد موقع "هلث دي نيوز" الأمريكي أن باحثين في جامعة "هارفارد" وجدوا أن كل الأغذية التي تحتوي على الفلافونويد مفيدة للرجال، في حين أن التوت فقط يفيد الرجال والنساء.
وقال الباحث المسؤول عن الدراسة شيانج جاو، إن "النتائج المفيدة بالنسبة لكافة الأغذية التي تحتوي على الفلافونويد ظهرت عند الرجال فقط. لكن، التوت يحمي الرجال والنساء"، مشيراً إلى أن التوت يحمي الأعصاب، ويمكن للناس أن يجعلوه في نظامهم الغذائي المنتظم، "فلا تأثيرات مضرة من استهلاكه وهو يخفض أيضاً خطر الإصابة بارتفاع الضغط".
ومرض باركنسون يؤثر على الجهاز العصبي المركزي، ويسبب عدداً من الاضطرابات الحركية مثل الرجفان ومشاكل التوازن.
وتتواجد الفلافونويد في الأغذية النباتية التي تساعد على منع تلف خلايا الجسم.
وشملت الدراسة 50 ألف رجل وأكثر من 80 ألف امرأة، حيث قام الباحثون بدراسة تأثير تناول خمس أنواع من مصادر الفلافونويد وهي الشاي والتوت والتفاح وعصير البرتقال.
وقارن العلماء بين الأشخاص الذين يتناولون كميات كبيرة من الفلافونويد ومن يتناولونه بكميات أقل، فظهرت منافع ملحوظة عند الرجال فقط حيث انخفض خطر الإصابة بمرض باركنسون بنسبة 40% لدى الأكثر استهلاكاً لهذه المواد.
ولدى النظر في كل مصدر على حدة، تبيّن أن التوت قد يفيد الرجال والنساء معاً، فيخفض خطر الإصابة بباركنسون لدى الجنسين بنسبة 25% .

nosa_aic
06 - 04 - 2012, 07:03
السمك يقي الأطفال من ضيق التنفس (http://www.alwafd.org/%D8%B5%D8%AD%D8%A9/189904-%D8%A7%D9%84%D8%B3%D9%85%D9%83-%D9%8A%D9%82%D9%8A-%D8%A7%D9%84%D8%A3%D8%B7%D9%81%D8%A7%D9%84-%D9%85%D9%86-%D8%B6%D9%8A%D9%82-%D8%A7%D9%84%D8%AA%D9%86%D9%81%D8%B3)



http://www.alwafd.org/images/news/1384077346ikt42e6d.jpg





أظهرت دراسة طبية جديدة أن الأطفال الذين يأكلون السمك قبل سن التسعة أشهر هم أقل عرضة للإصابة بضيق التنفس في مرحلة ما قبل الدخول للمدرسة.
وحلل الباحثون في جامعة غوتنبرغ السويدية أجوبة 4171 شخصا بشأن أطفالهم في سن الستة أشهر و12 شهرا وأربع سنوات ونصف السنة، وعاينوا الأطفال الذين تعرضوا لثلاث نوبات أو أكثر من ضيق التنفس في السنة الفائتة، بينهم من يتناولون أدوية مضادة للربو، وقارنوهم بمن لم يعانوا هذه المشكلة .
وقالت الباحثة المسؤولة عن الدراسة إيما غوكسور، إن الدراسة وجدت أن تناول السمك في سن يسبق التسعة أشهر يخفف إلى النصف إمكانية المعانات من نوبات ضيق التنفس المتكررة في سن الرابعة والنصف، لافتة الى أن نوع الأسماك الأكثر تناولا هي السمك الأبيض، والسلمون.
وكانت دراسات سابقة قد أظهرت أن السمك الذي يعتقد بأنه يحتوي على ميزات تقلل من خطر الإصابة بالحساسية، مفيد في حالات الاكزيما والتهاب مخاطية الأنف عند الأطفال في السن السابق للدخول إلى المدرسة.

nosa_aic
06 - 04 - 2012, 07:08
تحذير من كشط بطاقات الشحن بالأظافر



http://a5.sphotos.ak.fbcdn.net/hphotos-ak-prn1/524523_427752200575301_269792206371302_1863324_109 6682972_n.jpg (http://www.libyanyouths.com/vb/t139129.html)



وجدت هيئة البحوث الطبية في الولايات المتحدة


أن سرطان جديد قد يصيب الانسان تسببه مادة "نيترو أكسيد الفضة".


كلما قمت بشراء بطاقات إعادة شحن او بطاقات الاتصال



...لا تقم بحكها بواسطة الظفر لأنها تحتوي على طلاء 'الفضة أكسيد النتروجين'



ويمكن أن يسبب سرطان الجلد.





عــفـــانـــآ الله و إيـــآكـم

nosa_aic
06 - 04 - 2012, 12:17
كيف تتم عملية تصحيح البصر بالليزر؟


1

تبدأ عملية الليزك بوضع المشرط الإلكتروني على العين وتثبيته بدقة.
http://www.arabseyes.com/vb/imgcache/8068.imgcache (http://www.dlu3at.net/vb/article59227.html)

2

بتحريك المشرط الإلكتروني في اتجاه السهم يتم ازالة الغشاء الرقيق الذي يغطي القرنية.

http://www.arabseyes.com/vb/imgcache/8069.imgcache (http://www.dlu3at.net/vb/article59227.html)


3

يقوم الطبيب بازالة الغشاء بواسطة ملقط معقم ووضعه جانباً لتكون القرنية معرضة لاشعة الليزر للمرحلة التالية.
http://www.arabseyes.com/vb/imgcache/8074.imgcache (http://www.dlu3at.net/vb/article59227.html)

4
يتم تسليط أشعة الإكزيمر ليزر داخل أنسجة القرنية والتي تكون محسوبة بعدد محدد لازالة السمك المطلوب من سطح القرنية

http://www.arabseyes.com/vb/imgcache/8071.imgcache (http://www.dlu3at.net/vb/article59227.html)


5

تتم العملية بإعادة الغشاء الرقيق مكانه كما كان قبل العملية.

http://www.arabseyes.com/vb/imgcache/8072.imgcache (http://www.dlu3at.net/vb/article59227.html)



جهاز القطع الإلكتروني من انتاج شركة visx

http://www.arabseyes.com/vb/imgcache/8073.imgcache (http://www.dlu3at.net/vb/article59227.html)


http://www.arabseyes.com/vb/imgcache/8074.imgcache (http://www.dlu3at.net/vb/article59227.html)


http://www.arabseyes.com/vb/imgcache/8075.imgcache (http://www.dlu3at.net/vb/article59227.html)


http://www.arabseyes.com/vb/imgcache/8076.imgcache (http://www.dlu3at.net/vb/article59227.html)



مشاكل ممكن ان تحدث

كأي عملية جرحية فإن هناك بعض المشاكل التي من الممكن ان تحدث خلال مراحل العملية مثلاً في مرحلة قطع غشاء القرنية وبالرغم من انه جهاز عالي الدقة والتطور الا ان قد تكون عملية القطع غير مكتملة مما قد يسبب تأخير العملية لفترة تزيد عن 3 اشهر لحين التحام الغشاء مرة اخرى او ان تكون عملية القطع اعمق من الطلوب ولو ان هذا نادرا حدوثه او ان القطع كان غير منتظم او ان اعادة الغشاء لم يكن في المكان الاصلي تماماً. كما انه من الممكن ان تحدث بعض المشاكل خلال تسليط اشعة الليزر فقد يحدث ان تكون كمية الليزر اكثر او اقل من المطلوب بالضبط كما انه من الممكن ان يحرك المريض عينه اثناء الليزر كل هذه احتمالات نادرة الحدوث لان العملية يسبقها فحص دقيق جداً لتحديد دقيق لكل متعلقات العملية.

لماذا يختـار البعض إجـراء عملية تصحيح البصـر ؟

لا يوجد أحد لا يتمنى الرؤيـة بدون الاعتمـاد على النظـارات الطبية أو العدسات اللاصقـة ، حيث يقـوم أحدنا من فراشـه فيرى ساعته ويعرف طريقه دون أن يتحسس مكان النظارات الطبية أو العدسات اللاصقة . الكثيرون يتمنون مزاولة رياضتهم المفضلة ككرة القدم أو السباحـة دون متاعب ومخاطر وضع النظارات أو العدسات اللاصقة أثناء اللعب . البعض يعملون في مجالات تتطلب دقة وسلامة النظر بدون نظارات طبية أو عدسات ، مثل رجال الأمن والطيارين والرياضيين والمضيفـات. والبعض الآخر لا تصلح له العدسات اللاصقة بسبب وجود حساسيـة أو جفاف في العين بسبب قلـة إفراز الدموع، كما أنه لا يحبذ الظهور بالنظارات الطبية أو يفضل حرية الحركة بدون التقيد بالنظارات أو العدسات وتلبي عملية تصحيح النظر بالليزر كل هذه الرغبات بنجاح كبير .

كيف يقـوم الليـزر بعلاج قصـر النظـر ، طول النظر واللابؤرية ؟
بدأ العلاج بالليزر في أوروبا منذ منتصف الثمانينات، وقد تم منذ تلك الفترة وحتى الآن علاج مـا يزيـد عن عشرة ملايين شخص من مختلف دول العالم وبنسبة نجاح تزيد عن 95% . يجري حاليـاً نوعان من العمليـات لعــلاج قصر النظر باستعمـال الليزر هي عمليـات "الليزك"وعمليـات "الليزر" وفي الحالتين يعتمد الجهاز على إصدار أشعة فوق بنفسجية تستطيع تغيير التحدب الخارجي للقرنية دون إحداث أي تلف في الأنسجة المحيطة ، حيث تقوم أشعة الليزر المبرمجـة مسبقاً بواسطـة الكومبيوتر بحد كميات محدودة من أنسجة سطح القرنية (يقل سـمكهـا عن سمك الشعرة الرقيقة) وبذلك تصل العين إلى قوة التركيز المتوافق مع طولهـا وبالتالي يتم تصحيح البصر والاستغناء عن النظارات الطبية والعدسات اللاصقـة .

ما الفرق بين الليزر والليزك و أيهما افضل لعلاج حالتي ؟

بجميع العمليات يتم استعمال نفس جهاز الاكسايمر ليز ولكن الفرق بين الليزر والليزك هو موضع العلاج في عمليات الليزر يتم علاج السطح الخارجي للقرنية بالليزر وقد اثبتت الابحاث انها طريقة علاج مأمونة وفعالة في درجات النظر البسيطة أما في الدرجات العالية فقد وجدت الابحاث ان عمليات الليزك تعطي نسبة نجاح أعلى ويتم فيها الاستغناء عن النظارات بصورة اسرع وأدق وفي هذه العمليات يتم إستعمال الليزر لعلاج الانسجة داخل القرنية

كيف تتم عملية تصحيح البصر بالليزر؟ بالشرح والصور التوضيحية

( بدلا من السطح الخارجي ) بعد إستخدام جهاز آخر مساعد يسمى المايكروكيراتوم


هل حـالتي مناسبة للعلاج بالليـزر ؟

حتى نضمن نسبة نجــاح عـالية فلا بد من اختيار الشخص المناسب بدقة وذلك عن طريق إجراء فحص مسبق في العيادة لقياس درجة قصر النظر، طول النظر والإستيجماتيــزم وللتأكد من خلو العين من الالتهابات الخارجية والداخليـة وبعد ذلك يتم إجراء تصوير طوبوغرافي للقرنيـة وهو فحص بسيط وضروري يتم بواسطتـه تحديد الشخص المناسب للعــلاج ودرجــة عيوب الإبصار بدقة شديدة بواسطة الكومبيوتر .

هل هنـاك عمر محدد للشخص المطلوب علاجـه ؟

لا نستطيع العلاج قبل سن الثامنة عشر عامـاً ولا يوجد حد أعلى للعمر وينبغي الأخذ بعين الاعتبـار أن يكون قصر النظر قد استقر عند المريض حتى يكون هناك جدوى من العملية .

مـا مـدة العمليـة ؟

العلاج بالليزر لا يحتـاج إلى الإقـامة في المستشفى لان العملية بسيطة جدا . فبعد أن توضع قطرات في العين لتخديرها يستلقي المريض تحت جهــاز الليزر لمدة تتراوح من
10 الى 50 ثانية فقط وبعد ذلك يعود المريض الى بيته.

هل يسبب العلاج بالليزر أي ألـم ؟

العلاج بحد ذاتـه لا يسبب أي ألم ولكن بعد عملية الليزر ولمدة يومين ينصح المريض بعدم التعرض للضوء العالي لأنه قد يضايقه . هناك قطرات توصف للتقليل من أي شعور بعدم الارتياح في هذه الأيام الأولى بعد العلاج بالليـزر.

أمـا في حالة عمليات الليزك او السوبر ليزك يكون عدم الارتياح هذا لفترة الساعات الثلاثة الأولى فقــط بعد العــلاج لأن السطح الخارجي للقرنيـة لم يلمسه الليزر وبالتالي فإن المريض يستطيع العودة لحياته العادية بكل سهولة في اليوم التالي للعملية .

ما نسبـة نجاح العملية ؟ وهل تتراجع نتيجة تصحيح البصر بالليزر مع مرور الوقـت ؟

نسبة نجاح العملية هي حوالي 95 % ، وهذا يعني انه اذا اختير المريض المنــاسب الذي تصلح درجة قصر نظره للعلاج بالأكسايمر ليزر فإن نسبة حدوث نقص بحدة النظر مرة أخرى لا تتعدى خمسة بالمائة وفي هذه الحالـة من الممكن إجراء جلسة ثانية للعلاج بالليزر لتصحيح الجزء البسيط المتبقي من درجات قصر النظر وبسهولة .

هل يحتمل أن يؤثر العلاج بالليزر تأثيرات جانبية على أجزاء أخرى في العين غير القرنية المطلوب علاجها ؟

الاكسايمر ليزر عبارة عن أشعة غاية في الدقـة والتخصص ويتحكم في تشغيلها الكمبيوتر ولا يتعدى تأثيرها الأنسجة المطلوب علاجها .

إذا كنت استخدم العدسات اللاصقة قبل العملية ما الذي ينبغي أن أفعله ؟

يجب عليك عدم استخدام العدسات اللاصقة قبل الفحص الطوبوغرافي وعملية الليزر لفترة تتراوح من عدة أيـام
في حالة العدسات اللينة ,, و لعدة أسابيع في حالة العدسات الصلبة .

هل هناك تعليمات خاصة بوضع مستحضرات التجميل ؟

يجب عدم وضع مستحضرات التجميل لمنطقة العين يوم العملية وبعدها لمدة أربعة أيام

ابو مالك
10 - 04 - 2012, 08:43
http://www.album.v90v.com/data/media/57/images_524.gif

السلام عليكم ورحمة الله وبركاته

nosa_aic
10 - 04 - 2012, 16:43
http://www.album.v90v.com/data/media/57/images_524.gif




السلام عليكم ورحمة الله وبركاته


و عليكم السلام و رحمة الله و بركاته

مرحبا اخى الفاضل



http://www.al-amakn.net/vb/uploaded/17365_1238248346.gif

nosa_aic
10 - 04 - 2012, 16:46
http://a.yfrog.com/img875/5900/31nsc.jpg (http://www.dlu3at.net/vb/redirector.php?url=http%3A%2F%2Fforum.sedty.com%2F )

nosa_aic
10 - 04 - 2012, 16:54
الهشاشة تسرق العظام تدريجيا



استحق بجدارة لقب اللص الصامت الذي يتسلل إلي جسم الإنسان دون أن يدري أن مصاب به إلا بعد حدوث كسور من أقل خبطة أو كعبلة..
يحني الظهر، ويكسر الفخذ، وتصبح العظام مثل أطباق الصيني قابلة للكسر في أي وقت.
إنه مرض "هشاشة العظام" الذي يصيب أكثر من 25% من النساء في سن الخمسين، ويتسبب في وفاة أكثر من 20% من عدد المصابين به..!


الهشاشة
هي تعبير يطلق علي نقص غير طبيعي واضح في كثافة العظام فالعظام في حالتها الطبيعية تشبه قطعة الأسفنج المليء بالمسامات ويكبر حجمها، وتفقد العظام صلابتها وتكون عرضة للكسر بمنتهي السهولة وتعتبر عظام الفخذ والساعد والعمود الفقري هي الأكثر عرضة للكسر في المرضي المصابين بهشاشة العظام.


وتأتي الإصابة بالهشاشة كنتيجة لنقص عنصر الكالسيوم في جسم الإنسان خاصة مع تقدم العمر.
"هشاشة العظام تتسلل إلي أجسادنا تدريجيا".. هذا ما يؤكده د. سمير البدوي أستاذ الأمراض الروماتيزمية بالقصر العيني، بالعظام تقوي في مراحل النمو الأولي، وتصل إلي أشدها في أواخر سن المراهقة، ثم تبدأ في الترفق تدريجيا بمعدل 1% سنويا حتى تصبح أكثر هشاشة.


والعظام الهشة ليست بالضرورة مؤلمة، فقد تكتم متاعبها حتى يفاجأ المريض بالكسور وربما يفاجأ بالإعاقة
إذ يعجز 80% من المصابين بكسور للهشاشة عن السير بعد 6 أشهر من الإصابة.
والأخطر أن 20% منهم يتوفون خلال سنة واحدة بعد إصابتهم بالكسر.
وتحتوي العظام علي 90% من كمية الكالسيوم بالجسم عن الباقي يوجد حرا في الدورة الدموية وهو مهم للوظائف الحيوية.


ويمثل تكسير العظام بشكل دوري مصدر الكالسيوم الحر في الجسم.
وتعد دورة التكسير والبناء هذه مهمة لإطلاق الكالسيوم في الدم ولعملية النمو ولإصلاح العظام بعد الإجهاد.
ومن لديه كثافة عظام منذ البداية لا يتعرض للهشاشة، لكن كلما زاد السن كلما زادت فرص الإصابة.
كوني حذرة.. ليس للهشاشة أعراض..!
الاختبار البدني وأشعة اكس واختبارات فحص كثافة العظام.. هم فقط القادرين علي اكتشاف إصابتك بهشاشة العظام.
وفيما عدا ذلك.. فقد تلعب الصدفة دورا كبيرا لتكتشف أنك مصابة بالمرض..!


فالعظام الهشة لا تعلن عن نفسها خاصة في بداية المرض.
إلا أنه عندما تنخفض كثافة العظام لدرجة إمكانية حدوث كسور فيها، قد يحدث الألم الذي يبدأ عادة في الظهر كمؤشر علي تلف فقرات الظهر، ويأتي الألم قويا وفجائيا ويزداد إذا ما حاول المريض الوقوف أو الحركة.
وتتطور الإصابة إذا ما حدث كسر في أكثر من فقرة في العمود الفقري.. فينحني الظهر وتلتهب العضلات، كما قد يحدث الكسر في بعض العظام الأخرى بعد أي ضغط خفيف علي العظام أو عند السقوط.

hesham1997
11 - 04 - 2012, 08:16
دراسة: ارتباط بين إصابة الأم بالسكر وتعرض طفلها للتوحد

الثلاثاء، 10 أبريل 2012 - 22:13

كتب إسلام إبراهيم

كشفت دراسة أمريكية حديثة أشرف على إجرائها باحثون من معهد دافيس بجامعة كاليفورنيا عن وجود علاقة قوية بين إصابة الأم بمرض السمنة ومرض السكر من النوع الثانى، وبين ارتفاع فرص إصابة أطفالها بالتوحد أو ما يعرف باضطرابات طيف التوحد "autism spectrum disorder".

وجاءت هذه النتائج فى دراسة حديثة نشرت بدورية "Pediatrics"، وذلك بالعدد الصادر فى التاسع من شهر أبريل الجارى، وقام بدعمها مادياً المعهد الوطنى للصحة الأمريكى.

وشملت الدراسة حوالى 1004 من الأمهات والأطفال، غالبيتهم من كاليفورنيا الشمالية، وكان عمر الأطفال يتراوح مابين عامين و5 سنوات، وكان حوالى 517 منهم مصابين بمرض التوحد، واستمرت الدراسة من عام 2003 إلى عام 2010.

وأشارت الدراسة إلى أن الأمهات الذين كانوا يعانون من خلل فى التمثيل الغذائى وأصيبوا بمرض السمنة كانت فرصهم أكبر فى امتلاك أطفال مصابين باضطرابات طيف التوحد بنسبة 67%، مقارنة بالأمهات أصحاب الوزن الطبيعى، وغير المصابات بمرض السكر أو ضغط الدم المرتفع، وكما زادت فرص حصولهم على أطفال مصابين باضطرابات أخرى فى النمو بمقدار الضعف.

وكما أضافت الدراسة، أن الأمهات المصابات بمرض السكر من النوع الثانى كانت نسبة حصولهم على أطفال مصابين بتأخر فى النمو بمقدار 67% مقارنة بالأمهات السليمة غير المصابات بالسكر، حيث حدث عندهم خلل فى التواصل مع الناس وخلل فى القدرة على الاستيعاب وطريقة الكلام والانطوائية وضعف القدرات الحركية.

hesham1997
11 - 04 - 2012, 08:29
ما هى منظمات ضربات القلب؟

الثلاثاء، 10 أبريل 2012 - 17:31


تسأل قارئة: ما هى منظمات ضربات القلب؟

يجيب عن هذا التساؤل الدكتور أحمد السواح قائلا، إن القلب وهو عضو متخصص، يمتلئ بالدم وينبض بشكل متواصل ليضخ الدم المحمل بالأكسجين والغذاء اللازم إلى كافة أنحاء خلايا الجسم، ويتم التحكم بالانقباضات القلبية من خلال مؤثرات كهربائية يكون مصدرها الجزء الأعلى من الأذين الأيمن للقلب عن طريق نوع من الخلايا الخاصة تعرف باسم خلايا العقدة الجيبية الأذنية (وهى المنظم الطبيعى للقلب) والتى ترسل بدورها شبكة من نبضات القلب الكهربائية بطريقة منتظمة فيتم انقباض الأذين الأيمن والأيسر فى وقت واحد دافعين الدم إلى البطين الأيمن والأيسر، وعند امتلائهما يقومان بدورهما مرة أخرى بدفع الدم إلى الشريان الرئوى والشريان الأورطى لتوصيل الدم إلى الرئتين وبقية أجزاء الجسم، وهذه العملية تتكرر مع كل نبضة قلب.

فى حالة الراحة يكون معدل نبضات القلب للكبار من 60-80 نبضة بالدقيقة بينما فى الأطفال فيكون من 80 – 110 وقد يزداد هذا الرقم عن 100 نبضة بالدقيقة للكبار فى بعض حالات الإجهاد أو الانفعال النفسى، فأثناء التمارين الرياضية مثلا تزداد حاجة عضـلات الأرجل والأذرع لكميات أكثر من الدم، وللاستجابة لهذا المطلب يستجيب القلب الطبيعى أوتوماتيكيا بزيادة عدد نبضاته فى الدقيقة.

فى بعض الأحيان لا تكون استجابة القلب بصورة ملائمة كأن تكون السرعة بطيئة جدا أو سريعة أكثر من اللازم أو غير منتظمة، وأحياناً لا تنقل النبضات الكهربائية بشكل صحيح للجزء السفلى من القلب هذه الحالة تسمى (حركة قلبية قليلة الضربات)، وفى أى من هذه الأحوال تقل قدرة القلب على ضخ الدم إلى كافة أنحاء الجسم وهذا يؤدى إلى بعض الأعراض: مثل التعب، الإعياء، فقدان الوعى، والنهجان، وفى هذه الحالة يقوم الطبيب باختيار أفضل سبل العلاج ويكون الحل الأمثل هو زراعة منظم لضربات القلب وهو جهاز مزود ببطارية صغيرة ووظيفته إرسال تنبيهات كهربائية للقلب بصورة منتظمة، والتى بدورها تؤدى إلى انقباض القلب بصورة منتظمة وملائمة ليقوم بضخ الدم إلى جميع أجزاء الجسم إن معظم منظمات ضربات القلب تركب فى الجزء الأعلى من الصدر من خلال عملية تستغرق حوالى ساعة واحدة تجرى تحت تأثير التخدير الموضعى فقط، حيث يقوم الطبيب المختص بعمل فتحة صغيرة فى الجلد ومن ثم يتم إدخال المنظم تحت الجلد بعد إتمام عملية توصيل السلك الكهربائى فى المكان الخاص به بالقلب عن طريق الأوردة ومن ثـم يتـم إغلاق هذه الفتحة بالخيوط الجراحية.

وأثناء عملـية التركيب هذه يقوم الطبيب بمراقبة حركة السلك من خلال شاشة تلفزيونية تحت الأشعة السينية لوضع السلك الكهربائى فى مكانه المحدد بالقلب.

بعد ذلك يقوم الطبيب بمراقبة الجهاز قبل وبعد خروج المريض من المستشفى، حيث تتم أولا المراقبة الأولى للتأكد التام من شفاء والتئام الجرح، وكذلك مراقبة عمل المنظم حسب البرمجة التى عملت له والجواب على أسئلة واستفسارات المريض، وبعد المراقبة الأولى تتم عملية المتابعة العادية فى المستشفى أو فى عيادة الطبيب المعالج، ويجب على المريض أخذ العلاج الموصوف له بواسطة الطبيب، واتباع تعليماته وفى نفس الوقت إبلاغه عن أى مشاكل قد تعترضه مثل: احمرار الجرح أو عدم جفافه، وجود سخونة أو ألم فى مكان الجرح وارتفاع درجه الحرارة.

nosa_aic
21 - 04 - 2012, 02:58
رؤية الحياة بنظرة إيجابية تحمى من خطرالإصابة بالازمات القلبية

http://www.egynews.net/wps/wcm/connect/17ad66004af0653894c5dc6b86ceb346/Thumbmail2012-04-19+08%3A51%3A31.734X.jpg?MOD=AJPERES

أثبتت دراسة علمية حديثة أجراها باحثون أمريكيون بكلية هارفارد في بوسطن أن الانسان الذى يتحلى بموقف إيجابى ونظرة تفاؤل نحو الحياة يتفادى الاصابة بخطرالنوبات والازمات القلبية والسكتات الدماغية التى قد تودى بحياته.
ووجد الباحثون أن الاشخاص الذين لديهم القدرة على التمتع بأبسط الاموروالتحلى بالصبر إزاء المواقف العصيبة والنظرالى الحياة بنظرة يملؤها التفاؤل والايجابية هم أقل عرضة للإصابة بالازمات القلبية والذبحات الصدرية .
وقالوا إن التوتر العصبى والاكتئاب الشديد والضيق والحزن هى عوامل تزيد من الضرر الذى يلحق بقلب الانسان بشكل كبير,كما أن الكثير من الاشخاص كانوا يغفلون عن أهمية المشاعر الايجابية وفائدتها الهامة لصحة ونضارة الانسان .
وفى اول دراسة من نوعها قام بها فريق من الباحثين بفحص 200 بحث ودراسة منفصلة تناولت الصحة النفسية وصحة القلب الوعائية والتى نشرت نتائجها فى النشرة النفسية عبر شبكة الانترنت.
أظهرت الدراسة التى أجريت على 300 رجل وإمرأة أن الأشخاص الذين لديهم نظرة إيجابية نحو الحياة و يشعرون بتفائل نحو المستقبل يميلون إلى خوض حياة صحية بشكل عام , فهم أكثر عرضة لممارسة التمارين الرياضية , وتناول غذاء صحى ومتوازن, والحرص على الحصول على قسط كاف من النوم , ما يقلل فرص الاصابة لديهم بأمراض القلب والأوعية الدموية.

nosa_aic
21 - 04 - 2012, 03:12
معلومات علميه تهمك



لماذا تسبب بعض الاصوات القشعريرة ..؟
- مثل صوت الاظافر على الزجاج :

لا يوجد سبب واضح لهذه الظاهرة الغريبة ( وقد يشعر بعض القراء بالقشعريرة فعلا عند تذكر هذا الصوت لحظة قراءة هذه السطور ) و يعتقد العلماء أن سبب هذه القشعريرة التي تحصل عند البعض هو أن هذا الصوت يمثل تحذيرا لغريزة اساسية قديمة ( كان يمتلكها الإنسان الأول ) لخطر ما قادم لهذا السبب تتكون هذه القشعريرة

لماذا يحمر وجهك خجلا ؟

يحدث ذلك نتيجة لحالة الارتباك التي تحدث للمرء مما يؤدى إلى اتساع العضلات المحيطة بالأوعية الدموية في الوجه والعروق الرقيقة فيندفع الدم إليها بشدة ويظهر اثر ذلك على الوجه الذي يحمر ويتهوج نتيجة للطاقة الناتجة في عملية الاندفاع للدم هذه لذلك لا يستطيع المرء إخفاء هذا مهما حاول.

ما هو التثاؤب ولماذا عندما يتثائب الشخص يتثائب الذي بجانبة ؟

التثاؤب هو انعكاس تنفسي معين، هدفه زيادة جريان الدم الواصل إلى المخ وتوسيع بعض الشعيرات الدموية، وفتح بعض الحويصلات الهوائية المسدودة في الرئتين، وعامة هو يؤدي إلى حالة نشاط مؤقتة.. بالتالي يحدث دائماً مع الأشخاص المنهكين .. أما عن سريانه بالعدوى فهي ظاهرة إشعاع سايكوفيزيائي شهيرة .. إن الحماس والخوف والتوتر والضحك كلها عواطف تنتقل بالإشعاع السايكوفيزيائي، يكفي أن يتوتر الجالسون معك حتى تتوتر.. شاهد معهم رواية مضحكة لا تروق لك كثيراً.. بمجرد أن يضحكوا تضحك أنت ولا تدري لهذا سبباً.

معلومه عن القلب

هل تعلم أن القلب يضخ 6000 لتر من الدم يوميا، وأن القلب يضخ مليون برميل من الدم طوال حياة الإنسان، وكمية الدم التي يضخها القلب في الحالة العادية تبلغ 4.5 إلى 5 لتر في الدقيقة, ويمكن أن تزداد إلى ثلاثة أضعاف عند القيام بممارسة الرياضة.
يبلغ وزن القلب حوالى 0.5% من وزن الجسم حيث يزن 350 غرام لشخص وزنه 70 كغ ويمكن لهذا الوزن أن يزداد بزيادة عمل القلب عند الرياضيين مثلا. يترافق هذه الزيادة الوزنية بازدياد حجم الدم الذي يضخ في النبضة الواحدة وليس عدد النبضات.

nosa_aic
21 - 04 - 2012, 03:20
جديد استخدامات الأسبرين


http://www.inquisitr.com/wp-content/2012/02/Aspirin.jpg (http://www.libyanyouths.com/vb/t141392.html)

لا شك في أن الأسبيرين هو الدواء الأكثر شيوعاً في العالم. لكن قوته في الشفاء تتخطى معالجة الآلام العادية. فقد أشارت الدراسات الجديدة إلى أن الأسبيرين يحارب مجموعة كبيرة من الأمراض الخطيرة، وهو مفيد في مجالات صحّية عدّةلذا، ينصح الأطباء مرضاهم بتناول جرعة خفيفة من الأسبيرين شرط ألا تكون لديهم حساسية تجاهه ولا يعانون مشاكل النزف أو من الربو, وفي ما يأتي بعض الأمراض والحالات التي يفلح الأسبيرين في معالجتها.

مرض القلب المرتبط بالسكري

وجد العلماء أن المصابين بداء السكري هم الأكثر عرضة لتزايد إنتاج الترومبوكسين Thromb boxine ، أي المادة التي تشجع لويحات الدم على التكتّل. لهذا السبب، يكون المصابون بداء السكري عرضة مرتين إلى أربع مرات أكثر للموت نتيجة اشتراكات المرض القلبي الوعائي. ويساعد الأسبيرين في الحؤول دون حصول مرض القلب المرتبط بداء السكري إذ يعيق تركيب الترومبوكسين. وتبيّن أن النوبات القلبية انخفضت بنسبة 44 في المئة لدى الرجال الذين يتناولون علاج الأسبيرين. كما انخفضت هذه النسبة أكثر لدى الرجال المصابين بداء السكري. لذا، توصي الجمعية الأميركية لداء السكري باستعمال جرعة منخفضة من الأسبيرين للتخفيف من خطر الإصابة بالمرض القلبي الوعائي.

الزهايمر

كشفت الأبحاث خلال السنوات الخمس الأخيرة أن الالتهاب في الدماغ يؤدي دوراً في نشوء مرض ألزهايمر. ويفسّر ذلك سبب تضاؤل احتمال الإصابة بمرض ألزهايمر عند الأشخاص الذين تناولو على نحو منتظم أدوية مضادة للالتهاب لمداواة أمراض أخرى مثل التهاب المفاصل أو مرض الأوعية القلبية. كما يتضاءل معدّل فقدان القوة الإدراكية لدى المتقدمين في السن الذين يتناولون الأسبيرين. هكذا، يتّضح أن الأسبيرين لا يؤثر إيجاباً فقط في مرض ألزهايمر وإنما أيضاً في الأشخاص الذين يعانون فقدان الذاكرة مع التقدم في العمر.

السرطان

في العقد الأخير من القرن العشرين، ازداد الاهتمام باستخدام الأسبيرين للحؤول دون الاصابة بالسرطان. فقد أظهرت التجارب أن العقاقير المضادة للالتهاب الخالية من السترويد، بما في ذلك الأسبيرين، تثبط نمو الأورام في عدد من أنواع السرطان، بما في ذلك سرطان القولون والمعدة والمريء. وأجرت جامعة هارفرد الأميركية اختباراً على نحو 90 ألف ممرضة، وتبيّن أن احتمال الإصابة بسرطان القولون والمستقيم انخفض بنسبة 30 في المئة لدى النساء اللواتي استخدمن الأسبيرين بشكل منتظم لمدة 10 إلى 19 عاماً، فيم وصلت هذه النسبة إلى 44 في المئة في حال استخدام الأسبيرين بشكل متواصل لمدة 20 عاماً.

النوبه القلبيه

نعرف جميعاً أن جمعية الصحة الأميركية توصي بتناول الأسبيرين لاتقاء النوبة القلبية لدى المصابين بمرض القلب. لكن عدداً ضئيل منا يدرك أن الأسبيرين يساعد فعلاً في بداية النوبة. ففي العام 1998 ، نصحت جمعية الصحة الأميركية الأشخاص الذين يتعرضون لأعراض النوبة القلبية بتناول الأسبيرين على الفور. وكشفت دراسة عالمية شملت نحو 71 ألف مريض أن معدّل الموت انخفض بنسبة 23 في المئة عند تناول الأسبيرين في غضون 24 ساعة من حدوث أعراض النوبة القلبية. هكذا، إذا شعرت أنك تشهد أعراض النوبة القلبية، أمضغ حبتين من الأسبيرين على الفور. فمضغ الحبّة يؤدي إلى امتصاصها بصورة أسرع مما لو جرى ابتلاعها. فالاسراع في وصول الدواء الى العضلات القلبية خلال النوبة يحميها. وكلما انتظرت وقتاً أطول، تعرّض المزيد من عضلات قلبك للضرر.

فقدان السمع الناتج عن المضادات الحيويه

تشير الأبحاث إلى إمكان تقليص فقدان السمع الناجم عن المضادات الحيوية الشائعة وذلك بتناول الأسبيرين مع تلك العقاقير.
فالمضادات الحيوية وإن كانت تفلح في القضاء على العديد من الالتهابات الجرثومية التي تعجز العقاقير الأخرى عن محاربتها. حيث ان عشرة في المئة على الأقل من مرضى المستشفيات يتلقون المضادات الحيوية، أو ما يعرف بالغلوكسيد الأميني، فإن منظمة الصحة العالمية تعتبرها سبباً أساسياً للصمم الممكن منع حصوله. فالمضادات الحيوية تندمج مع الحديد في الجسم وتولّد الجذور الحرّة Free Radicals ، أي الجزيئات غير الثابتة التي تتلف الخلايا، بما في ذلك آلاف الخلايا الشعرية البالغة الصغر الموجودة في الأذن الداخلية. وحين تتلف هذه الخلايا الشعرية، تفقد الأذن الداخلية قدرتها على كشف الأصوات مما يؤدي إلى فقدان دائم للسمع.
وأشارت الدراسات الأولية التي أجريت على الحيوانات إلى أن الساليسيلات، أي الأسيد الذي يتحول اليه الأسبيرين بعد تفككه في الجسم، يحول دون تكوّن الجذور الحرّة، وبالتالي فقدان السمع الناجم عن المضادات الحيوية. لكن قبل الشروع في تناول الأسبيرين يومياً، عليك مراجعة الطبيب. فالأطباء يحذّرون من تعرض بعض الأشخاص لعواقب وخيمة عند تناول الأسبيرين.
في الواقع، عندما يرقّق الأسبيرين الدم، يؤخر بذلك تخثّره ويؤدي بالتالي إلى نزف مفرط. واستخدام الأسبيرين قد لا يكون ملائماً للذين يعانون مشاكل في الجهاز الهضمي أو نزفاً في المعدة والأمعاء أو مشاكل نزف أخرى. كما يجدر بالذين يودّون الخضوع لعملية جراحية، مهما كانت بسيطة، أن يطلعوا الأطباء في حال تناولهم الأسبيرين. ولا يوصى بالأسبيرين أيضاً للأولاد والمراهقين بسبب ارتباطه مع تناذر راي Reye’s Syndrome ، المرض النادر إنما الخطير الذي يصيب الأطفال. إلا أن الأسبيرين يبقى بالنسبة إلى العديد من الأشخاص العلاج المثالي للحؤول دون بعض الأمراض الخطيرة.

nosa_aic
21 - 04 - 2012, 12:16
نصائح بسيطه للتغلب على الاحباط ..



الحياه لاتخلو من الاحباطات والتوترات

لذلك

اذا أصابك التوتر ووصل بك إلى حد الآستسلام

والشعور بالعجز والرغبه في الأنطواء فمعنى ذلك أن الإحباط قد تملكك .


وعليك عدم الآستسلام لهذا الآحباط

الذي يعد من أخطر المشاكل التي يتعرض لها

الإنسان بصوره مستمره في حياته اليوميه .


فالإحباط يؤثر تأثير سلبيا على سلوكياتنا


فهو يعوق تقد منا في مسيرة الحياة


ويجعل الشاب يبدو كهلا مكبلا بالهموم عاجزا عن الأنجاز ،

وهي حالة شعوريه


تطرأ على الشخص حين يتعرض لضغوط اجتماعيه أونفسيه لأيستطيع مواجهتها


فتؤدي إلى التوتر ثم الآستسلام والشعور بالعجز ، فحين يتعرض الأنسان

_ على سبيل المثال_ إلى

مناوشات بالطريق ثم أختلافات في العمل ثم مشاحنات اسريه


كل ذلك يدفع به الى الأ نطواء والشعور بالإحباط ، وللتغلب على هذا الشعور



الذي قد يؤدي إلى الأكتئاب ننصح بالآتي :


1/ اتباع طريقة التنفيس أو التهدئه الذاتيه بأخذ شهيق عميق وزفير بطئ.



2/تفريغ المشاكل بالفضفضه مع صديق أو إنسان مقرب .



3/ البكاء إذا احس الإنسان بالرغبه في ذلك دون مكابره .



4/ الخروج الى الأماكن العامة المفتوحه .



5/ تدريب النفس على استيعاب المشاكل اليوميه ، باسترجاع التجارب


المشابهه التي مرت به والتغلب عليها فيثق في قدرته على تخطى الأزمه .





6/ تبسيط الضغوط النفسيه ، والثقه بأن أي مشكله لها حل


.


7/ ممارسة الهوايات ؛ لانها تنقل الشخص إلى حالة مزاجيه أكثر سعادة .



8/ أن يترك الإنسان التفكير في مشاكله ويحاول إسعاد الآخرين ؛ فيجد سعادته

الغائبه وليس الأحباط .



9/ تذكر أن دوام الحال من المحال والثقه بأن الوقت كفيل بإنهاء هذه الحاله


هــــــمسه

إن كانت الحياة بحر من الهموم ،

فاركبها بقارب صغير من الصبر

وقل :

اللهم برائحة الجنه بلغني ، وبظل عرشك

اسكني وبمن احب اجمعني .

nosa_aic
28 - 04 - 2012, 20:20
ضرس العقل .. هل له فعلاً علاقة بالحكمة والعقل ..


http://algamal.net/Files/Articles/2010_07/7570_large.jpg (http://www.dlu3at.net/vb/article61776.html)





ارتبط ظهور ضرس العقل في كل الأزمان وفي مختلف الحضارات بتمام ونضوج فكر الإنسان؛ ولذلك نرى أنه يطلق عليه ضرس العقل باللغة العربية، وكذلك سمي بضرس الحكمة عند المجتمع الإنجليزي وكذلك المجتمعات الأخرى، ولكن نحب أن ننوه هنا أن هذه النظرية لها شيء من الصحة، وذلك من ناحية أنه يظهر ما بين الثامنة عشرة إلى الخامسة والعشرين من العمر، وهذه الفترة يكون فيها عقل الإنسان قد وصل إلى مرحلة من الوعي والنضوج، ولكن هذا لا يعني أن نطلق على أي شخص تظهر له ضروس العقل بأنه إنسان راشد عقليا وحكيم، وإنما هو متعلق بالفترة الزمنية فقط لا غير.
ولقد بات ضرس العقل أكثر الأسنان تمييزا، كونه يظهر في سن متأخرة من العمر، وكذلك اعتباره مصدرا للإزعاج لكثير من الناس لما يسببه من مشاكل عديدة؛ ولذلك نضعه اليوم في قفص الاتهام، ونسأله لماذا كل هذه المشاكل التي تسببها، وخاصة لمن هم في سن الزهور؟ وهل أنت السبب في تخريب الأسنان المرتبة بواسطة تقويم الأسنان؟ مسببا تزاحم وتراكم الأسنان في أفواه من يسعون إلى الابتسامة الجميلة الكاملة الخالية من العيوب.
فاليوم نسلط الضوء على هذا الموضوع، ونبحر في طياته؛ لنثقف العامة عن ماهيته وأعراض ظهوره والمشاكل المصاحبة له، وطرق التعامل معه.

ما هو ضرس العقل..



هو آخر الطواحن، والذي يؤدي دورا جيدا في مضغ الطعام، وكذلك يسهل عملية بلعه، وهو آخر الأسنان ظهورا في فم الإنسان؛ إذ جعله الله لحكمة عظيمة جدا ألا وهي ضم جميع الأسنان جنبا إلى جنب، وإغلاق الفراغات الموجودة بين الأضراس، وذلك لمنع تراكم الطعام بين الفتحات المؤدي إلى تكون الجير المسبب لتسوس الأسنان، وعدد ضروس العقل أربعة، اثنان منها موجودان في الفك العلوي، واثنان في الفك السفلي.
ونظرا لأنها آخر الأسنان ظهورا، ففي الغالب لا تجد لنفسها مكانا في عظام الفكين؛ فنجدها إما أنها لا تظهر كليا، وإما أنها تظهر جزئيا، أي جزء ظاهر في الفم والجزء الآخر ضامر داخل عظم الفكين، وهذا مما لا شك فيه يسبب العديد من الانزعاجات لدى الشخص، مسببا كثيرا من الآلام والمتاعب التي لا حصر لها.

الأعراض التي تنتاب الشخص عند بداية ظهور ضروس العقل:



تغير رائحة الفم إلى رائحة كريهة بعض الشيء، كذلك ملاحظة تغير في مذاق الفم، والشعور بعدم الراحة، والعض على الخدين من الداخل؛ مما يسبب التورم في اللثة، وأيضا الشعور بانتقال الألم إلى مفصل الفك، وإلى الأذن والعين، وأحيانا يستمر الألم غالبا لعدة أيام ثم يختفي، وما يلبث أن يعود بعد عدة أسابيع أو أشهر.

عدم ظهور ضرس العقل له أسباب متعددة من أبرزها:



صغر حجم الفك؛ بحيث لا يكون له متسع للظهور كليا، وفي بعض الحالات يسبب عدم ظهور برعم السن كليا منذ البداية؛ فلا تظهر السن نهائيا، وأيضا قد تنمو السن بشكل عرضي أو مائل؛ مما لا تسمح له الأسنان المجاورة بالخروج.
فهذه المشاكل لها عوامل تؤثر عليها ومنها العامل البيئي، ففي السابق وفي العصور القديمة كان الناس يأكلون الطعام الجامد القاسي غير المطبوخ؛ وهذا يؤثر كثيرا على تآكل الأسنان وضمورها، نتيجة الاحتكاك القوي الذي يصيب الأسنان، هذا بالإضافة إلى كبر الفكين في تلك العصور؛ مما ساعد كثيرا على سهولة ظهور ضرس العقل بأريحية.
وعلى العكس في وقتنا الحاضر، مع تيسر سبل المعيشة والحياة المرفهة التي نعيشها، فنوعية طعامنا عموما تتميز بالليونة؛ مما قلل احتكاك الأسنان بعضها ببعض، وأدى ذلك إلى صغر المسافة المخصصة لبزوغ ضرس العقل؛ مما يتسبب في ضموره وعدم ظهوره. والعامل الثاني هو العامل الوراثي، والذي نتج عن تزاوج الأعراق المختلفة بعضها ببعض في الوقت الحاضر؛ مما أدى إلى تزايد نسب تشوهات الأسنان والفكين، ومنها تزاحم الأسنان، وخصوصا ضروس العقل.

المشاكل المصاحبة لظهور ضرس العقل:



قد يحدث التهاب في اللثة التي تحيط المنطقة عند محاولة الضرس الظهور، والأخطر من ذلك أن هذا الالتهاب والتورم قد يحتجز تحته إفرازات صديدية تزيد من الألم، فلا يستطيع الشخص أن يفتح فمه بسهولة، وقد لا يستطيع في بعض الأحيان بلع الطعام مع ارتفاع في درجة الحرارة، والشعور بالتعب والإعياء، وقد يكون ضرس العقل موقعا للآلام بين الحين والآخر نتيجة لضغطه على عصب الفك السفلي.
والمشكلة الأعظم هنا لا تقتصر فقط على تورم أو آلام مزعجة، ولكن تمتد إلى أن يكون ضرس العقل مصدرا للقلق على صحة الإنسان، فموضع هذا الضرس منطقة معرضة للالتهابات المزمنة، التي لا يحس بها غالب الناس، وخاصة السيدات الحوامل، اللاتي هن عرضة لولادة مواليدهن بشكل غير كامل النمو، كالقلب والدماغ وبعض مناطق الجسم، وهذا يجعلنا نلفت الانتباه إلى ضرورة الحفاظ على ضروس العقل من الميكروبات كإحدى الأولويات الصحية لمختلف الأعمار، وإن كانت سلامة جميع الأسنان أمرا مهما أيضا، ولكن موضع ضرس العقل يتميز بأنه بعيد داخل الفم، وبالقرب من مناطق قريبة من الرأس والرقبة بكل ما تحمله من أوعية دموية وليمفاوية يسهل انتقال الميكروبات منها إلى أنحاء الجسم القريبة والبعيدة.

توصيات حول الحفاظ على ضرس العقل أو خلعه:



نقدم لكم هذه النظرة الخاصة، بناء على ما ورد ذكره من أبحاث، وبناء على خبرة كثير من الخبراء في هذا المجال
أولا: كل حالة تختلف عن الأخرى، فإذا كانت ضروس العقل مضمورة ومائلة، وليس لها فراغ لبروزها فهنا ينصح بخلع الضرس في سن العشرين أو قبل ذلك؛ للوقاية من تزاحم الأسنان ومشاكلها.
ثانيا: إذا كانت ضروس العقل مصابة بالتسوس أو بالتهاب اللثة المزمن ينصح أيضا بخلعها بأسرع وقت ممكن.
ثالثا: إذا كان الإنسان يجد صعوبة في تنظيفها، ولا يستطيع الاعتناء بها، فيمكن خلعها مبكرا لمنع تسوسها في المستقبل.
رابعا: إذا كانت ضروس العقل سليمة، ولها فراغ كاف وليست مائلة، فلا يجب خلعها ولكن يجب فحصها باستمرار عند طبيب الأسنان.
خامسا: إذا كانت أسنانك في حاجة لتقويم أسنان، فيفضل عدم خلعها إلا بعد استشارة طبيب التقويم؛ كونه أحيانا يحتاج إلى وجودها لأغراض معينة تساعد في إكمال العلاج. وتقرير خلعها من عدمه يعود إلى خطة العلاج المعدة لتقويم الأسنان.
سادسا: إذا كانت بعض ضروس العقل ناقصة، فيجب خلع البقية الباقية. فمثلا لا يمكن أن نترك ضرس عقل في الفك العلوي دون مثيله في الفك السفلي؛ كونه سيستمر في البزوغ حتى يرتطم بالفك السفلي، وذلك قد يسبب مشاكل في الإطباق والتهابا في اللثة وغير ذلك من المشاكل.
وأحيانا أخرى فإن وجود ضرس عقل في جهة واحده فقط قد يسبب ميلان الأسنان إلى الجهة الأخرى، أو تزاحما في جهة أكثر من الأخرى. ففي هذه الحالات يكون خلع ضروس العقل المتبقية ضروريا جدا.
وفي الختام نحب أن نذكر أن القرار الأول والأخير لخلع أو بقاء ضرس العقل يعود إلى طبيبك المختص، ومدى اقتناعك بما يقول، ويجب الذهاب إليه مبكرا بمجرد الإحساس بأعراض ظهور سن العقل، ولا ننسى دائما أن «الوقاية خير من العلاج» ودمتم بصحة وعافية.

nosa_aic
30 - 04 - 2012, 05:25
الذبحة الصدرية أعراض واسباب وعلاج الذبحة الصدرية

الذبحة الصدرية مصطلح يطلق على ألم يحدث فى صدر الانسان بسبب نقص وصول الدم الى عضلة القلب. تعمل عضلة القلب كمضخة لتوصيل الدم إلى جميع أنحاء الجسم وتحصل عضلة القلب على ما تحتاجه من طاقة (أوكسجين) لأداء تلك المهمة عن طريق الدم الذي يصلها عن طريق الشرايين التي تغذيها وعددها ثلاثة تسمى بالشرايين الاكليلية أو التاجية. والذبحة الصدرية هي الأعراض التي تحدث للمريض عند نقصان الدم الساري في الشرايين التاجية المغذية لعضلات القلب والناتج عن عدم التوازن بين استهلاك القلب للغذاء ونسبة وصول الغذاء إليه وهي في الغالب تكون نتيجة تصلب وضيق الشرايين التاجية مما يمنع وصول الدم بصورة كافية وأحيانا يكون السبب زيادة كبيرة في حاجة القلب للغذاء ” الأوكسجين ” بالرغم من كفاءة الشرايين التاجية مثل حالات تضخم القلب نتيجة لارتفاع الضغط أو لاعتلال عضلي.
ومن المهم معرفة أن الذبحة الصدرية تختلف عن احتشاء عضلة القلب وأنها لا تسبب تلفاً في أنسجته.
طورة الإصابة بالذبحة الصدرية:

إن الذبحة الصدرية تعني أن عضلات القلب لا تكتفي بكمية الاكسجين التي تحصل عليها، وهي عبارة عن عَرَض تحذيري للمصاب به ليتخذ اللازم لزيادة إمداد عضلات القلب بالاكسجين ومعالجة الأمر المسبب لنقصه.
كما أن الاصابة بالذبحة الصدرية لا يعني حتمية الإصابة باحتشاء عضلة القلب فيما بعد إذا اتخذت التدابير اللازمة لمنع ذلك، لكن يمكن أن تكون إنذاراً بحصول الإحتشاء في المستقبل.
عوامل الخطورة للإصابة بالذبحة الصدرية:



التدخين من أهم أسباب حدوث الذبحة الصدرية.
زيادة الوزن.
ارتفاع ضغط الدم.
زيادة نسبة الكوليسترول والشحوم الثلاثية في الدم.
الإصابة بداء السكري.
وجود تاريخ عائلي للإصابة بأمراض القلب ومنها الذبحة الصدرية.
تشخيص الذبحة الصدرية:

يعتمد الطبيب في تشخيصه للذبحة الصدرية على التاريخ المرضي للمصاب، شاملاً وصف الألم ومكانه وسبب حدوثه، بالإضافة لوجود عوامل الخطورة السابقة الذكر. ويطلب الطبيب بعدها إجراء تخطيط للقلب يُعمل أثناء استلقاء المريض على السرير ثم أثناء قيامه بمجهود معيّن كالمشي أو ركوب الدراجة الخاصة بالفحص.
يحتاج بعض مرضى الذبحة الصدرية لعمل صورة أشعة خاصة بشرايين القلب لمعرفة ما إذا كانت متضيقة بفعل ترسب بعض المواد عليها.
علاج الذبحة الصدرية:



التوقف عن التدخين.
الامتناع عن شرب الخمور.
إنقاص الوزن الزائد.
الحمية الغذائية والتقليل من الدهون وخاصة المشبعة.
ممارسة التمارين الرياضية بانتظام.
التحكم الجيد بداء السكري.
التحكم الجيد بضغط الدم.
ممارسة الاسترخاء بانتظام للتخلص من الضغوط النفسية او التحكم بها
استعمال بعض العقاقير الطبية التي تعمل على توسيع الأوعية الدموية تُصرف بعد مراجعة الطبيب وتؤخذ عند بداية الأحساس بالألم (مثل النيتروجليسرايد)
أخذ جرعة صغيرة يومية من الأسبرين.
مراجعة الطبيب بانتظام واتباع النصائح الطبية
يحتاج بعض المرضى لعمل توسيع للشرايين التاجية عن طريق القسطرة أو لعملية جراحية لتبديل الشرايين بأخرى سليمة تؤخذ من الفخذ.
ما الفرق بين الذبحة الصدرية المستقرة والذبحة غير المستقرة؟

تحدث الذبحة الصدرية الاعتيادية أو المستقرة في أحوال معينة.
مثلاً: بعد القيام بمجهود بدني أو التعرض لضغوط نفسية أو للحر أو البرد، وتختفي عند الراحة، وتزيد حدة الألم تدريجياً.
أما الذبحة الصدرية غير المستقرة فهي تحدث أحياناً دون التعرض للأسباب سالفة الذكر، أو تستمر على الرغم من الراحة، أو أنها تبدأ فجأة بألم حاد وشديد جداً، أوتكون حدة الألم فيها مساوية لتلك التي تحدث في حالة احتشاء عضلة القلب على الرغم من أن الفحوصات المخبرية تؤكد عدم وجود الإحتشاء.
وتعتبر الذبحة الصدرية غير المستقرة أشد خطورة من الذبحة المستقرة وتُنذِر باحتمال الإصابة باحتشاء قريب لعضلات القلب.
العلامات المنذرة في الذبحة الصدرية:

يتأقلم المصابون مع أعراض الذبحة الصدرية ويمكنهم عادة التحكم بها، لكن يحدث في بعض الأحيان أن يصابوا ببعض الأعراض التي تنذر بوجود مشكلة أكبر من الذبحة، ولذلك لا بد من استشارة طبية عاجلة،
وهذه الأعراض أو العلامات هي:



استمرار ألم الذبحة الصدرية لأكثر من عشر دقائق.
زيادة حدة الألم عن العادة.
عدم تأثر الألم باستعمال الأدوية المعتادة واستمراره على الرغم منها.
زيادة عدد نوبات الألم عن المعتاد.
الإحساس بالألم أثناء الراحة.
الاحساس بأعراض جديدة لم تكن موجودة في السابق.
اسباب الذبحة الصدرية:



عندما تزيد حاجة القلب للدم والأكسجين عن الكمية المتاحة، وهذا يكون أثناء الحركة والنشاط مما يؤدى إلى حدوث الذبحة الصدرية.
أو بسبب الضغوط النفسية.
أو بعد تناول وجبة دسمة.
أو بسبب الإحساس بالحر أو البرد الشديدين.
يزيد الدم القادم الى القلب عادةً عند زيادة الحاجة له، لكن في بعض الحالات تكون الشرايين ضيقة بسبب ترسب بعض المواد عليها (atherosclerosis)، أو تتقلص الشرايين لأسباب مختلفة فلا تتمكن من زيادة كمية الدم فتحدث الذبحة. ويصاب المدخنون وزائدوا الوزن بالذبحة الصدرية أكثر من غيرهم.
الأعراض المصاحبة للذبحة الصدرية:

من أهم اعراض الذبحة الصدرية هو الأحساس بألم قليل ضاغط خلف عظمة القص، ينتشر الألم أحياناً الى الرقبة والفكين، أو الى الظهر أو الذراعين. ويحدث الالم مع المجهود العضلي أو النفسي ويختفي عند الراحة.
يشتكي بعض المصابين من صعوبة في التنفس وزيادة في التعرق والإحساس بالغثيان والتعب والإرهاق الشديدين. ومن المهم معرفة أن ليس كل ألم في الصدر يعني ذبحة صدرية، فقد يكون الألم ناتجاً عن شد في عضلات الصدر أو بسبب مشكلة في المريء، أو في الجهاز التنفسي.

nosa_aic
01 - 05 - 2012, 07:08
التوتر العصبى يسبب الام الظهر



http://static.dot.jo/uploads/repository/25ed6d89d638ba90ecca86a41499979065b69638.jpg (http://www.dlu3at.net/vb/article59771.html)


أثبتت دراسة طبية حديثة أجراها باحثون أمريكيون أن آلام الظهر والكتف والرقبة ترجع الى أسباب نفسية والذى يشبه الى حد كبير ذلك الألم الحقيقى الناتج عن التوتر العضلى ، ولكن الاختلاف هو فى أن التوتر العضلى يحدث بسبب الانفعالات الزائدة، وليس بسبب تلف فى أحد الأنسجة أو مكونات الجسم أو نتيجة إحدى الإصابات الرياضية.

وقال الباحثون عندما يصاب الإنسان بالاحباط وتهبط عزيمته و يشعر بالخوف والتوتر العصبى الشديد فإن الجسم ينتج موادا كيميائية يطلق عليها هرمونات "القتا" أو الطيران تجعل العضلات مشدودة ، مما يجعلها غير مستعدة للأداء والحركة.

وأضافوا أن عوامل القلق والتوتر والاكتئاب تسبب عدم الشعور بالارتياح والنتيجة هى أن الإنسان يجلس فى عمله أو مكتبه متوترا مستشيطا غضبا نتيجة لخطأ ما ارتكبه أحد الزملاء فى العمل ، أو وهو جالس فى السيارة خلف عجلة القيادة نتيجة لخطأ أحد السائقين الآخرين أو نتيجة لتأخره عن العمل نتيجة لازدحام المرور ، فتتشنج عضلاته ويصيبها الآلم، طبقاً لما ورد بوكالة "أنباء الشرق الأوسط".

ويختلف الشعور بالآلم من شخص لآخر ، فالبعض يشعر بالأم فى الرقبة ، والبعض يتطور ليشمل الكتفين والذراعين ، والبعض الآخر قد يشعر بالألم فى أسفل الظهر ، وقد يتطور ليمتد للرجلين وقد يؤدى إلى تقلص عضلى يصيب كل هذه المناطق

nosa_aic
01 - 05 - 2012, 07:22
الوقاية من امراض القلب


http://www.hgate.net/blog/wp-content/uploads/2011/04/cholesterol_s1_fresh_rasberries.jpg (http://www.dlu3at.net/vb/article61531.html)


الكثير منا يعلم أن ارتفاع نسبة الكوليسترول في الدم قد تزيد من خطر الإصابة بأمراض القلب
إليكم خطوات لخفض الكوليسترول و الوقاية من أمراض القلب
أولا يجب أن نعلم هنالك عدة أنواع من الكوليسترول
TG الدهون الثلاثية


LDL و هو النوع السيء الدي نريد خفضه, وزيادته مؤشر خطر لزيادة تصلب الشراين و أمراض القلب


HDL و هو النوع الجيد الـذي نريد زيادته و هو يساعد على التخلص من الكوليسترول السيء من الجسم
و نستطيع ذلك بتغير أسلوب حياتنا و المحافظة على غـذائنا


1-لتعلم الكمية المناسبة لك

http://www.hgate.net/blog/wp-content/uploads/2011/04/istock_photo_of_handful_of_pistachio_nuts.jpg (http://www.dlu3at.net/vb/article61531.html)


معظمنا يتجه إلى المطاعم و يطلب الوجبات ذات الأحجام الكبيرة التي تؤدي إلى زيادة الوزن و ارتفاع نسبة الكوليسترول
و الكثير يأكل أكثر مما يحتاجه جسمه
لـذا اتخد كف يدك كمقياس لحصة ما يجب أن تأكله


2-أشبع معدتك بالكثير من الخضار و الفاكهة ..


http://www.hgate.net/blog/wp-content/uploads/2011/04/istock_photo_of_green_grocer_display.jpg (http://www.dlu3at.net/vb/article61531.html)
حوالي من 5-9 حصص باليوم
فهي تعمل على خفض نسبة LDL و تحتوي على الكثير من مضادات الأكسدة المفيدة للجسم

3-اتجه إلى خيرات البحر ..

http://www.hgate.net/blog/wp-content/uploads/2011/04/istock_photo_of_fresh_salmon.jpg (http://www.dlu3at.net/vb/article61531.html)
تناول الأسماك و خصوصا السردين و التونا فهي تحتوي على دهون مفيدة غير مشبعة أوميجا3 التي تساعد على خفصTG
و ابتعد عن قلي الأسماك

4-ابدأ يومك بالحبوب الكاملة

http://www.hgate.net/blog/wp-content/uploads/2011/04/istock_photo_of_whole_grain_cereal.jpg (http://www.dlu3at.net/vb/article61531.html)
الحبوب الكاملة هي التي لم يتم تصنيعها أو إزالة قشورها،كالنخالة و الخبز الأسمر و الشوفان و الشعير و الأرز البني
فهي تعطيك الكثير من الطاقة و تشعرك بالشبع لمدة طويلة

5-تحتاج إلى وجبة خفيفة اتجه إلى المكسرات

http://www.hgate.net/blog/wp-content/uploads/2011/04/getty_rr_photo_of_mixed_nuts.jpg (http://www.dlu3at.net/vb/article61531.html)
فهي تحتوي على دهون أحادية التشبع التي تساعد على خفضLDL الإبقاء على HDL في الجسم
و لكن تـذكر الحصة تكون بمقدار كف يدك

6-زيت الزيتون و ما أدراك ما لزيتون

http://www.hgate.net/blog/wp-content/uploads/2011/04/getty_rf_photo_of_bread_dipped_in_olive_oil.jpg (http://www.dlu3at.net/vb/article61531.html)


استبدل زيت طعامك بزيت يحتوي على دهون غير مشبعة كزيت الزيتون و دوار الشمس و ابتعد عن زيت النخيل و الزبدة لمضارها الكثيرة على صحتك.

7-لا للأبيض


http://www.hgate.net/blog/wp-content/uploads/2011/04/getty_rm_photo_of_basket_of_bread.jpg (http://www.dlu3at.net/vb/article61531.html)



لا للأرز الأبيض و الخبز الأبيض و المعجنات و الحلويات ..حاول التقليل منها ..فهي تعطيك جرعة سريعة و عالية من السكريات و لكن سرعان ما ستشعر بالجوع في فترة قصيرة.. استبدلها بالحبوب الكاملة

8-الرياضة للجميع

30 دقيقة من التمارين الرياضية لخمسة أيام في الأسبوع كفيلة بخفض نسبة الكوليسترول في الجسم
لا تستطيع ذلك ..فقط امشي فالمشي يجدد صحتك و نشاطك
ليس لديك وقت ..اجعل نشاطاتك رياضية ..استخدم السلالم بدلا من المصاعد ..امشي إلى العمل ..
و للسيدات البيوت ..الأعمال المنزلية من أفضل التمارين الرياضية


9- أستطيع السيطرة على غدائي في البيت و لكن في خارجه يحصل الكثير من الدمار

http://www.hgate.net/blog/wp-content/uploads/2011/04/istock_photo_of_sandwich_and_fries.jpg (http://www.dlu3at.net/vb/article61531.html)
عند تناولك الطعام في الخارج ..لتكن اختيارتك ذكية
اختر الأطعمة المشوية أو المطهية بالخار و ابتعد عن القلي
اجعل الصلصة خارجية ..كثير من الصلصات تحتوي على نسب عالية من الدهون
تناول نصف الوجبة …تشارك وجبتك مع من تحب

ابو مالك
02 - 05 - 2012, 00:47
http://t3.gstatic.com/images?q=tbn:ANd9GcRK1U_zDb63y5hOGU7b71Dw50mr7lD1F sAaWVUHDHxhXdI56KSkww

nosa_aic
11 - 05 - 2012, 07:56
http://t3.gstatic.com/images?q=tbn:ANd9GcRK1U_zDb63y5hOGU7b71Dw50mr7lD1F sAaWVUHDHxhXdI56KSkww




http://m002.maktoob.com/alfrasha/ups/u/26720/31303/392675.gif

nosa_aic
11 - 05 - 2012, 07:59
هذه طريقة بسيطة لشرح عملية قياس الضغط مع الصور

يتم قياس ضغط الدم بربط كُم مطاطي حول الذراع الأيسر ثم نفخ الهواء فيه وملاحظة كمية الضغط اللازم لوقف جريان الدم خلال الشريان
الموجود تحت الكُم بالإنصات إليه عبر السماعة الطبية ويسجل قياس ضغط الدم على هيئة رقمين
يسمى الرقم الأول الضغط الانقباضي systolic
أما الرقم الثاني فيسمى الضغط الانبساطي diastolic
ووحدة قياس الضغط هي الملليمتر زئبق،
والجهاز الذي يقيس ضغط الدم يدعى سفيقنومونوميتر Sphygmomanometer
وقد اقترحت منظمة الصحة العالمية أنه عندما يصل ضغط الدم عند الإنسان أكثر من 140/95 فإنه يعد غير طبيعي،
وقد تم مؤخراً تصنيف وتقسيم ضغط الدم على حسب
شدته وهو كالآتي:


التصنيف الضغط الانقباضي/ الضغط الانبساطي


Optimalالضغط المثالي 120/ 80
Normalالضغط الطبيعي 130 او اقل/ 85 او اقل
H.Normalالضغط فوق الطبيعي 130-139 /85-89
Grade-1ضغط مرتفع من الدرجة الاولى 140-159 /90-99
Grade-2ضغط مرتفع من الدرجة الثانية 160-179 /100-109
Grade-3ضغط مرتفع من الدرجة الثالثة 180 او اعلى/ 110 او اعلى
http://www.lojein.com/modoi/102.gif (http://www.dlu3at.net/vb/article62735.html)



http://homepage.smc.edu/wissmann_paul/anatomy1/bloodpressuremeasurement.JPG (http://www.dlu3at.net/vb/article62735.html)




قلب الأنسان عبارة عن مضخه تدفع الدم القادم من الرئه الى الجسم عبر الشرايين و تسحب الدم من الجسم
و تدفعه للرئه عبر الأوردة بشكل منتظم على شكل دورة متتابعه ما بين انقباض و انبساط وتسمى بالنبضات.


يطلق على قوة دفع القلب للدم في الشرايين بضغط الدم و يتم قياسه مقدار الضغط بعدد من الطرق
و سنشرح اشهرها وهي استخدام حزام الضغط.
Sphygmomanometer


يتكون الجهاز من حزام داخله كيس يتم تعبئته بالهواء بواسطه مضخه هوائيه يدويه و يتصل بالكيس
جهاز قياس (سواء كان سائل او على شكل عداد).
كما تستخدم سماعه الأذن لسماع صوت جريان الدم اثناء القياس.



http://www.lojein.com/modoi/102.gif (http://www.dlu3at.net/vb/article62735.html)



http://homepage.smc.edu/wissmann_paul/anatomy1/bppic1.jpg (http://www.dlu3at.net/vb/article62735.html)


طريقة عمل الجهاز :
يتم ربط الحزام على اليد (فوق المرفق) بشكل جيد ثم يتم تعبئته بالهواء فيضغط الحزام على اليد مانعا مرور الدم في الشريان للجزء المتبقي من اليد
و هنا سيضغط الشريان على سطح الحزام بمقدار الضغط المتولد فيه من جراء دفع القلب للدم وبذلك يمكن قياس التغير في ضغط الهواء داخل الكيس
حسب تغير الضغط داخل الشريان
http://www.lojein.com/modoi/102.gif (http://www.dlu3at.net/vb/article62735.html)



http://homepage.smc.edu/wissmann_paul/anatomy1/bppic2.jpg (http://www.dlu3at.net/vb/article62735.html)


(1)
بعد ربط الحزام يتم وضع السماعه على سطح اليد فوق الشريان و يتم نفخ الجزام حتى يتوقف الدم من الجريان و هنا لا يسمع للدم اي صوت في السماعه.



http://www.lojein.com/modoi/102.gif (http://www.dlu3at.net/vb/article62735.html)
http://homepage.smc.edu/wissmann_paul/anatomy1/bppic3.jpg (http://www.dlu3at.net/vb/article62735.html)


(2)
يتم تفريغ الحزام من الهواء بالتدريج و بمجرد بدا الدم في الجريان سيمكن سمعا صوته في السماعه في حينها يتم قراءه الضغط على جهاز القياس
و يكون هذا اعلى قرائه للضغط او الضغط العالي او ما يسمى ضغط الأنقباض


(3)
يتم الأستمرار في تفريغ الحزام تدريجا و سينخفض صوت جريان الدم كذلك في السماعه حتى يتم الوصول الى مرحله يختفي فيها صوت
جريان الدم في السماعه حينها يتم قراءه الضغط في جهاز القياس و سيكون هذا الضغط المنخفض او ما يسمى ضغط الأنبساط
http://www.lojein.com/modoi/102.gif (http://www.dlu3at.net/vb/article62735.html)




http://homepage.smc.edu/wissmann_paul/anatomy1/bp.gif (http://www.dlu3at.net/vb/article62735.html)

اتمنى للجميع الصحة والعافية

hanan desoky
13 - 05 - 2012, 11:17
السلام عليكم ورحمة الله وبركاته

http://up.esgmarkets.com/uploads/images/esgm-1946351b9e.jpg (http://up.esgmarkets.com/)

ابو مالك
18 - 05 - 2012, 11:05
http://1.bp.blogspot.com/-E8T6_xhcK-I/TfsbQoOhBHI/AAAAAAAAH3E/61728-jMovA/s1600/ZTE77509.jpg

اميره اميره
26 - 05 - 2012, 19:49
http://a3.sphotos.ak.fbcdn.net/hphotos-ak-ash4/301736_385498551496375_287696717943226_1037127_190 5658592_n.jpg

nosa_aic
01 - 06 - 2012, 11:27
http://a3.sphotos.ak.fbcdn.net/hphotos-ak-ash4/301736_385498551496375_287696717943226_1037127_190 5658592_n.jpg

اللهم اميييييين

nosa_aic
01 - 06 - 2012, 11:28
نصائح وإرشادات مهمة لمرضى الضغط



http://l1.yimg.com/bt/api/res/1.2/J2LMrS7jiMNNEdHX.yN46w--/YXBwaWQ9eW5ld3M7cT04NTt3PTUxMA--/http://l.yimg.com/os/401/2012/05/29/118396651-jpg_095750.jpg (http://www.dlu3at.net/vb/article63741.html)


فى بعض الأحيان لا يدرك مريض الضغط ما هو مقياس الضغط المناسب، وما مؤشرات الضغط العالى، وكيف يتعامل كى لا يرتفع معدل ضغطه، فكلها أمور تحتاج إلى إرشادات ونصائح خاصة كى يسيطر على المرض القاتل الصامت.

يوضح الدكتور وائل صفوت، مستشار الطب العام وأخصائى أمراض الباطنة والجهاز الهضمى والكبد، أن من أهم الأمور التى يجب على مريض الضغط معرفتها هو نسبه الصحيحة حيث لا يجب أن يزيد ضغطك عن 89 / 139 مم زئبق فى أى حال من الأحوال، أما إذا كنت تعانى من مرض السكر فيجب ألا يزيد ضغطك عن 84 / 129 مم زئبق، وفى حالات وجود زلال فى البول بكميات كبيرة نتيجة مضاعفات مرض السكر يجب ألا يزيد ضغطك عن 74 / 124 مم زئبق.

كما لا يجب أيضا أن تأخذ نصيحة من شخص غير مؤهل أو ليس مختصا، حيث يجب أن تشارك طبيبك وتساعده على العناية بك وعلاجك، وقد يكون فى بداية الأمر صعباً عندما تتغير من عاداتك اليومية لإدخال البرنامج العلاجى، ولكن الطبيب المعالج سيقوم بمتابعة تطور حالتك بطريقة فعالة.

وحول النظام الغذائى لمريض الضغط يقدم الدكتور وائل بعض النصائح وهى:

الإقلال من ملح الصوديوم فى نظامك الغذائى، حيث يجب على مرضى الضغط الإقلال من استخدام ملح الطعام.

الإقلال من استخدام الأغذية المحفوظة (لاحتوائها على نسب عالية من الصوديوم كمادة حافظة).

الابتعاد عن الوجبات الخفيفة كثيرة الملح، مثل الشيبسى والبسكويت المملح والمكسرات المملحة والبسطرمة.

ويجب تجنب تناول الوجبات السريعة، لاحتوائها على نسب عالية من الصوديوم، مع تجنب أية مصادر للملح، مثل الجبن الرومى والزيتون والمخلل والأسماك المحفوظة.

ويوضح أن صفوت بعض الأمور المهمة فى النظام الغذائى، منها قراءة الورقة الملصقة بالأطعمة المختلفة الموجودة بالأسواق للتأكد من نسبة الصوديوم فيها، كما يجب الإقلال من السكر والحلويات لأن ذلك يؤدى إلى زيادة الوزن، فى حين أن الكربوهيدرات يسمح بتناولها بحرية خاصة الكربوهيدرات سهلة الهضم.

ويشير الدكتور وائل إلى ضرورة الامتناع عن الأطعمة الغنية بالكوليسترول مثل: اللحم الأحمر - اللحوم السمينة مثل الضأن، والمخ والكبدة والكلاوى والسجق والهامبرجر - صفار البيض - البط والأوز والحمام وجلد الطيور - المكرونة المجهزة بالبيض أو اللبن أو المواد الدسمة الأخرى كالباشمل والسمن والقشدة، والألبان الدسمة والأيس كريم والجبن الدسم - الجمبرى والاستاكوزا والأسماك عالية الدهون مثل الثعابين والقراميط.

nosa_aic
01 - 06 - 2012, 11:33
لماذا يقول الأطباء أفتح فمك



http://sama7b.com/up/viewimages/26e88e59e8.jpg (http://www.dlu3at.net/vb/article63786.html)

هل سئلت نفسك مرة واحده
لماذا يصر الأطباء أثناء زيارتنا لهم في العيادة

على طلبهم الدائم بفتح الفم ومد اللسان ..!؟

من منا لم يسمع كلمة ( إفتح فمك ) أكيد لا أحد

معلومة كنت أجهلها
.. ولو تدري ما هي فوائد مد اللسان ودلالاتها
لمددت لسانك كل دقيقه

فالطبيب يسألك أن تخرج لسانك عند الفحص وذلك للأسباب التالية :

1- اذا كان لون لسانك يميل الى الاصفرار

فهذا دليل على نسبة الصفار عالية في الدم

2- اذا كان لون لسانك يميل الى الزرقة

فهذا يدل على وجود مرض بالقلب أو الجهاز التنفسي

3- اذا كان لون اللسان أحمر ورديا

فهذا يدل على الصحة

4- اذا كان لون اللسان باهتا

فذلك يدل على وجود أنيميا

5- اذا كان يكسو اللسان طبقة بيضاء

فهذا يدل على وجود حمى وإضطراب في الهضم

6- اذا كان هنالك رعشة فى اللسان عند اخراجه من الفم

فهذا يدل على وجود تسمم أو توتر عصبي

nosa_aic
11 - 06 - 2012, 08:33
الأنيميا عند الأطفال .. أعراضها وكيفية التعامل معها


http://l.yimg.com/bt/api/res/1.2/uR3UfQMoOoBQuH9AaY6M5w--/YXBwaWQ9eW5ld3M7cT04NTt3PTYzMA--/http://media.zenfs.com/ar_XA/News/GN4ME/327578.jpg (http://www.dlu3at.net/vb/article63813.html)

يصاب الطفل بالأنيميا أو فقر الدم إذا كانت كرات الدم الحمراء عنده قليلة مع الوضع فى الاعتبار أن معظم حالات الأنيميا عند الأطفال تكون بسبب نقص فى الحديد. وعلى كل أم أن تعلم أيضا أن نقص عناصر معينة فى نظام الطفل الغذائى مثل فيتامين سى و ب 12 أو عدم القدرة على امتصاص تلك العناصر الغذائية هو أمر قد يؤدى أيضا للأنيميا أو فقر الدم. إن جسم الإنسان يحتاج للحديد لصناعة الهيموجلوبين وهو الذى يحمل الأوكسجين للدم، فإذا لم يحصل طفلك على كمية كافية من الحديد فإن كرات الدم الحمراء عنده ستكون أقل وحتى كرات الدم الموجودة عنده ستكون أصغر من الحجم المعتاد وبالتالى فإن أنسجة الجسم لن تتلقى كمية الأوكسجين الكافية أو اللازمة. وعليك أن تعلمى أن الأطفال يكونون معرضين أكثر للإصابة بالأنيميا خلال فترات النمو السريع عندما يحتاجون لكميات إضافية من الحديد ولا يحصلون عليها فى المقابل. ولكن عليك أن تعلمى أيضا أن الأنيميا أو فقر الدم بسبب نقص الحديد لا تصيب الطفل فجأة وهى تحدث بسبب : أن نظام الطفل الغذائى قد يكون لا يحتوى على كمية كافية من الحديد أو أنه لا يمتصها جيدا أو أنه حتى يفقد الدم كثيرا.
إذا شعرت بأن طفلك قد يكون مصابا بالأنيميا فعليك أن تستشيرى الطبيب فورا لأن هناك بعض الأعراض للأنيميا قد تكون خفية ولكنها فى نفس الوقت خطيرة مثل تضخم الكبد أو الطحال. يجب على كل أم أن تعلم أن الأنيميا بسبب نقص الحديد عند الأطفال سن ما قبل دخول المدرسة قد تسبب تأخرا فى النمو ومشاكل فى السلوك كعدم القدرة على التواصل الاجتماعى وهى أمور قد تستمر مع الطفل حتى سن دخول المدرسة إذا لم تتم معالجة الأنيميا.

http://l.yimg.com/bt/api/res/1.2/f3.pVw3LsxYsSNvpwGDHNw--/YXBwaWQ9eW5ld3M7cT04NTt3PTYzMA--/http://media.zenfs.com/ar_XA/News/GN4ME/327579.jpg (http://www.dlu3at.net/vb/article63813.html)

الطفل ما بين التسعة أشهر و24 شهرا يكون معرضا بنسبة كبيرة للإصابة بالأنيميا. كما أن طفلك إذا كان لا يحصل على كفايته من الحديد فإنه قد يصاب بالأنيميا. ويجب أن تعلمى أيضا أن إصابة طفلك بالأنيميا قد تكون بسبب أنه يشرب كميات لبن كبيرة. فاللبن هو عنصر مهم فى نظام الطفل الغذائى ولكنه أيضا لا يحتوى على الكثير من الحديد وقد يتعارض مع عملية امتصاص الجسم للحديد. كما أن طفلك إذا كان يشرب كميات لبن كبيرة فإن هذا الأمر قد يحل محل استهلاكه للأطعمة المليئة بالحديد. يجب عليك أن تنتبهى أيضا أن طفلك إذا كان يعانى من حساسية من اللبن البقرى ولم تكتشفيها بعد، فإنه قد يعانى من نزيف فى الأمعاء مما قد يؤدى بالتالى لإصابته بالأنيميا.
كيف تعرفين إذا كان طفلك مصابا بالأنيميا ؟
- هناك الكثير من الأطفال المصابين بالأنيميا تظهر عليهم علامات التعب والإرهاق حتى إذا كانوا قد نالوا قسطا من النوم والراحة
- إذا كان طفلك مصابا بالأنيميا، فإن قلبه لن يصله الأوكسجين الكافى وبالتالى فإنه سيضخ بطريقة أسرع ليحصل على الأوكسجين الكافى، وبذلك تكون ضربات القلب السريعة هى أيضا عرضا من أعراض الإصابة بالأنيميا
- إن طفلك المصاب بالأنيميا قد يشعر أيضا بالدوران أو عدم الاتزان لأن المخ قد لا يصله أيضا الأوكسجين الكافي
- إن من علامات إصابة الطفل بالأنيميا أيضا أنه يكون شاحبا بسبب نقص الهيموجلوبين فى كرات الدم الحمراء عنده
- يجب أن تعلمى ايضا أن طفلك إذا كان فاقدا للشهية فإن هذا قد يكون بسبب إصابته بأنيميا نقص الحديد
- يجب عليك أن تفحصى طفلك دائما وتتأكدى ما إذا كان يعانى من عدم قدرة على التنفس بسهولة أو من دوار بعد ممارسته لبعض الحركة والأنشطة الرياضية
- يجب عليك أن تنتبهى أيضا للصداع والتقلصات العضلية عند طفلك من حيث عدد مرات الحدوث والمدة
إذا كنت تريدين حماية طفلك من الإصابة بالأنيميا، فيمكنك أن تطعميه حبوب إفطار مدعمة بالحديد وأطعمة أخرى مثل اللحوم والدواجن والأسماك والباستا والأرز والبيض والخضروات. عليك أيضا أن تقدمى لطفلك خضروات وفواكه تمتلئ بفيتامين سى مثل البرتقال والفراولة والكيوى والأفوكادو والتى تساعد كلها على امتصاص الجسم للحديد.

nosa_aic
11 - 06 - 2012, 08:54
الأفكار الشائعة عن الحساسية عند الأطفال
ما بين الصح والخطأ


يزداد يوماً بعد يوم عدد الأطفال الذين يعانون من الحساسية. لكن مع التطورات العلمية الحاصلة، يفترض ألا تشكل الحساسية أي عبء على حياة المصابين بها. في ما يأتي لمحة عن الأفكار الشائعة بشأن الحساسية.

ما هي الحساسية بالضبط؟

الحساسية هي تفاعل شاذ وغير طبيعي في جهاز المناعة ناجم عن الاحتكاك بمادة غريبة بالجسم وإنما يمكن تحمّلها عادة. إنها تعرف بالمادة المسببة للحساسية. تكون الأعراض السريرية للحساسية متنوعة ووخيمة نوعاً ما. قد تكون شاملة، أو في البشرة، أو في الجهاز التنفسي، أو في العينين، أو في الجهاز الهضمي... وفي أغلب الأحيان، تظهر الأعراض بسرعة بعد الاحتكاك بالمادة المسببة للحساسية، في غضون بضعة دقائق إلى بضعة ساعات.

تتيح بعض الأعراض كشف مدى الاستعداد للحساسية
صح. فهناك الكثير من الأعراض التي تسهم في تحديد الاستعدادات المسبقة للحساسية عند الطفل، بدءاً من الاستمرار الطويل الأمد لبعض الأمراض مثل الأكزيما، والتهاب القصيبات الهوائية، والتهاب أغشية العينين، والتهاب الجيوب الأنفية، والتهاب الحنجرة. وفي الإجمال، يستحسن إجراء تحليل مفصّل لمسببات الحساسية لكل طفل يكشف عن أعراض حساسية مستمرة أو متكررة أو وخيمة أو مستلزمة لعلاج مستمر.

ليست الحساسية مرضاً حقيقياً
خطأ. فالحساسية هي مرض حقيقي قد تظهر أعراضها بدءاً من الأسابيع الأولى في الحياة وتتكشف في أي عمر. تظهر الحساسية بطريقة مفاجئة نوعاً ما وبأشكال مختلفة (حساسية غذائية، حساسية في الجهاز التنفسي، حساسية في البشرة، حساسية إجمالية....) وبطريقة وخيمة نوعاً ما. ويمكن لبعض أنواع الحساسية، مثل داء الربو الخارج عن السيطرة أو صدمة العوار، أن تكون مميتة.

تتطور تفاعلات الحساسية مع الوقت
صح. فأعراض الحساسية تتطور خلال الطفولة. وتختفي غالباً بصورة مفاجئة مع العمر، لكنها قد تستمر أيضاً، لا بل تتفاقم إذا لم تتم معالجتها بطريقة صحيحة. وهي تحصل عموماً وفق التسلسل التالي: حساسية غذائية، حساسية جلدية موضعية عند الطفل الرضيع (بدءاً من عمر 3 أشهر)، حساسية في الأنف عند أولاد المدرسة، وأخيراً داء الربو والتهاب الشعيبات الهوائية عند الأطفال في بداية العمر المدرسي.

ينقل الأهل المرض إلى أولادهم
صح وخطأ. كلما امتلك الطفل عدداً أكبر من الأهل المصابين بالحساسية، ازداد خطر تعرضه هو أيضاً لهذا المرض. هكذا، فإن الطفل الذي يعاني أحد أهله فقط من الحساسية يكون معرّضاً بنسبة 40 في المئة لأن يعاني هو أيضاً من الحساسية. وقد ترتفع هذه النسبة إلى 60 في المئة إذا كان الأب والأم مصابين معاً بالحساسية. لكن هناك العديد من الأطفال المصابين بالحساسية والذين لا يعاني أهلهم من أية حساسية. لا يمكن القول إذاً إن المشكلة وراثية على الدوام.

لا يمكن تشخيص الحساسية قبل عمر 5 سنوات
خطأ. فعلى عكس الاعتقاد الشائع، يمكن تشخيص الحساسية بدءاً من الأشهر الأولى للحياة، وذلك عبر فحص سريري وتحاليل للبشرة لتأكيد الحساسية أو المواد المسببة للحساسية. وبدءاً من الأشهر الأولى لعمر الطفل، يمكن إجراء فحوص مكملة لتأكيد النتائج أو ضحدها عند الضرورة.

لا يوجد علاج للحساسية
خطأ. فبعد تشخيص الحساسية، لا بد أن يتولى الطبيب مسألة تخفيف الأعراض وتفادي تفاقم الحساسية (ظهور أنواع جديدة من الحساسية، تطور داء الربو أو تفاقم الأعراض). وتقوم المعالجة على وصف أدوية لتخفيف الأعراض، وتخفيف الاحتكاك بالمادة المسببة للحساسية، وتعلّم التعايش مع المرض بشكل يومي.

الحساسية تمنع الأشخاص من العيش مثل الآخرين
خطأ. فالطفل المصاب بالحساسية يجب ألا يعامل بطريقة مختلفة عن رفاقه. يكفي اتخاذ بعض الاحتياطات لتفادي تعرض الطفل للمواد المسببة للحساسية في المدرسة والمنزل وأماكن اللعب، عبر تنظيف المساحات جيداً، وتهوئة الغرف كل يوم، ومنع التدخين، وإبعاد الحيوانات والنباتات الخضراء....

يوصى بعدم ممارسة الرياضة في حال المعاناة من داء الربو
خطأ. بالعكس، يوصي الأطباء بالممارسة المنتظمة لأي نشاط جسدي. لكن لا بد من اتخاذ بعض الاحتياطات لتفادي نشوء الأزمات، مثل تحمية العضلات لمدة خمس عشرة دقيقة، وتفادي تمارين القدرة على التحمل (مثل الركض، والركوب على الدراجة الهوائية...) خلال فترات البرد والجفاف، وتناول الدواء الوقائي عند الضرورة قبل ممارسة التمرين الجسدي. وحده الغوص تحت الماء ممنوع في حال كان داء الربو خارجاً عن السيطرة. كما يحظر على الأولاد المصابين بداء الربو الركوب على الأحصنة.

المستحضرات «غير المسببة للحساسية» ملائمة للأطفال المصابين بالحساسية
خطأ. فالمستحضرات "غير المسببة للحساسية" تعني فقط أنها غير مؤذية للبشرة الحساسة. لكن هذا لا يعني أنها قد لا تسبب حساسية.

الطفل الذي يرضع من أم مصابة بالحساسية يكشف عن احتمال أكبر للتعرض للحساسية
خطأ. فإذا كانت الأم مصابة بالحساسية، يكون الطفل معرضاً بنسبة 40 في المئة للحساسية، سواء أرضعته أمه أم لا. وفي الإجمال، يوصي الأطباء بالرضاعة الطبيعية، خصوصاً للحؤول دون الأكزيما الموضعية لأن حليب الأم يؤخر ظهور الأكزيما ويحدّ من وخامتها.

الحساسية معدية في بعض الأحيان
خطأ. فالحساسية غير معدية على الإطلاق. إنها تظهر فقط عند الأشخاص الذين يملكون استعداداً للحساسية، علماً أن العوامل الوراثية تؤدي دوراً كبيراً في أغلب الأحيان.

قد تكشف الحساسية عن تأثيرات نفسية
صح. فالطفل المصاب بالحساسية يكون غالباً مريضاً وينصح بعدم ممارسة التمارين الرياضية مع رفاقه، بحيث يشعر أنه منعزل عن بيئته. لذا، لا بد من الانتباه جيداً إلى نفسية الطفل ومتابعته عن كثب لتحسين وضعه السريري والنفسي في الوقت نفسه.


حمى الله لكم أطفالكم من كل سوء ,,,

sabah
12 - 06 - 2012, 23:08
http://a3.sphotos.ak.fbcdn.net/hphotos-ak-ash4/301736_385498551496375_287696717943226_1037127_190 5658592_n.jpg



آآآآآآآمين يا رب العالمين

nosa_aic
15 - 06 - 2012, 06:52
الابتسامة سر إقناع الأطفال بتناول الخضراوات

كشفت دراسة علمية حديثة النقاب عن أن ابتسامة الأباء والأمهات بعد تجربة تناول الخضراوات التي يرفضها العديد من الأطفال تعد بمثابة عملية إيحائية لإقناعهم بتناولها لأنها مفيدة ولذيذة أيضا. ووجد الباحثون أن الأطفال يكونوا أكثر إقبالًا على تناول الأطعمة التي عادة لا يفضلونها إذا شاهدوا ذويهم البالغين يبتسمون ويتمتعون بتناولها أمام أعينهم، فكان الأطفال في سن الخامسة أكثر استعدادًا لتذوق الخضراوات التي يكرهون طعمها إذا رأوا أمهاتهم يبتسمون عند تناولها.
وأشارت النتائج التي نشرت في الدورية البريطانية لعلم النفس التنموي إلى أن أدمغة الأطفال غير ناضجة بالقدر الكافي للتعرف على مشاعر الآخرين، ببساطة فإن رؤية البسمة على وجه شخص بالغ قد ينقل نفس المشاعر لهؤلاء الصغار في مكان بالمخ يعرف بقشرة الفص الجبهي.
وقال الباحثون إن هذه النتائج قد يكون لها انعكاسات مهمة على تشجيع العادات الصحية للأطفال في تناول الطعام، لافتين إلى أن البالغين قد يأثرون على الأطفال لدون وعي أذواقهم الغذائية من خلال تعابير الوجه سواء من متعة أو اشمئزاز.

nosa_aic
15 - 06 - 2012, 06:54
علاج طبيعي لنوبات السعال المتكرر


أظهرت أحدث الأبحاث الطبية أن استحلاب السكر النبات والمينتول يعتبران خير علاج طبيعي دون أي آثار جانبية لنوبات السعال المتكررة.
تنجم نوبات السعال عند مهاجمة كائنات دقيقة الجهاز التنفسي وتثير الحساسية لدى الإنسان ليلجأ الجسم إلى السعال المتكرر كخط دفاعي للتخلص من هذا الدخيل الضار.
وقد تسهم نوبات السعال المتكررة متوسطة الحدة في زيادة مخاطر الإصابة بالالتهاب الرئوي، حيث تدفع بنحو 30 مليون أمريكي لزيارة المستشفى سنويًا.

ابو مالك
15 - 06 - 2012, 12:00
بارك الله فيكي

nosa_aic
17 - 06 - 2012, 07:44
بارك الله فيكي

http://www.albdoo.info/imgcache2008/6a96573c8ec5033134115cff129ab92c.gif

nosa_aic
17 - 06 - 2012, 07:45
دواء للسرطان من قشر اليوسفى


http://productnews.link.net/general/Women/20-01-2011/Tangerine_150.jpg (http://www.dlu3at.net/vb/article65153.html)



كشفت دراسة اجراها فريق من كلية الصيادلة جامعة ليزيستر بريطانيا ان مادة
مستخرجة من قشر اليوسفي تسمي‏'‏ سالفسترو‏'‏ يمكنها القضاء علي خلايا السرطان‏،‏
خاصة سرطان الكبد وأمراضه‏،‏ حيث تتحول هذه مادة إلي مركب سام في خلايا
السرطان‏،‏ وتقوم بالقضاء عليها‏،‏ كما توجد هذه المادة بتركيزات كبيرة في البرتقال‏.‏

وقال كبير الباحثين في الفريق الدكتور هون تان‏'‏ إن عمل الفريق لا يزال في
مراحله الأولي‏،‏ لكنه كون شركة مع زملائه لإجراء مزيد من الأبحاث حول إمكانية
تطوير علاج طبيعي للسرطان‏'م تلك المادة‏.‏

وعبر عن دهشته من أن يجد العلماء مركبا في طعام طبيعي يمكنه استهداف
السرطان بشكل محدد‏،‏ ويعتبر مركب سالفسترول نوعا من مركبات فايتوالكسين
التي تحتوي علي مواد كيماوية تفرزها النباتات لصد أعدائها من الحشرات والفطريات‏،‏ ويتحول المركب إلي مركب سام بواسطة أنزيم موجود بتركيزات كبيرة في خلايا السرطان‏.‏

ونتيجة لذلك‏،‏ وجد الباحثون أنه يكون أكثر سمية للخلاي السرطانية بعشرين
ضعفا من نظيرتها السليمة‏.

ويقول الدكتور هون تان إن مادة سالفسترول توجد في فواكه أخري مثل عائلة
القرنبيط‏.‏

وعن فوائد اليوسفي الأخري‏،‏ أوضح أنه غني بمركبات فيتامين اي المسماة
بالكاروتينويدات‏،‏ وهي التي تعطي اليوسفي لونه البرتقالي‏،‏ وهي تلعب دورا في
خفض خطر الإصابة بسرطان الكبد وأمراضه وتصلب الشرايين‏.‏

nosa_aic
17 - 06 - 2012, 07:53
عصير الرمان و الكرش




http://1.bp.blogspot.com/_nJLOuss1ip0/SWFz96waOMI/AAAAAAAAAxI/U0njb5VZipM/s400/pomagranate.jpg (http://www.dlu3at.net/vb/article65181.html)


إن لم تكن كل الفوائد المذكورة عن عصير الرمان كافية لتشجيعك على شرب قدر من عصير الرمان يوميا فإن سببا محفزا آخر يتمثل في قدرته على إيقاف تنامي الطبقة الشحمية في البطن المترافق مع بلوغ المرء متوسط العمر ويؤمن العلماء أن تلك الفاكهة الفائقة الأهمية والذي أطلقوا عليها اسم "سوبر فروت" ( السوبر فاكهة) تمتلك القدرة على تقليص الشحم المخزن حول المعدة ، والذي يعتبره البعض العجلة الإضافية للرجل وقمة الكعكة لدى المرأة.




فبعد شهر واحد، من تناول عدد من المتطوعين زجاجة من عصير الرمان يوميا لكل منهم أثبتوا أنهم أقل احتمالا لأن ينمو خلايا شحمية حول بطونهم.



كما تمتعوا بضغط دم منخفض وبذلك قللوا من احتمال الإصابة بالجلطات القلبية والدماغية وأمراض الكلية. ويؤمن فريق من الباحثين يعملون في جامعة ادنبرة أن عصير الرمان قد يساعد على تخفيض الحمض الشحمي في الدم والمعروف باسم "نيفا".




وكانت دراسات سابقة أجريت على البشر والحيوانات بينت أن مستويات الحمض الشحمي "نيفا" العالية لها صلة بخزن أكبر للشحوم حول البطن إضافة إلى زيادة مخاطر الإصابة بأمراض قلبية ومرض السكري نوع 2. وفي التجربة التي أجراها العلماء الاسكتلنديون في جامعة أدنبرة أعطي 24 رجلا وامرأة كل يوم زجاجة عصير رمان تسع لـ 500 ملليمتر منه ولمدة أربعة أسابيع.




ووجد الباحثون أن ما يقرب من نصف كل المتطوعين قد انخفضت لديهم نسبة الحمض الشحمي "نيفا" بنسبة كبيرة عند انتهاء التجربة. ويرى هؤلاء الباحثون أن ذلك سيجعلهم أقل استعداد لخزن الشحم حول معدتهم. إضافة إلى ذلك، فإن أكثر من 90% من الرجال والنساء المشاركين في التجربة انخفض ضغط الدم لديهم في نهاية الشهر.




وقال الدكتور عماد الدجيلي والدكتورة كاثرين تسانغ اللذان قادا فريق الباحثين في جامعة ادنبرة لمراسل صحيفة الديلي ميل اللندنية إنه ليس هناك أي شك من أن عصير الرمان مفيد في تخفيض مخاطر الإصابة بأمراض الأوعية القلبية لأن النتائج خلال التجربة أظهرت انخفاضا ملحوظا ومهما في ضغط الدم لدى المتطوعين.




وأضاف الدجيلي: "كان هناك دليل على أن استهلاك عصير الرمان قد يساعد في التأثير على شحم البطن. ونحن واثقون من أن هذه الكشوف الأولية تستحق دراسة أكثر تفصيلية. فالأشخاص الذين شاركوا في التجربة يتمتعون بصحة جيدة وهذا ما يجعل رصد التأثير صعبا". لذلك يرى الدجيلي أنه من الضروري أن يتركز البحث مستقبلا على أشخاص يعانون من السمنة وهذا ما سيساعد على ملاحظة التغييرات.

http://1.bp.blogspot.com/_Qz3qx6oPy4s/SxLOi_Dth-I/AAAAAAAAAG0/N1rpOu4ZtwU/s1600/%D8%B7%C2%A7%D8%B8%E2%80%9E%D8%B7%C2%B1%D8%B8%E2%8 0%A6%D8%B7%C2%A7%D8%B8%E2%80%A0.jpg (http://www.dlu3at.net/vb/article65181.html)

nosa_aic
17 - 06 - 2012, 08:07
موسوعة التغدية عند المرأة الحامل

http://69.59.144.138/icon.aspx?m=blank (http://www.dlu3at.net/vb/article64567.html)
شرب الحليب بكثرة عند الحامل يمنح مولودا أكبر

http://www.dohaup.com/up/2009-07-08/dohaup_481834627.gif (http://www.dlu3at.net/vb/article64567.html)


كشفت دراسة كندية نشرت أمس الاربعاء ان الامهات ‏اللواتي
لا يشربن كميات كافية من الحليب اثناء فترة الحمل يلدن
اطفالا اصغر ‏‏ويعرضن اطفالهن للضرر.‏
ويعتقد الباحثون ان نقص فيتامين (د) الموجود في الحليب
هو ما يسبب قصور النمو لدى الاطفال




ويعتقد الباحثون ان نقص فيتامين (د)
الموجود في الحليب هو ما يسبب قصور النمو لدى الاطفال،
ووجدت الدراسة التي قام بها باحثون في جامعتى ماجيل وكالغاري،
ان النساء اللاتي ‏شربن اقل من 250 ملليمترا من الحليب يوميا
(ما يعادل كوب واحد من الحليب فقط) ‏
ولدن اطفال اصغر من النساء اللاتي
شربن كميات اكبر من الحليب.‏


واستندت الدراسة التي نشرت في صحيفة جمعية الاطباء الكندية
الى معلومات ‏عن حوالي 300 امرأة حامل
ما بين سن 19 و 45 عام. وجاء في الدراسة
ان الاطفال الاصغر حجما هم الاكثر عرضة
لارتفاع ضغط الدم ‏والسمنة والسكري مع مرور الوقت.‏
يذكر ان الحكومة الفدرالية الكندية تلزم منتجي الحليب
باضافة فيتامين (د) الى ‏حليب الابقار قبل بيعه في الاسواق.


الشكولاته.. للمرأة الحامل أيضا

http://www.dohaup.com/up/2009-07-08/dohaup_481834627.gif (http://www.dlu3at.net/vb/article64567.html)


أفادت دراسة فنلندية أن تناول الشكولاته من قبل المرأة
خلال فترة الحمل هو أمر مفيد للجنين خاصة
إذا كانت المرأة تشعر بالقلق.
تم إجراء التجربة على 305 امرأة حامل
و تم فحص الأطفال بعد ستة اشهر من الولادة ليتعرفوا
على مدى تأثير الشكولاته على هؤلاء المواليد.


تبين أن الأطفال الذين ولدوا لأمهات كن يأكلن الشكولاته
يوميا أثناء فترة الحمل يتمتعون بحيوية اكثر
و يبتسمون بشكل اكبر من الأطفال الذين لم تكن أمهاتهن يتناولن الشكولاته.
كذلك تبين أن أطفال النساء اللواتي كن يعانين من القلق
وكن يتناولن الشكولاته يتمتعون بقدرة اكبر
على التعامل مع المواقف الجديدة من أطفال النساء
اللواتي كن يعانين من القلق و لم تكن يتناولن الشكولاته.


يعتقد الأطباء انه عندما تقوم المرأة الحامل بتناول الشكولاته
فأن المواد الكيميائية المحسنة للمزاج تنتقل من الأم إلى الجنين.
ومن جانب آخر، أكد خبراء التغذية أن الشكولاته
تحتوي على مواد مفيدة مضادة للأكسدة
ولا تسبب تسوس الأسنان أو البثور أو حب الشباب
كما لا تعتبر مصدرا رئيسا
لمادة الكافيين المنبهة ولا تؤدي إلى الإدمان.


وقال الباحثون في تقرير صدر في نشرة الصحة والنشاط
عن المميزات الإيجابية للشكولاته أنها تحتوي
على مركبات قوية مضادة للأكسدة
تعرف باسم (فلافونويد) تساعد في تقليل الآثار
المؤذية للكوليسترول السيئ (ال دي ال)
لذا فهي تفيد القلب وتحافظ على الأوعية الدموية.
مشيرين إلى أن الشكولاته السوداء أفضل من البيضاء
أو المحتوية على الحليب لأنها تحتوي
على كميات أكبر من تلك المركبات.


وأشار هؤلاء، إلى أن الشكولاته تحتوي على كميات ضئيلة جدا
من الكافيين لذا فهي غير ضارة كما أنها لا تسبب تسوس الأسنان
أو بثور الشباب ولا تعرض من يكثر منها للإدمان.
وأظهرت دراسة أخرى في نفس الإطار أن حبوب الكاكاو
فعالة في تخفيض ضغط الدم العالي فتحافظ
على سلامة القلب وتجعله قويا معافيا.


ولتوضيح العلاقة بين استهلاك مركبات الفلافونويد
الموجودة في الشكولاته وانخفاض معدلات الوفاة
من أمراض القلب وجد الباحثون في قسم الكيمياء
الحيوية بمدينة دوزلدورف الألمانية وزملاؤهم
في كلية هارفارد الطبية أن الكاكاو كان فعالا
في تقليل ضغط الدم عند هنود كونا
الذين يعيشون في الجزر الساحلية لبنما.


وبالرغم من أن غذاء هذا الشعب غني بالملح
إلا أن مستويات ضغط الدم لديهم طبيعية
بسبب استهلاكهم كميات كبيرة من الكاكاو
الغني بمركبات الفلافونويد المنتشرة زراعته في مناطقهم.
وأشار الخبراء إلى أن عمليات معالجة الكاكاو
تفقده الكثير من خصائصه العلاجية وفوائده الصحية
بسبب فقدان بعض مركباته الوقائية المضادة للأكسدة.


أهمية الكالسيوم في حياة المرأة

http://www.dohaup.com/up/2009-07-08/dohaup_481834627.gif (http://www.dlu3at.net/vb/article64567.html)

بدت النساء أخيراً في إدراك أهمية الكالسيوم في
حياتهن وتأثيره على عظامهن .. فالمعروف
أن الجسم يحتاج إلى قدر معين من الفيتامينات والمعادن،
وأهمها الكالسيوم للرجال والنساء على حد سواء،
ولكن المرأة تحتاج إلى الكالسيوم بصفة أكثر من الرجل
لأنها تفقد جزءاً كبيراً منه في فترة الحمل،
وترجع أهمية الكالسيوم بالإضافة إلى أنه يحافظ على العظام قوية
وفي حالة صحية جيدة إلى أنه يلعب دوراً مهماً جداً
في المحافظة على أداء وظائف الجسم الحيوية
في حالة جيدة مثل الجهاز العصبي والعضلي وأنشطة القلب..
ولا تقتصر الحاجة إلى الكالسيوم في فترة محددة من العمر،
ولكن الجسم يحتاجه في كل مراحل الحياة لضمان نموه السليم


ولضمان حصول الجسم على حاجته من الكالسيوم
ينصح المتخصصون بضرورة شرب كوبين
من اللبن يومياً والإكثار من تناول منتجات الألبان
والأغذية الغنية به مثل الأسماك والفواكه المجففة،
هذا بالإضافة إلى ضرورة ممارسة
التمرينات الرياضية المنتظمة خاصة المشي
أو الجري أو الأيروبيك لأنها تساعد على بناء عظام قوية..
كذلك يجب التأكد من معدل الجسم على حاجته
من فيتامين (د) لأنه يساعد الجسم على امتصاص الكالسيوم،
والمعروف أن مصدره الرئيسي هو أشعة الشمس
التي يجب أن يتعرض لها البالغون
فترة تتراوح ما بين 15 و 20 دقيقة يومياً خاصة
مناطق الوجه والذراعين

تحذير للحوامل والمرضعات من تناول التونا الخفيفة

http://www.dohaup.com/up/2009-07-08/dohaup_481834627.gif (http://www.dlu3at.net/vb/article64567.html)


أثارت تقارير طبية أمريكية موضوع تناول الحوامل
للأسماك ولمعلبات سمك التونا تحديداً،
ونصحت الأمهات الحوامل بعد تناولها مطلقاً.
وكانت التقارير قد أكدت أن 15% من التونا الخفيفة المعلبة
مما كانت تظن إدارة الغذاء والدواء أنها مخفوضة المحتوى
من الزئبق هي في الحقيقة عالية المحتوى منه،
وهو ما عادت الإدارة إلى التراجع عنه، وأشارت إلى أن 6% منها،
أي مما قالت أنه مخفوض المحتوى من الزئبق،
هي في الواقع عالية المحتوى منه.
ورغم هذا، أعلنت الإدارة أنها ليست بصدد
إعلان تحذير للناس من تناول معلبات التونا،
وقال مسؤولون فيها إن ما نفعله هو إعطاء
نصيحة توازن بين فوائد تناول الأسماك وبين مخاطر الزئبق فيها.
وكانت تنبيهات سابقة شددت أن على مجموعات محددة
من الناس ذوي الحساسية وشدة التأثر من الزئبق
انتقاء تناول التونا الخفيفة دون بقية أنواع المنتجات
البحرية عالية المحتوى من الزئبق،
وتحديداً، الحوامل والمرضعات والنساء،
في عمر وظروف تحتمل الحمل في أي وقت،
والأطفال أيضاً، مثل سمك القرش والماكريل وغيرهما.


يأختى الاناناس يسبب الاجهاض خاصه فى الاشهر الاولى
اضرار الاناناس وآثاره :

http://www.dohaup.com/up/2009-07-08/dohaup_481834627.gif (http://www.dlu3at.net/vb/article64567.html)


إن أكل الاناناس بكثرة يؤدي إلى
- اضطرابات في الجهاز الهضمي مثل ،
-اسهال معوي ، غثيان ، قيء
- طفوح جلدية
- بثور في اطراف الشفتين والفم
- انقباض في عضلات الرحم مما يسبب الاجهاض

تفاعل الاناناس مع الادوية :

http://www.dohaup.com/up/2009-07-08/dohaup_481834627.gif (http://www.dlu3at.net/vb/article64567.html)

يفضل عدم اكل الاناناس عند مرضى
ضغط الدم الذي يستعملون
- ادوية الضغط

nosa_aic
28 - 06 - 2012, 19:44
تناول العنب بين الوجبات يساعد على خفض مستوى السكر فى الدم





http://l.yimg.com/os/401/2012/06/26/grapes-JPG_091550.jpg (http://www.dlu3at.net/vb/article66114.html)






توصلت دراسة طبية حديثة أمريكية إلى أن تناول حفنة صغيرة من العنب ثلاث مرات بين الوجبات يوميا يعمل على خفض مستوى السكر فى الدم عقب الوجبات بصورة ملحوظة، وذلك بالمقارنة بالأشخاص الذين يتناولون عناصر غذائية أخرى بين الوجبات مماثلة فى السعرات الحرارية.


وذكر الباحثون فى معرض أبحاثهم التى أجريت فى هذا الصدد أن نحو 46 رجلا وسيدة ممن لم يتم تشخيص إصابتهم بمرض السكر، إلا أنهم يعانون من ارتفاع طفيف فى مستوى السكر بالدم.

وقد تم إعطاء بعض المتطوعين حفنات من العنب فى مقابل إعطاء تسالى من المكسرات للبعض الآخر، ليتم تتبعهم لنحو 12 أسبوعا.

وأشارت المتابعة إلى أن الأشخاص الذين انتظموا فى تناول حفنات العنب نجحوا فى المحافظة على استقرار مستوى السكر بالدم بالمقارنة بالأشخاص الذين تنالوا المكسرات.

مدحت فوزى على
29 - 06 - 2012, 10:10
http://i.imgur.com/hIHY7.gif (http://forum.iqr0.com/showthread.php?t=140031)

جمعة مباركة

على الجميع

إن شاء الله

hanan desoky
01 - 07 - 2012, 13:42
السلام عليكم ورحمة الله وبركاته

http://up.esgmarkets.com/uploads/images/esgm-5576e1a63f.jpg (http://up.esgmarkets.com/)

nosa_aic
06 - 07 - 2012, 11:37
http://i.imgur.com/hIHY7.gif (http://forum.iqr0.com/showthread.php?t=140031)

جمعة مباركة

على الجميع

إن شاء الله





السلام عليكم ورحمة الله وبركاته

http://up.esgmarkets.com/uploads/images/esgm-5576e1a63f.jpg (http://up.esgmarkets.com/)


و عليكم السلام و رحمة الله و بركاته

http://www.lamst-a.net/upfiles/oNa79904.gif

nosa_aic
06 - 07 - 2012, 11:41
العصائر الطازجة.. تقيك وعائلتك أمراض الصيف

http://www.balagh.com/images/texes/asaer-tazejaa3.jpg (http://www.dlu3at.net/vb/article66840.html)


نظراً لغناها بالفيتامينات والألياف :

مع دخول فصل الصيف تنتشر الكثير من الأمراض المرتبطة بتكاثر البكتيريا بسبب ارتفاع درجة الحرارة والرطوبة.. هذا الفصل من السنة من الفترات المعروفة بكثرة أمراضها، مثل الإسهال والتسمم الغذائي والإجهاد، وضربات الشمس وغيرها.
وتعد الفواكه الطازجة من أفضل سبل الحماية من أمراض الصيف نظراً لسهولة هضمها وسرعة امتصاص الأمعاء للمواد السكرية والأحماض والأملاح والكالسيوم فيها.. والعصائر التي نتحدث عنها هي تلك الطازجة المستخلصة من الفاكهة بلا أي إضافات أو مواد حافظة، أما العصائر المصنعة والمشروبات الغازية فهي أكثر ضرراً على الصحة من أي شيء آخر.
ولكي نساعد أجسامنا على مقاومة أمراض الصيف علينا تناول العصائر طازجة لأنّها ذات مردود غذائي وصحي، ومنها:
- عصير التفاح: تعد فاكهة التفاح من أهم الفواكه التي يمكن أن يتناولها الإنسان صباحاً، وذلك لما فيها من فوائد للجسم ولكن تناول عصير التفاح الطازج يعد الأفضل، حيث إنّه لا يحتاج إلى عملية هضم طويلة شأنه شأن جميع أنواع العصائر، إضافة إلى أنّه يتفاعل بشكل سريع مع الجسم، كونه سائلاً. ويحتوي عصير التفاح على أحماض أمينية تمنع الإمساك وتعمل على تنشيط الأمعاء وتخليصها من الفضلات والحيلولة دون تصلُّب الشرايين إضافة إلى تنشيط عمل الكبد.
- عصير الفراولة: هي من الفواكه الغنية بفيتامين (C) وهي سهلة الهضم وغنية بالكاروتين والصوديوم والبوتاسيوم والكالسيوم وتناولها عصيراً يخلص البشرة من شحوبها ويعيد إليها نضارتها.
- عصير التوت: يطلق على التوت "الفاكهة الناعمة" شأنه في ذلك شأن الفراولة التي يمكن تناولها مباشرة بعد غسلها، ومن أهم ما يحتويه عصير التوت فيتامينا (A) و(C) ولهذا يساعد على شفاء المصابين بنزلات البرد ويعمل على تخفيف آلام المفاصل.
- عصير الليمون: من أهم العصائر التي يمكن أن تتناوليها في فصل الصيف وذلك لأهميته في مكافحة الإنفلونزا، نظراً لغناه بفيتامين (C) ولكونه مُرطباً ومكافحاً لنزلات البرد وأي سموم قد تدخل الجسم مع الأطعمة.. ويؤخذ عصير الليمون ليخلص الجسم من الإرهاق الناجم عن حرارة الصيف أو التعرق الشديد، كما أنّه يساعد الجسم على التخلص من الضغوط النفسية وآلام المفاصل.
- الطماطم (البندورة): يمكن أن نعد الطماطم فاكهة، لأنّه بإمكاننا أن نأكلها من دون طبخ ويمكن أن نعتبرها نوعاً من أنواع الخضراوات لأننا نأكلها وهي مطبوخة؛ ولهذا فهي فاكهة وخضراوات في آنٍ واحد، والطماطم تعد من أغنى أنواع الفاكهة بعد الليمون بفيتامين (C) أما عصيرها فهو من أكثر أنواع العصائر فائدة للجسم، فهو ينقي الدم ويخلصه من السموم الناجمة عن عوادم السيارات والبيئة ويطهر الجهاز الهضمي، ويقاوم حالات التسمم الناجمة عن أي تلوث غذائي، فالمعروف أنّه في الصيف تزداد حالات التلوث الغذائي بسبب ارتفاع درجة الحرارة التي بدورها تخلق جواً مناسباً لتكاثر البكتيريا في الأطعمة.. عصير الطماطم يقاوم نزلات البرد والتوتر والروماتيزم، ويليِّن المعدة.. ويصبح هذا العصير غذاءً كاملاً إذا أضيفت إليه من بين (8-10) قطرات من الليمون ونصف ملعقة من زيت الزيتون.
- البطيخ: يعد من أهم الفواكه في فصل الصيف وهو لا يحتاج لأن يؤخذ على شكل عصير وذلك لأن ما بين 90-80% من مكوناته ماء، كما توجد فيه ألياف تساعد على الهضم إضافة إلى كميات من الكالسيوم والسكر والحديد والأملاح المعدنية، والبطيخ لأن معظمه ماء فهو مُدر للبول ومُليِّن جيِّد للجهاز الهضمي.
- عصير الجوافة: وهو من العصائر الجيِّدة للجسم وذلك لاحتوائه على كميات كبيرة من فيتامين (C) وسكر، وكالسيوم وفوسفور وحديد ولأن بذور الجوافة صلبة فإن تناولها عصيراً يعد أفضل من تناولها كفاكهة.. وعصير الجوافة يساعد القناة الهضمية على العمل بشكل جيِّد ويخلِّص الأمعاء والمعدة من سوء الهضم.
وإجمالاً فإن جميع العصائر الطازجة مفيدة، بل وضرورية، في فصل الصيف خاصة عصير العنب الأحمر والأناناس والمشمش والنعناع الطازج المنعش في الصيف، وذلك بإضافته إلى عصير الليمون المثلج.. وفي كل الأحوال فإنّه يتعين شُرب العصائر الطازجة مباشرة بعد عصرها، لأن تركها لفترة يجعلها تتخمر ويفقدها الكثير من فوائدها.

nosa_aic
06 - 07 - 2012, 11:46
الصيام يساعد على تنشيط خلايا الدماغ


يشاع أن القدرة على التركيز تقل في رمضان ويميل الإنسان للكسل ويتم ربط ذلك بالصيام. وقد وصل هذا الاعتقاد إلى درجة تجعل الكثيرين من الطلبة بتغيبون عن الدراسة وتقل نسبة إنتاج الفرد في المصانع والشركات . .

لكن كشفت الأبحاث أنه لا علاقة لذلك بالصيام إنما بالنظام الغذائي غير الصحي المتبع والذي يصيب الإنسان بحالة خمول. في حين اكتشف جراح ألماني أن الصوم من وقت لآخر ينشط خلايا المخ. وأن التغذية الصحية مع الصوم تمنع حدوث اضطرابات في وظائف المخ، كما تقلل من خطورة التعرض للسكتة الدماغية.
حيث إن حرق الدهون الفائضة أثناء فترة الصوم يجدد نشاط الخلايا ويزيد من كفاءة توصيل الإشارات في المخ. وهذا يقودنا إلى حقيقة أن الله سبحانه وتعالى ما كان ليفرض عبادة تضر بالإنسان. ويذكرنا بقوله سبحانه في سورة البقرة: "وأنْ تصوموا خَيْرٌ لَكُمْ إِنْ كُنْتُمْ تَعلَمُون".

dr moustafa
06 - 07 - 2012, 11:54
مبروك على الباب , والله أول مرة أشوفة , وياريت إذا
قرأتى عن أدوية جديدة لعلاج الجيوب الأنفية أبقى
حطيها , لأحسن تعبانى خالص , وشكرا لك .

nosa_aic
06 - 07 - 2012, 11:55
هناك العديد من الفيتامينات والمعادن التى تساعد جسم الإنسان على تقوية جهاز المناعة ومن أهمها:

- الكالسيوم وفيتامين (د):

يساعد الكالسيوم وفيتامين" د" الجهاز المناعى بدرجة كبيرة فأنهما يعملان على تنشيط الخلايا القاتلة والخلايا الأكولة، ولكن يجب أن يعزز الكالسيوم بفيتامين د، حتى يكون قادرا على أداء مهمته. وقد أثبتت الأبحاث العلمية أن تناول جرعة كافية من فيتامين د، والكالسيوم تقلل من خطر الإصابة بسرطان القولون.

ويمكن الحصول على الكالسيوم من الزبادى منزوع الدسم، ويعتبر المصدر الأمثل للكالسيوم الغذائى، كما يتواجد أيضا فى بذور السمسم والخضراوات ذات الأوراق الداكنة، وفى الأسماك مثل السردين والمكاريل وفى هذه الحالة يجب تناوله بالعظام ويمكن أيضا توليد فيتامين "د" داخل الجسم عن طريق التعرض لحمامات الشمس لمدة تتراوح بين 20-30 دقيقة، يوميا ونتيجة لضعف طبقة الأوزون وخطر الإصابة بسرطان الجلد ينصح العلماء بالتعرض لأشعة الشمس قبل العاشرة صباحا أو بعد الساعة الثالثة مساء فى فصل الصيف، وهناك بعض العوامل التى تتداخل مع كفاءة الكالسيوم وهى تضم الأطعمة العالية الملوحة والدهون، كما أن نسبة الكورتيزون تؤثر تأثيرا سلبيا على فاعلية الكالسيوم، وإذا كان لا مفر من تناول مكملات الكالسيوم فيجب على الشخص أن يتناولها على هيئة جرعات مقسمة لا تكون أكثر من 600 مجم فى المرة الواحدة، وذلك يكون بين الوجبات ويفضل تناولها مع عصير البرتقال أو اللبن حتى يساعد على امتصاصه، كما ينصح العلماء بتناول آخر جرعة من الكالسيوم قبل النوم مباشرة، لأن نسبة كبيرة من الكالسيوم تمتص من العظام فى فترة النوم.

- الماغنسيوم:

ويعد الماغنسيوم أحد العوامل الأساسية للحفاظ على صحة الجهاز المناعى لأنه هام جدا فى فعالية الأجسام المضادة وتنشيط تكوين الخلايا، كما أنه يعمل سريعا على تخفيف التوتر وتحسين النوم ويِمكن للشخص زيادة مقدار ما يحصل عليه من الماغنسيوم بتناول الموز والحبوب والخضروات ذات الأوراق الخضراء ودقيق القمح والمكسرات.

- السلينيوم:

أن السلينيوم من الأملاح المعدنية النادرة، التى توجد فى التربة ويعمل السلينيوم كمادة مضادة للتأكسد للوقاية من سرطان الجلد وأمراض الشرايين التاجية. ويمكن للشخص أن يحصل على كمية مناسبة من السلينيوم بتناول حصص غذائية كثيرة من الحبوب الكاملة يوميا مع الكرنب والجزر والكرفس والخيار والثوم والعدس والبصل، وفول الصويا، والسبانخ وبذور القمح. ويجب أن نشير إلى أن السلينيوم يحقق أفضل النتائج عند تعاطيه مع فيتامين ( هـ ).

- الزنك:

يعتبرتناول الزنك بكميات مناسبة أحد العناصر الأساسية لضمان أعلى مستوى لكفاءة الخلايا التائية، وتكوين الأجسام المضادة داخل الجسم. غير أن تناول الزنك لا يحسن من وظائف الجهاز المناعى إلا إذا كان الشخص يعانى نقصا فى نسبة الزنك داخل الجسم ويعتبر التأخر فى ألتئام الجروح أحد المؤشرات للإصابة بنقص فى مستوى الزنك وكذلك انخفاض القدرة على التذوق والعدوى المتكررة، كما يرجح أن كل الأشخاص متوسطى العمر وكذلك كبار السن مصابون بنقص فى مستوى الزنك ولذلك ينصح بتناوله كمكملات فى هذه المراحل العمرية أو بالإكثار من تناول الأطعمة التى تحتوى على الزنك.

nosa_aic
06 - 07 - 2012, 12:07
مبروك على الباب , والله أول مرة أشوفة , وياريت إذا
قرأتى عن أدوية جديدة لعلاج الجيوب الأنفية أبقى
حطيها , لأحسن تعبانى خالص , وشكرا لك .



الاخ الفاضل الدكتور / مصطفى

مرحبا بحضرتك و ان شاء الله لو لقيت اى حاجة عن موضوع الجيوب الانفيه هكتبها

مع تمنياتى بالشفاء العاجل ان شاء الله

http://www.ashefaa.com/picup/uploads/b14d49986a.gif (http://www.dlu3at.net/vb/article46861.html) (http://www.dlu3at.net/vb/article46861.html)

nosa_aic
06 - 07 - 2012, 12:14
لماذا نشعر بدوران عندما نقف فجأة


أحياناً عندما نقف فجأة نشعر بدوار بسيط
ونرى نجوماً براقة تتطاير حولنا، فما الذي يسبب هذا الشعور
وفقاً لعيادة مايو الطبية، عندما تنتقل من وضعية الجلوس إلى وضعية الوقوف
يقوم النظام العصبي بشكل مؤقت بتضييق الأوعية الدموية، وزيادة معدل نبضات القلب.
ويفترض أن يسبب ذلك منع الهبوط المفاجئ في ضغط الدم.

ولكن أحياناً ينخفض ضغط الدم على أية حال. لعدة أسباب محتملة تتضمن:

1. الاستعمال المفرط لأدوية ضغط الدم، أو استعمال أدوية تسبب ذات التأثير.
2. الإصابة بحالة من اضطرابات دقات القلب، أو تسارع الدقات القلب "رفة القلب"
3. الجفاف الحاد
4. إطالة الاستراحة على السرير
وقد تتضمن المعالجة استعمال أدوية لرفع ضغط الدم، وتجنب الجفاف
وحتى ارتداء جوارب سمكية. وينصح الأطباء بأن يقوم الشخص بالوقوف تدريجياً خصوصاً
إذا كان في وضعية استلقاء
أو النظر إلى أعلى قبل الوقوف والعد لثلاثة، كما ينصح بشرب عدد معقول من أكواب الماء
خلال اليوم، والمشي لبضع دقائق في حالة الجلوس المطول في العمل

nosa_aic
06 - 07 - 2012, 12:17
ما هى الأطعمة التى تقوى الأسنان

http://l.yimg.com/os/401/2012/06/30/apple-JPG_091740.jpg (http://www.dlu3at.net/vb/article66417.html)


مفهوم العناية بالأسنان هو مفهوم مختلف بين الجميع فقد يعتقد أغلبنا أن فرش الأسنان يوميا والمتابعة من حين لآخر عند طبيب الأسنان يكفى، ولكن هل نعلم أن هناك أطعمة تحتوى على الفلورايد الذى يساعد على تقوية الأسنان؟

يوضح لنا الدكتور وائل صفوت مستشار الطب العام وأخصائى أمراض الباطنية والجهاز الهضمى والكبد، أن الفلورايد يلعب دورا هاما فى الحفاظ على الأسنان والعظام، وكثيرا منا يعتقد بأنه يمكن الحصول على مادة الفلورايد من خلال معجون الأسنان فقط، ولكن لا يعلم أن هناك أطعمة يوجد بها الفلورايد.

ويبين دكتور وائل إلى أن كمية الفلورايد المتواجدة فى الجسم تصل إلى 30 غرام ويوجد الفلورايد فى العديد من المصادر الطبيعية والصناعية التى تزيد من حماية التسوس وحماية العظام.

ومن مصادر الفلورايد الطبيعية هى التفاح وكبد العجل والبيض وكلى الحيوانات، بالإضافة إلى تواجده فى الشاى والماء والأسماك، لذا ينصح غالبا أطباء الأسنان بتناول تلك الأطعمة التى تحسن من قوة العظام والأسنان خاصة فى طور البناء عند الأطفال.

وعلى الرغم من أن تلك الأطعمة تحسن من صحة الأسنان والعظام إلا أن دكتور وائل يؤكد أنه لا تغنى أبدا تلك الأطعمة عن العناية اليومية للأسنان والتى من شأنها تقى الأسنان من التسوس، ومن تكون اللطعة التى تسبب بعد فترة حساسية الأسنان وتسوسها لذا يجب المتابعة والعناية بالأسنان عن طريق فرشها بشكل يومى مع تناول الأطعمة التى تحسن من قوتها وتزيد من نسب الفلورايد فى الجسم.

nosa_aic
06 - 07 - 2012, 12:41
التهاب الجيوب الأنفية أسبابه و علاجه
وسائل صحية للحماية منه

كمبردج (ولاية ماساشوستس الأميركية): «الشرق الأوسط»*
* اكثر من 20 مليون اميركي سوف يعانون من نوبة واحدة على الاقل من نوبات التهاب الجيوب الانفية sinusitis هذا العام. وسوف يعاني اغلبهم من الشعور بعدم الارتياح، ويتغيبون عن العمل او الدراسة. الا ان اكثرهم سيشفون.. لكن القليل منهم ستظهر لديهم مضاعفات خطيرة.
ان فهم التهاب الجيوب الانفية سوف يمكنك من تقليل فرص ظهور الحالة لديك- وحتى ان تعرضت لهجمة التهاب الجيوب الانفية، فانك ستكون على علم بالكيفية التي تعجل فيها بالشفاء وتقلل من اخطار المضاعفات. الجيوب الأنفية sinuses هي حجيرات مملوءة بالهواء توجد داخل عظام وجهك. ولأنها تحيط بالأنف، فإنها تعرف أيضا باسم الجيوب المحاذية للأنف paranasal sinuses. ولدى كل منا أربعة أزواج من الجيوب (انظر الشكل).
ويبطن كل من هذه الجيوب، بغشاء يفرز المخاط. وعندما تكون سليم الجسم، فإن المخاط، السائل المائي الخفيف، يمر بحرية من الجيوب نحو الجزء الأعلى من الأنف. ولكن، وعندما تلتهب الجيوب الأنفية، يصبح المخاط ثخينا ولزجا، ولذلك لا يمكنه المرور من الفتحات الصغيرة جدا المسماة ostia، التي تقود نحو الأنف. وبهذا يتراكم السائل في الجيوب، مؤديا إلى زيادة الضغط وحدوث الألم- وبذلك تصبح مصابا بالتهاب الجيوب الأنفية.


* أسباب التهاب الجيوب الأنفية



* التهاب الجيوب الأنفية هو عدوى تسببها البكتريا. وتوجد في أنف كل منا ملايين البكتريا، كما توجد ولدى الكثيرين منا الجراثيم التي تسبب عدوى الجيوب الأنفية.
هذه البكتريا في الأنف ليست ضارة، كما أنها لا تتسبب في حدوث المشاكل عندما تتغلغل نحو الجيوب الأنفية، ما دامت تنحدر بعد تغلغلها نحو الأنف مجددا. ولكن، إن كانت ممرات تفريغ الجيوب الأنفية مسدودة، فإن البكتريا تتكاثر مسببة العدوى. ولذلك فإن انسداد قنوات التفريغ الرفيعة للجيوب الأنفية هو السبب الرئيسي في حدوث التهاب الجيوب الأنفية، وإعادة فتح ممرات التفريغ هو مفتاح العلاج.


* مثيرات التهاب الجيوب الأنفية



* البرد هو أحد الأمور التي تثير أو تحفز التهاب الجيوب الأنفية. والشخص البالغ يصاب في المتوسط بنزلتين إلى ثلاث نزلات من البرد سنويا، أما الطفل فيصاب بست إلى عشر نزلات. ونزلات البرد تنجم عن الإصابة بالفيروسات، وليس البكتريا، ولذلك فإن المضادات الحيوية غير مفيدة في علاجها. إلا أن الفيروسات تتسبب في تورم أنسجة الأنف، الأمر الذي يؤدي أحيانا إلى انسداد الجيوب الأنفية. كما أن البرد يغير أيضا شكل المخاط، إذ يمنعه من تأدية دوره العادي في اصطياد البكتريا. وقد تشعر بشيء من الضغط في الجيوب الأنفية عند إصابتك بالبرد، إلا أن ذلك لا يعني أنك أصبت بالتهابها، أو أنك بحاجة إلى مضادات حيوية. ولا تقود إلا واحدة من 100 نزلة برد إلى التهاب الجيوب الأنفية. وبمقدورك تحاشي وقوع الالتهاب، بعملية تفريغ الجيوب الأنفية (انظر لاحقا). كما يمكنك تحسين الأمر بالتمخط بشكل رقيق من الأنف، إذ إن التمخط القوي بمقدوره دفع البكتريا إلى الأعلى نحو الجيوب الأنفية. والكثير من الأمور الأخرى بمقدورها سدّ الجيوب الأنفية وأن تقود إلى حدوث العدوى فيها. وتضم القائمة، المواد المثيرة للحساسية، دخان السجائر والأدخنة الأخرى، التغير في الضغط الجوي عند الطيران أو الغوص في المياه، الزوائد الأنفية، وانزياح غشاء الأنف.


* الأعراض



* الضغط المؤلم هو العرض الرئيسي. ويعتمد الألم على موضع الجيوب الملتهبة، إذ يكون الألم في الجبهة عندما تلتهب الجيوب الأمامية، وفوق الوجنتين أو في الفك الأعلى والأسنان (الجيوب الفكية)، وخلف العينين (الجيوب المصفوية والوتدية) أو في أعلى الرأس (الجيوب الوتدية). ويزداد ألم الجيوب الأنفية عادة عند الانحناء إلى الأمام.
كما تشيع أعراض احتقان الأنف، وظهور إفرازات بألوان غامقة من الأنف. وعندما تنزل قطرات المخاط من خلف الأنف إلى البلعوم، فسوف تشعر بطعم كريه، وقد تظهر لديك رائحة كريهة في الفم أو سعال. كما قد تفقد مؤقتا حاسة الشم أو التذوق، وأخيرا فقد تشعر بالحمى، والأوجاع، والتعب.
* التشخيص
* في غالب الحالات، يمكن للطبيب تشخيص التهاب الجيوب الأنفية، بالسؤال عن أعراضها. وإن كان الضغط على الجيوب يسبب الألم، فإنك مصاب على الأكثر بالتهابها. ويؤدي التصوير الطبقي المقطعي دوره المساعد في التشخيص إن كان التهاب الجيوب الأنفية شديدا بشكل غير استثنائي، وإن بدأ الطبيب يشك بوجود مضاعفات له، اما أشعة إكس فهي أقل فائدة. كما يمكن لأطباء الأنف والأذن والحنجرة تشخيص التهاب الجيوب الأنفية بمنظار الأنف.


* العلاج: التفريغ



* الكثير من المصابين بالتهاب الجيوب الأنفية سيشفون بسرعة نهائيا، من دون تناول المضادات الحيوية، بل وببساطة باتباع طريقة التفريغ.


وفي ما يلي ما يجب عليهم عمله:


> اشرب كميات كبيرة من الماء، فالتروية المائية تساعد على إبقاء المخاط خفيفا وسائلا.
> تنشّق البخار. استحم فترة أطول في المرش (الدوش) الحار. اغل الماء في إبريق، ثم صبه في قدر، وانحنِ فوق القدر بعد تغطية رأسك بمنشفة. استنشق البخار. وحتى الشاي الحار أو شوربة الدجاج تكون مساعدة. والعناصر السرية هنا هي في البخار. حاول أن تتنشق البخار 3 إلى 4 مرات يوميا.
> نم ورأسك مرتفع. إن كان الألم لديك في جانب واحد فقط، نم بوضع جانب وجهك الخالي من الألم على الوسادة.
> استخدم مزيلات الاحتقان. فالحبوب الحاوية على مواد pseudoephedrine أو phenylephrine مساعدة جدا، إلا أنها تقود في أحيان كثيرة إلى رفع ضغط الدم، وتسريع نبضات القلب، أو تحدث التشويش وتصيبك بالأرق. إلا أن بخاخات (سبراي) الأنف الحاوية لـ phenylephrine أو oxymetazoline ليس لديها هذه الأعراض الجانبية. ولكن إن أكثرت استعمالها ولفترات طويلة فقد يؤدي ذلك إلى تخريش الأنف أو أن تصبح معتمدا دائما عليها.
> استشر الطبيب حول وصفات البخاخات الحاوية على الاسترويدات، خصوصا إن كنت تعاني من الحساسية أو إن كان التهاب الجيوب الأنفية لديك من النوع «العنيد».
> استعمل بخاخات الماء المالح لتسييل المخاط وغسل الجيوب الأنفية.
> تجنب مضادات الهستامين. إنها عظيمة للحساسية، وعند سيلان الأنف في نزلات البرد، إلا أنها تزيد من ثخن المخاط، الذي يصعب تفريغه، وهذا هو آخر الأمور التي ترغب فيها لدى الإصابة بالتهاب الجيوب.
> كمادات دافئة على وجهك قد تخفف من الألم. والأدوية المخففة للآلام التي تباع من دون وصفة طبية مثل الاسبرين، أو الأسستامينوفين تساعد في تخفيف الألم، والحمى.
* المضادات الحيوية
* قد تصاب بالدهشة إن علمت أن المضادات الحيوية لا توضع في قائمة أولى علاجات التهاب الجيوب الأنفية. ولكن وبفضل الإعلانات التلفزيونية والصحافية المتتالية فإن غالبية المصابين بالتهاب الجيوب الأنفية يتوقعون تسلمهم للمضادات الحيوية، فيما يقوم أغلب الأطباء بتزويدها لهم. وبالفعل فقد شكلت المضادات الحيوية خطوة عظمى إلى الأمام في علاج التهاب الجيوب الأنفية- إلا أنها لا تؤدي مهمتها إلا إذا تم التوصل إلى عملية تفريغ جيدة للجيوب. وإن تم التوصل إلى تفريغ جيد فليس هناك ضرورة للمضادات الحيوية.
ورعم جودتها فإن المضادات الحيوية لها نواقص محتملة. إذ إنها يمكن أن تثير ردات فعل الحساسية أو تقود إلى ظهور أعراض جانبية. كما أن الاستعمال المتزايد للمضادات الحيوية أدى إلى انتشار البكتريا المضادة للمضادات الحيوية (البكتريا المتفوقة). وأخيرا فإن الكثير من هذه الأدوية غالي الثمن.
ومع ذلك، إن حدث وأن التهاب الجيوب الأنفية لم يتحسن خلال يومين إلى أربعة أيام من العلاج بالتفريغ – أو أن الالتهاب كان شديدا منذ البداية- فإن الطبيب سيصف المضادات الحيوية. ولأن البكتريا المقاومة غالبا ما تعيش في الأنف والجيوب الأنفية فإن من المنطقي استعمال واحد من المضادات الحيوية الجديدة الموجهة ضد هذه البكتريا.
ولكن، منطقيا أم غير منطقي، فإن عددا من الدراسات أشار إلى أن المضادات الحيوية القديمة الأقل ثمنا، فعالة أيضا مثلها مثل الأدوية الجديدة التي تهاجم البكتريا المقاومة. والسبب في ذلك هو أن التفريغ هو أكثر أهمية من المضادات الحيوية في غالبية حالات التهاب الجيوب الأنفية غير المعقدة. ولنفس هذا السبب فقد أظهرت التجارب أن العلاج بالمضادات الحيوية لمدة 3 إلى 7 أيام هو عموما فعال بمثل فاعلية العلاج التقليدي لمدة 10 إلى 14 يوما لحالات التهاب الجيوب الأنفية غير المعقدة.
الكثير من البكتريا يمكنها أن تسبب التهاب الجيوب الأنفية الحاد. وأكثر الأسماء شيوعا هي أسماء مخيفة للبكتريا مثل جرثومة ذات الرئة الفصيّة Pneumococcus، المكورات العقدية Streptococcus و Hemophilus وMoraxella ، وما لم يكن لديك انثقاب في الجيوب الأنفية (بسبب فحص تدخلي نادر يجريه أطباء الأنف والأذن والحنجرة، أو أحياء مجهرية غير معروفة أو مضاعفات)، فإنه لا يمكن التعرف بأي طريقة، على نوع البكتريا المسببة لالتهاب الجيوب الأنفية. ومحتويات المخاط أو الأنف المزروعة مختبريا لا تساعد كثيرا هنا لأنها مليئة دوما بالبكتريا التي تعيش داخل الأنف.
ومع هذه التصورات الموجودة، فإن الكثير من الاختصاصيين في الأمراض المعدية يوصون بالعلاج ببعض الأدوية المتوفرة مثل trimethoprim-sulfamethoxazole (وهو دواء مدمج يضم عقار السلفا)، وamoxicillin (وهو نوع من البنسلين) أو doxycycline (وهو نوع من التيتراسايكلين). وإن أخفقت هذه الأدوية في مهمتها- أو كان المرض شديدا في بدايته- فإن الأطباء يتحولون لوصف amoxicillin-clavulanic acid أو أحد أدوية quinolone (مثل دواء levofloxacin)، أو أحد أدوية Macrolide (مثل دواء azithromycin)، أو أحد أدوية cephalosporin (مثل دواء cefuroxime).


* المضاعفات



* الجيوب الأنفية محاطة بهياكل مهمة جدا، منها المخ، العينان، والجمجمة. وفي حالات نادرة فإن التهاب الجيوب الأنفية بمقدوره الانتشار نحو واحدة من هذه المناطق.
أخبر الطبيب فور شعورك بتدهور حالة التهاب الجيوب الأنفية، لدى ظهور واحد من هذه الأعراض أو أكثر:
- حمى شديدة - صداع شديد - تشوش ذهني أو تيبس الرقبة - تورم الخد، الجبهة، أو سقف الحلق - تورم واحمرار وألم العين - تشوش البصر - صعوبة التنفس، البلع، أو الكلام.
ولحسن الحظ فإن مثل هذه المشاكل نادرة. ومع ذلك فإنها تذكرنا دائما بأن التهاب الجيوب الأنفية ليس نزلة عابرة من رشح الأنف. وعلى المرضى من الذين يعانون من ضعف المناعة الخضوع لعناية طبية أكبر عند علاج التهاب الجيوب الأنفية لديهم.
* التهاب الجيوب الأنفية المزمن
* التهاب الجيوب الأنفية الذي يدوم لفترة تزيد على ثلاثة أسابيع، أو الذي يتكرر ظهوره ثلاث مرات في السنة يسمى التهاب الجيوب الأنفية المزمن. والسبب الأكثر شيوعا لحدوث التهاب الجيوب الأنفية المزمن هو المعالجة غير الملائمة لالتهاب الجيوب الأنفية الحاد- وبما أن التشخيص والعلاج لحالات التهاب الجيوب الأنفية الحاد قد تحسنا كثيرا فقد أصبح التهاب الجيوب الأنفية المزمن أقل شيوعا مما كان عليه في الماضي.
غالبية المصابين بالتهاب الجيوب الأنفية المزمن يمكنهم الاستفادة من تقييم أطباء الأنف والأذن والحنجرة، ومنها الفحص بالمنظار، والتصوير الطبقي المقطعي. وذلك لأن المشاكل التشريحية مثل الزوائد الأنفية أو انزياح الحواجز في الأنف هي المسؤولة في الغالب عنها. وبما أن الحساسية تكون مسؤولة أيضا عن كثير من حالات المرض، فإن فحص الحساسية قد يكون مفيدا.
إن إفرازات الأنف المتواصلة واحتقانه، هي أهم أعراض التهاب الجيوب الأنفية المزمن. وما عدا ظهور نوبات مفاجئة من حالات التهاب الجيوب الأنفية، فإن الصداع أو الحمى لا يحدثان في الحالات المزمنة إلا قليلا.
وبالإضافة إلى البكتريا التي تسبب التهاب الجيوب الأنفية الحاد، فإن المكورات العنقودية Staphylococcus، والبكتريا اللاهوائية، والفطريات قد تسبب التهاب الجيوب الأنفية المزمن. والمضادات الحيوية قد تكون مفيدة خصوصا لعلاج النوبات، إلا أنها أقل أهمية مقارنة بعملية ريّ الأنف، ومزيلات الاحتقان، وبخاخات الأنف الموصوفة طبيا. وإن كان هناك حساسية، فإن مضادات الهستامين تكون مساعدة. وفي الحالات الشديدة يكون من الضروري استخدام الاسترويدات عن طريق الفم. وكما هو الحال مع حالات التهاب الجيوب الأنفية الحاد فإن العلاج الناجح هنا هو التفريغ. وفي حالات التهاب الجيوب الأنفية المزمن، قد تكون الجراحة ضرورية. وبمقدور طبيب الأنف والأذن والحنجرة أيضا إزالة الزوائد الأنفية، أو تقويم الغشاء، أو توظيف المنظار لفتح قناة للتفريغ بين الجيوب الأنفية وبين الأنف.
* رسالة هارفارد «مراقبة صحة الرجل» خدمات «تريبيون ميديا».


* الجيوب الأنفية.. وأنواعها



* توجد أربعة أزواج من جيوبك الأنفية المملوءة بالهواء في العظام المحيطة بأنفك.
الجيوب الأمامية sinuses frontal توجد خلف جبهة الرأس، أما الجيوب الفكية maxillary sinuses فإنها تقع خلف عظام الوجنتين، والجيوب المصفوية ethmoid sinuses تقع خلف جسر الأنف، والجيوب الوتدية sphenoid sinuses تقع عميقا داخل الجمجمة، خلف الأنف.
تعايش مع التهاب الجيوب الأنفية > من اللطيف أن نعرف أن المسح الطبقي المقطعي والفحص بالمنظار والجراحة أصبحت متوفرة سواء لتقييم التهاب الجيوب الأنفية الحاد أو المزمن، أو لعلاجهما. إلا أن من حسن الحظ أن التهاب الجيوب الأنفية الحاد يستجيب لعلاجات أبسط بكثير.
ولكي تحمي جيوبك الأنفية، حافظ على تروية الجسم بالماء. تجنب دخان التبغ والأدخنة المؤذية. وإن كانت لديك حساسية، تجنب الأمور التي تثيرها. تجنب الوقوع في نزلات البرد ، بتكرار غسل اليدين جيدا والابتعاد عن المصابين بالبرد.
وعندما تحدث لديك نزلة برد، تمخط بشكل مناسب لمنع البكتريا من التغلغل نحو الجيوب الأنفية. عالج أعراض التهاب الجيوب الأنفية بشكل سريع بتنشّق البخار، ومزيلات الاحتقان، وريّ الأنف.
وإن لم يتم شفاؤك كما كان مقدرا له- أو كان لديك التهاب شديد في الجيوب الأنفية أو أعراض خطيرة- راجع الطبيب للحصول على المضادات الحيوية، وربما على الاستريودات الأنفية.
إن الأطباء يعرفون جيدا لماذا نصاب بالتهاب الجيوب الأنفية، وما هو الدور الذي تقدمه لنا، إلا أنهم لا يعرفون ما هي الامور السيئة التي قد تحدث بسبب التهابها. والتهاب الجيوب الأنفية الحاد شائع وغير مريح. إلا أن معرفتك بكيفية العمل على إبقاء جيوبك الأنفية مفتوحة وإفراغها بحرية، فإن بإمكانك أن تحافظ عليها سليمة وبصحة جيدة.

nosa_aic
06 - 07 - 2012, 12:48
http://www.tbeeb.com/pic/uploads/c9d5d2ac3f.gif تعريفات ومقدمة سريعة
- الجيوب (sinuses) شكل من التجاويف المملوءة بالهواء(مساحات مليئة بالهواء) تحيط بالعينين والأنف، وتوجد داخل عظام الجمجمة، وهي ترتبط بتجاويف الأنف عبر فتحات صغيرة. - إلتهاب الجيوب الأنفية هو إلتهاب الغشاء المحيط بالجيوب. - هذه التجاويف معقمة ومبطنة بغشاء رقيق يفرز المخاط ،وتقوم خلايا شعرية بكسح المخاط لطرد الجسيمات الغريبة والكائنات الدقيقة مثل البكتيريا والفيروسات وكذلك ذرات الغبار. - في الأحوال الطبيعية يحدث تصريف المخاط من خلال فتحات صغيرة بين الجيوب الانفية والأنف. ويحدث إلتهاب الجيوب الأنفية عندما يقع إنسداد لهذا النظام الطبيعي في الصرف - يعتقد الأطباء أن الجيوب لها دور في تعديل نوعية الصوت. - يرافق غالبآ إلتهاب الجيوب العداوي التي تصيب السبيل التنفسي العلوي كالزكام أو حمى الكلأ، ويكون الوضع مؤلمآ ومزعجآ في كلا الحالتين. - يشفى إلتهاب الجيوب عادة بدون علاج لكن قد يعاود الظهور بأعراض أكثر حدة. - في الحالات الحادة قد تستمر نوبات إلتهاب الجيوب لأشهر عديدة. - نادرآ ما يعاني الصغار من هذه الحالة لأن الجيوب لا يكتمل نموها حتى عمر الأربع أو الخمس سنوات. العلامات والأعراض - الصداع(ألم في الرأس) - الحمى(إرتفاع في الحرارة) - إنسداد الأنف وتفريغ أنفي ملطخ( أنف مسدود ومتقرح مع إفراز كثيف) - الإحساس بالألم فوق الجيب المصاب. - إحمرار حول العينين في بعض الأحيان. - الشعور بإمتلاء الرأس عند الإنحناء إلى الأمام. - ألم في العينين أو الخدين. - في بعض الأحيان يرافق الحالة ألم في الأسنان الموجودة أسفل الجيب الأنفي مباشرة. - رعشات القشعريرة. - وهن يبلغ من الشدة حدآ يجعل المريض يلازم الفراش. مواضع وأسماء الجيوب تسمى الجيوب المختلفة بإسم العظام الموجودة فيها، فالجيوب الفقمية تقع في عظام الخد أما جيوب الجبهة فتقع في الفسحة الموجودة فوق الحاجبين في حين تقع الجيوب الغربالية والوتدية داخل الجمجمة أنظر إلى الصور أدناه http://www.tbeeb.com/pic/uploads/5adbbd165e.gif http://www.tbeeb.com/pic/uploads/1a7acb731e.jpg
ماالذي يسبب إلتهاب الجيوب؟
- بشكل عام يحصل إلتهاب الجيوب الأنفية نتيجة العدوى بإحدى فيروسات الزكام الشائعة( نتيجة إلتهاب الأنف الناجم عن الزكام أو الإنفلونزا) وقد تنسد هذه الجيوب وتمتليء بالسوائل مسببة ألمآ في الوجه. وتحدث معظم الأعراض بعد ثلاثة إلى عشرة أيام من الإصابة بالزكام. - يمكن لحمى القشع والحساسيات الأخرى أن تسبب إلتهاب الجيوب الأنفية. تدابير بسيطة للمساعدة والعناية الذاتية - مسكنات الألم البسيطة. - ابق في الداخل في حرارة معتدلة. - إمتنع عن الإنحناء مع إمالة الرأس إلى الاسفل. - إستعمال كمادات دافئة على الوجه. - أخذ قسط من الراحة إذا كان المريض محمومآ وغير مرتاح. - تجنب الأجواء المليئة بالدخان. - تجنب التعرض الطويل للغبار والمواد المهيجة. - عدم التمخط بشدة أثناء الإصابة بالزكام لأن هذا يمكن أن يدفع العدوى بإتجاه الجيوب. - تناول الأقراص المزيلة للإحتقان التي تتوفر في الصيدليات. - إستعمل قطرة الماء والملح. - إشرب الكثير من السوائل (8 اكواب يوميآ ، وكل كوب يكون على الاقل سعة 200 مل) حتى تحافظ على سيولة المخاط وتدفقه. - تجنب ركوب الطائرة عندما تكون مصابآ باحتقان، فالتغير في الضغط الجوي قد يدفع المخاط إلى إلى داخل الجيوب الانفية
واذا اضطررت لركوب الطائرة فاستعمل مزيل الاحتقان قبل الاقلاع واستعمل بخاخ الانف المزيل للاحتقان قبل هبوط الطائة بحوالي 30 دقيقة.
- تجنب ممارسة رياضة الغوص الى ان تشفى من الاتهاب الجيوب الانفية تمامآ
- خذ دشآ دافئآ. - احتس طبقآ من الشوربة الساخنة. - إستنشاق البخار مستخدمآ فوطة لتصنع خيمة فوق مصدر البخار (أفضل علاج لترخية الإفرازات الموجودة في الجيوب ويساعد على تصريفها بشكل أسهل) حيث يتم إستنشاق البخار من وعاء فيه ماء مغلي لمدة بضع دقائق كل مرة. أنظر إلى الصورة أدناه http://www.tbeeb.com/pic/uploads/f727e9b8fa.gif
متى يجب زيارة الطبيب؟
- إذا إستمرت أو لم تتحسن الأعراض خلال 3 إلى 7 أيام . - إذا تكررت الأعراض بشكل مفاجيء(ثلاث مرات في السنة) مع ألم شديد وحمى ( وينشأ هذا الداء الثانوي نتيجة عدوى بكتيرية). - إذا أصبت بإلتهاب في العين. إجراءات التشخيص - يقوم الطبيب بالضغط على الوجنتين والجبهة للتأكد من عدم وجود أي إيلام فيهما. - يقوم أيضآ بفحص فمك وزورك والممرات الأنفية. - وقد يقوم بتسليط ضوء عبر الجلد للتأكد ما إذا كانت الجيوب شفافة ورائقة. - سوف يطلب لك أيضآ صوة للجيوب بالأشعة السينية (أشعة مقطعية) إذا إشتبه بوجود إلتهاب جيوب مزمن. إلتهاب الجيوب المزمن
عندما تصاب بعدوى قصيرة الامد وبشكل متكرر في الجيوب ، فهي تبدو وكأنها غير قابلة للشفاء، ويسمى هذا الشكل من المرض بإلتهاب الجيوب الانفية المزمن. ورغم أن السبب غير معروف إلى حد الان، لكن يلاحظ أن التدخين والتعرض للملوثات الصناعية يجعلان الحالة تسوء أكثر. وتتحسن الأعراض عادة عن طريق رذاذ الأنف الستيرودي. وفي بعض الحالات الحادة جدآ يتم غسل الجيوب وصرف السائل منها عند طبيب أنف أذن حنجرة. وقد تحتاج إلى إجراء عملية جراحية لتحسين جريان المادة المخاطية في الأنف. العلاج الطبي - إذا كان الإلتهاب لا يحوي أي عدوى بكتيرية فقد يصف لك الطبيب الأقراص المزيلة للإحتقان و بخاخات الأنف لتقليص الأغشية المخاطية المتضخمة والسماح بصرف المخاط، أو حبوبآ مضادة للهستامين أو كورتيزن أنفيآ على شكل بخاخ لتخفيف حدة الإلتهاب. - إذا تبين أنك تعاني من عدوى بكتيرية ثانوية فسيصف لك مضادآ حيويآ لمدة 7 إلى 14 يومآ. - الجراحة(بإستخدام مناظير دقيقة تدخل من المنخرين إلى فتحات الجيب دون عمل أي قطع جراحي بجلد الوجه) عندما تتكرر نوبات العدوى الميكروبية التي تصيب الجيب الأنفي بالرغم من العلاج. وتهدف الجراحة إلى توسعة فتحات الجيب الأتفي التي إعتراها الضيق على جلب الراحة.

nosa_aic
06 - 07 - 2012, 12:49
علاجات منزلية لالتهاب الجيوب الانفية


حتى تمنع الحساسية أو البرد من التفاقم إلى أن تتحول إلى التهاب مزمن بالجيوب الانفية وحتى تحافظ على ممراتك الانفية من الانسداد ن اتبع هذه الارشادات العلاجية المنزلية:
1- تمخط برفق حتى تنظف الممرات الانفية وتحافظ على من الانسداد.
2- اشرب الكثير من السوائل (8 اكواب يوميآ ، وكل كوب يكون على الاقل سعة 200 مل) حتى تحافظ على سيولة المخاط وتدفقه.
3- تجنب ركوب الطائرة عندما تكون مصابآ باحتقان، فالتغير في الضغط الجوي قد يدفع المخاط إلى إلى داخل الجيوب الانفية
واذا اضطررت لركوب الطائرة فاستعمل مزيل الاحتقان قبل الاقلاع واستعمل بخاخ الانف المزيل للاحتقان قبل هبوط الطائة بحوالي 30 دقيقة.
4- تجنب ممارسة رياضة الغوص الى ان تشفى من الاتهاب الجيوب الانفية تمامآ
5- ضع كمادات دافئة على الوجه او استنشق البخار ( خذ دئفآ دافئآ ، احتس طبقآ من الشوربة الساخنة ، أو استنشق البخار من حلة ماء ساخن مستخدمآ فوطة لتصنع خيمة فوق مصدر البخار.

dr moustafa
06 - 07 - 2012, 13:56
جديدة علية حكاية إستنشاق بخار الماء , شكرا لكى
على مجهودك وتقبلى تحياتى .

nosa_aic
06 - 07 - 2012, 15:57
جديدة علية حكاية إستنشاق بخار الماء , شكرا لكى
على مجهودك وتقبلى تحياتى .


الشكر لله اخى الفاضل

مع تمنياتى بالشفاء العاجل ان شاء الله

مدحت فوزى على
06 - 07 - 2012, 23:27
دراسة: السمنة تحمي المصابين بقصور القلب

http://s.alriyadh.com/2012/07/06/img/256871754070.jpg

واشنطن – ي.ب.آ:
2012-07-06 20:05:56
(http://www.esgmarkets.com/forum/#)[/URL][URL="http://www.esgmarkets.com/forum/#"] (http://www.esgmarkets.com/forum/#)

من المعروف جداً أن السمنة تشكل عامل خطر للإصابة بأمراض القلب وقصوره، لكن عند الإصابة بمشكلة قصور القلب يمكن لزيادة الوزن أن يشكل عامل حماية.

وقالت الباحثة المسؤولة عن الدراسة في جامعة "كاليفورنيا" أدريين كلارك إن الخصر النحيف والوزن الطبيعي يرتبطان عادة بنتائج صحيّة أفضل، لكن الدراسة على النساء والرجال وجدت أن السمنة التي يظهرها ارتفاع مؤشّر كتلة الجسم ومحيط الخصر، عند المصابين بقصور القلب تقلل بشكل ملحوظ من خطر النتائج الضارّة. وقالت تمارا هورويتش المشاركة في الدراسة أيضاً إن الدراسة تشير إلى كيفية أن مرضى قصور القلب يمكن أن يتأثروا بالسمنة، وأضافت أن هذه الحالة القلبية "هي إحدى الحالات الصحية القليلة التي تظهر فيها زيادة الوزن مفعولاً وقائياً".

وحلل العلماء بيانات تعود للعام 1983 إلى 2011 لمرضى بقصور القلب ادخلوا المستشفى شملت 2718 مريضاً قيس لديهم مؤشر كتلة الجسم في بداية إصابتهم بالحالة والعلاج و469 مريضاً قيس محيط خصرهم في بداية العلاج. ووجد الباحثون أن محيط الخصر العالي ومؤشر كتلة الجسم مرتبطان بنجاة المصابين بقصور القلب، من الوفاة وزراعة القلب.

nosa_aic
07 - 07 - 2012, 23:33
انواع البنادول و الفرق بينهم بالصور

كثيرا ما نصادف ألم في أوقات متأخرة, و يمنعنا الكسل من الذهاب
لمستشفى قريبا كان أو بعيد لتلقي العلاج,
و لكن نحتاج لمُسكن ألم, و أكثر المسكنات شُيوعا هو البنادول.

هناك خطأ شائع أن البنادول الأحمر “أقوى” و تأثيره أفضل,
من خلال المعلومات سوف يُلاحظ ان كل نوع له تركيبه كيميائية مختلفه عن غيره
, لإختلاف إستعماله.
بصورة مختصرة أوجزت أنواع من البنادول التي يمكن شراؤها من الصيدليه
لتخفيف “مؤقت” للألم.

أنواع البنادول:

1- الأزرق/ Blue
يتكون من: 500 ملجم باراسيتامول.
إستعمالاته: تخفيف اعراض الحمى, و الصداع.

http://im16.gulfup.com/2011-11-02/1320217892133.jpg (http://www.dlu3at.net/vb/redirector.php?url=http%3A%2F%2Fwww.a7l7.com%2Fvb% 2Fshowthread.php%3Ft%3D20498)


2- الأحمر/ Extra
يتكون من: 500 ملجم باراسيتامول و 65 ملجم كافيين.
إستعمالاته:
ألم الأسنان, ألم الأذن, ألم العضلات, ألم الدورة الشهرية عند النساء
يستعمل ايضا لتخفيف درجه الحرارة و لا ينصح استعماله في حالات الصداع الناتج عن الإرهاق, لأن مادة الكافيين الموجوده تزيد من تنبيه المخ مما يزيد الصداع.



http://im16.gulfup.com/2011-11-02/1320217892142.jpg (http://www.dlu3at.net/vb/redirector.php?url=http%3A%2F%2Fwww.a7l7.com%2Fvb% 2Fshowthread.php%3Ft%3D20498)


3- Cold & flu
يتكون من: 600 ملجم باراسيتامول و 40 ملجم اسكوربيك اسيد
“الموجود بالليمون”
المسحوق منه يتكون من:
سكروز, سيترات الصوديوم, نشا الذرة, كالاميت الصوديوم, الصوديوم السكرين,
نكهه الليمون, عسل, و كارميل.
إستعمالاته:
إزاله أعراض الانفلونزا, كالحرارة و الصداع
النوع الموجود بالعلبة الخضراء يحتوي على مادة مضادة ل”الهستامين”
و تسبب النعاس
و لا يُذكر أن النوعية الموجودة بالعلبة الصفراء تسبب النعاس.


http://im16.gulfup.com/2011-11-02/1320217892485.jpg (http://www.dlu3at.net/vb/redirector.php?url=http%3A%2F%2Fwww.a7l7.com%2Fvb% 2Fshowthread.php%3Ft%3D20498)

nosa_aic
07 - 07 - 2012, 23:50
الصداع

أنواع الصداع - صداع الجيوب الأنفية و يكون الألم حول عظام الحاجب و الخدين.

- الصداع العنقودي و يتركز الألم حول عين واحدة.

- الصداع الناتج عن الضغط و يكون المه كحزام يعتصر الدماغ.

- الصداع النصفي "الشقيقة" و يسبب ألما مبرحا و غثيان و تغيرات في النظر.

http://img291.imageshack.us/img291/9026/image002uq.jpg (http://www.dlu3at.net/vb/article37050.html)



يؤكد العلماء أن أكثر الأمراض انتشاراً بين الشباب هي أمراض الصداع والذي قد يصيبهم دون سابق إنذار أو أسباب واضحة ويصنف الأطباء أسباب الصداع إلى أسباب عضوية ناتجة عن مرض أو إصابة عضوية وأسباب غير عضوية.

http://img61.imageshack.us/img61/8180/we67sr6.gif (http://www.dlu3at.net/vb/article37050.html)

أسباب الصداع العضوية

- ارتفاع ضغط الدم.

- اضطرابات العين : كالتهاب الملتحمة .. قصر النظر .. التهاب أعصاب العين.


- التهاب الأذن الوسطى.

- التهاب الجيوب الأنفية.

- مشاكل الأسنان..

- الحمى.

- الزكام والأنفلونزا.

- اضطرابات السكر في الدم ( ارتفاع وانخفاض السكر في الدم ).

http://img61.imageshack.us/img61/8180/we67sr6.gif (http://www.dlu3at.net/vb/article37050.html)

أسباب الصداع الغير عضوية

ينتج في الغالب نتيجة لأسباب نفسية وعاطفية أو نتيجة اضطراب في وظائف بعض أعضاء الجسم ( كالمخ واضطرابات الدورة الدموية ) أو تغير في بعض أنماط الحياة اليومية ( كتغيير مواعيد النوم ) وقد يكون وراثيا (خصوصا الصداع النصفي).



وتعتبر الضوضاء والحياة المدنية المتسارعة سببا مباشرا لتكرر نوبات الصداع.



http://img61.imageshack.us/img61/8180/we67sr6.gif (http://www.dlu3at.net/vb/article37050.html)

أسباب أخرى

-الروائح القوية.

- قلة النوم أو كثرته.

- بعض أنوع الأطعمة والبهارات.

- التغير المفاجئ في درجات الحرارة.




http://img61.imageshack.us/img61/8180/we67sr6.gif (http://www.dlu3at.net/vb/article37050.html)

إذا كنت تعاني من نوبة صداع تجنب الأتي

- الجلوس في مكان صاخب الإضاءة.

- الجلوس أمام التلفاز أو الكمبيوتر.

- الحديث لفترة طويلة على الهاتف المحمول.

- القراءة.

- تناول الأجبان الصفراء.

- تناول الشوكولاته.

- التدخين.



- تناول عصير الحمضيات والمشروبات الغازية ..... حيث ثبت أنها تزيد من حدة الصداع بنسبة الضعف.


http://img61.imageshack.us/img61/8180/we67sr6.gif (http://www.dlu3at.net/vb/article37050.html)



كيف تتغلب على الصداع ؟

إن تناول الأدوية المهدئة ليس الحل الأمثل للتغلب على الصداعحيث أن هناك طرقا أكثر فاعلية لقهر الصداع وأبرزها الأتي

- التمدد والاسترخاء في مكان تحت ضوء خافت وجيد التهوية.

- الضغط على الصدغين ( المنطقة المحاذية للعين ) بأطراف الأصابع وتدليكهما بخفة وبحركة دائرية.

- وضع كمادات باردة على الصدغين.


- شرب قدح من القهوة المحلاة بالسكر مع بداية الشعور بالألم.

- أخذ حمام بارد ليعيد توازن الدورة الدموية.

- تناول كمية من السوائل.

nosa_aic
13 - 07 - 2012, 09:37
كيف تعرفوآ ان احد الفيتامينات ناقصه عندكم



إذا كنت تعاني من:
- الالتهابات المتكررة وخصوصا في الجزء العلوي من الجهاز التنفسي
- ظهور تقرحات في الفم
- العشى الليلي
- جفاف وتقشر الجلد
فأنه يوجد لديك نقص في فيتامين (( a ))

وهو موجود في:
زيت كبدالحوت / الجبن / اللبن / القشطة
النباتات الخضراء والملونه مثل : السبانخ / الجزر / الخس
الكرنب / الطماطم / البقول / الخوخ / عصيرالبرتقال


***
إذا كنت تعاني من:
- الإجهاد المتواصل
- عدم القدرة على التركيز
- تشقق الشفاه
- التحسس من الضوء
- القلق المستمر
- الأرق
فأنه يوجد لديك نقص في فيتامين (( b ))

وهوموجود في:

الخميرة / الكبد / اللحوم / صفارالبيض
الخضروات / الفواكه / الفول السوداني / السبانخ / الكرنب / الجزر



***
إذا كنت تعاني من:
- الإصابة المتكررة بالبرد
- نزيف اللثة
- عدم التئام الجروح بسهوله
فأنه يوجد لديك نقص في فيتامين (( C ))

وهو موجود في

الكبد / والطحال والموالح بكثرة
عصيرالليمون / البرتقال / اليوسفي / الفراولة / الجوافة / الفجل / التفاح
/ الكرنب / البقدونس / الطماطم


***
إذا كنت تعاني من:
- آلام المفاصل آلام الظهر
- تساقط الشعر
فأنه يوجد لديك نقص في فيتامين (( d ))
وهوموجود في

زيت كبد الحوت / القشطة / اللبن / صفارالبيض / في اشعة الشمس



***
أذا كنت تعاني من:
- الشعور بالتعب عند اقل جهد
- بطىء التأم الجروح
فأنه يوجد لديك نقص في فيتامين (( e ))

وهوموجود في

الخضار الورقية: كالخس / الجرجير / البقدونس / السبانخ
زيت بذرة القطن / زيت الصويا / زيت الذرة / بادرات القمح

nosa_aic
13 - 07 - 2012, 09:48
البطيخ في الصيف الحل الأمثل لرشاقة جسمك





http://health.sabayagazine.com/wp-content/uploads/2012/07/Watermelon-Woman.jpg (http://www.dlu3at.net/vb/redirector.php?url=http%3A%2F%2Fhealth.sabayagazin e.com%2Fwp-content%2Fuploads%2F2012%2F07%2FWatermelon-Woman.jpg)




الرشاقة والقوام الممشوق هو ما تبحث عنه جميع السيدات والتي تسعى نحوه بمختلف الطرق من فقد للسعرات الحرارية والتخفيض من الوزن فتلجأ الكثيرات إلى التقليل من تناول الأطعمة أو الحرمان من الكثير من الأكلات الشهية التي تستمتع بتناولها لذا، ننصحك بتناول الكثير من الفواكه التي تساعدك على فقد سعرات حرارية بصورة أكبر وفي نفس الوقت تشعرك بالشبع بحيث لا تذهبين إلى الإفراط في تناول الطعام أو تناوله بشكل كبير.


البطيخ ليس مجرد فاكهة لذيذة، ولكنه أيضاً أفضل غذاء لخفض الوزن خاصة في الصيف، فالبطيخ يحتوي على سعرات حرارية قليلة، ويستطيع أن يقتل الإحساس بالجوع بشكل كبير ولفترات طويلة، لذا يجب على المهتمين بنظم الحمية، أن يضمنوا البطيخ في خطتهم، ليستفيدوا من النتائج الإعجازية التي يحققها في فقدان الوزن.



كم عدد السعرات الحرارية في البطيخة ..؟؟



يعتبر تناول الفاكهة جزء مهم من أي نظام غذائي متوازن فهي تمكنك من فقدان الوزن بطريقة صحية، حيث تملأ معدتك بدلاً من أن تشعري بالجوع، والبطيخ يحتوي على 49 سعر حراري لكل كوب، بينما تحتوي البطيخة –ذات الوزن الطبيعي- على 20 كوب، وبذلك تحتوي البطيخة بكاملها على 1000 سعر حراري، وهو رقم معقول للاستهلاك في اليوم.



افقدي وزنك بالبطيخ :



إذا كنت تريدي أن تفقدي الوزن بسرعة يجب أن تتبعي هذه القاعدة البسيطة، يجب أن تأكلي كيلو جرام واحد من البطيخ، لكل 10 كيلو جرام من وزنك.


البطيخ يحتوي أيضًا على بعض المواد الغذائية الصحية مثل فيتامين (ج) والليكوبين، وهي مواد مهمة للصحة عموماً.


ويمكنك استبدال البطيخ بالأكلات السريعة والحلوى، فهو أفضل وأشهى كثيراً.


إن المحتوى العالي من الماء داخل البطيخ يساعد في حرق الدهون ويجعل عملية الأيض أكثر كفاءة، خاصة مع وجود محتوى صحي من الألياف والبروتين، ويساعد الجسم على استهلاك الدهون المخزنة داخله بكل كفاءة.



كيف تضعين البطيخ على قائمة حميتك ..؟؟



هناك طرق عديدة لوضع البطيخ بكثافة ضمن قائمة حميتك.


يمكنك أن تأكليه كشرائح، أو تناوليه كوجبة خفيفة بين مواعيد الوجبات.


يمكنك أيضاً أن تصنعي منه عصير مباشرة، أو خليط من مشروبات أخرى، مثل أن تضيفي إليه بعض حبات الفراولة وتخلطيهم معاً في الخلاط، فيصبح لديك مشروب لذيذ وصحي وقليل السعرات الحرارية، يمكنك تناوله في أي وقت.


أيضاً يمكنك أن تصنعي سلطة من البطيخ، بإضافة بعض الأعشاب والخضار المسلوق، والملح والفلفل، والصوص الأسباني، فيصبح لديك طبق غداء ضخم وقليل السعرات الحرارية في نفس الوقت.



نصيحة لاختيار أفضل أنواع البطيخ :



عندما تختارين البطيخ، أنظري جيداً إلى لون وقشرة البطيخ، فيجب أن تكون لامعة، ولكن ليس بشكل فاقع، ولا باهت في نفس الوقت، وألا تكون قطعة البطيخ أثقل من وزنها الطبيعي.

ابو مالك
15 - 07 - 2012, 12:01
http://img.ehowcdn.com/article-new/ehow/images/a06/dg/a8/paint-pink-black-walls-800x800.jpg

http://m002.maktoob.com/alfrasha/up/1239386691651889243.gif

nosa_aic
19 - 07 - 2012, 07:22
طرق لخروج الماء من الاذن


كثير ما نتعرض لدخول الماء في الأذن اليسرى أو اليمنى وذلك يحدث
بعد الإستحمام أو الأغواص في المسابح الكبيرة في الغالب

. . . إذاً ماهو الحل لخروج الماء من الأذن ؟

_ ويكون كذلك بأحد هذه الطرق بإذن الله . . .

تَسْتَطِيّعْ إِخْرَاجْ الْمَاءْ فِيْ ثَوَانِيّ فِيّ بَيّتِكْ دُوُنَ الْحَاجَةُ إِلَىْ الطَبِيِبْ . .

● إسـتخـدام عـود تنظيف الأذن الـناعم برفق مع حـركـة تـدوير متعاكسه
برفق ومع تغيير الأعواد في كل مره .
● النوم على الجهة اليسرى أو اليمنى حسب وجود مكان الماء في الأذن
● إستـعمل أي نـوع من اللـبان (العلك) لأن المضغ يساعد على فتح قنات
إستاكيوس الموصوله بالأذن الوسطى و يخرج عبرها السائل (الماء) إلى الحلق.
●مـيّل رأسـك على الـجـانب الـذي بـه الـمـاء و الـقفز عـلى رجـل واحـدة
"الرجل في نفس جهة الأذن التي بها الماء"
مع سحب صوان الأذن للخلف و للأعلى و من ثم تنشيف الماء الخارج
لأن الرجل تزيد الضغط على الأذن والإهتزاز فيخرج الماء
وهذي طريقة فعالة بإذن الله . .

● مّـتّي يَـجِـبْ الـذِهَـابْ إِلـىْ الـطَـبِـيّبْ ؟
إذا كانت طبلة الأذن مثقوبة يجب الذهاب إلى الطبيب لأن سيكون الماء خلف الطبلة. .
و يترتب على ذلك بعض الإلتهابات.. و سيشعر الشخص بأنه يوجد ماء (لايخرج)
في أذنه و بعض الإنسداد و عدم السمع جيداً
"فيجب في هذه الحالة إلى مراجعة الطبيب"

أسباب أخرى تسبب في ثقب الطبلة غير الماء . .
"منها"
. . السخونه والحمى تسبب ثقب في طبلة الأذن
. .فيـجـب عـدم الإهـمـال

nosa_aic
19 - 07 - 2012, 07:25
دراسة توضح تأثير الصيام على مرضى السكر

http://l.yimg.com/os/401/2012/07/14/96887690-jpg_065647.jpg (http://www.dlu3at.net/vb/article67442.html)





أقامت إحدى شركات الأدوية دراسة علمية لتقييم أثر الصيام فى شهر رمضان على مرضى السكر من النوع الثانى. وتعد تلك الدراسة هى الأولى من نوعها، وتم تصميمها بدقة لمساعدة الشركة على تحديد أفضل الطرق لمساعدة مرضى السكر الذين يرغبون فى صيام شهر رمضان.
وقد شملت عينة الدراسة 1066 مريضا وتم إجراؤها فى 43 مركزا إكلينيكيا بمنطقة الشرق الأوسط، وبالتحديد فى مصر، الأردن، لبنان، السعودية، والإمارات العربية المتحدة.
وتقدر الدوائر العلمية أن هناك 50 مليون مريض سكر، منهم 79% يعانون من النوع الثانى، يصرون على مواصلة الصيام خلال شهر رمضان، وذلك بما يتعارض مع النصائح الطبية التى يسديها لهم الأطباء.
وإدراكا لهذا العدد الضخم من مرضى السكر الصائمين، والذين قد يعرضون أنفسهم لمخاطر صحية خلال الصيام، أقيمت هذه الدراسة ، بهدف التعرف على أهم المشكلات الصحية التى يواجهها مرضى السكر نتيجة الصيام، حتى تتمكن شركات الأدوية من تطوير حلول عملية تساعد من خلالها مرضى السكر الذين يقررون الصيام خلال رمضان دون التعرض لمضاعفات أو مشاكل صحية.
وقد أظهرت دراسة رمضان أن هناك ضعفا فى مستوى الوعى بين مرضى السكر بالمخاطر التى ينطوى عليها صيامهم خلال رمضان. كما أظهرت الدراسة الحاجة الماسة لتوخى الدقة فى قياس مستويات السكر فى الدم أثناء الصيام مع المحافظة عليها. بالإضافة لذلك، اكتشفت الدراسة أن مرضى السكر من النوع الثانى الذين يتناولون عقار جانوفيا (sitagliptin) خلال صيامهم فى رمضان يكونون أقل عرضة لحدوث انخفاض مستوى السكر فى الدم، وذلك عند مقارنتهم بالمرضى الذين يتناولون عقاقير مجموعة سيلفونيل يوريا SU. كما اكتشفت الدراسة أيضا أن التغير فى نمط تناول الأطعمة خلال رمضان يمكنه أن يسبب مخاطر ومضاعفات صحية لمرضى السكر من النوع الثاني، بما فيها انخفاض مستوى السكر فى الدم hypoglycaemia، وهو ما يعد اكتشافا هاما للغاية لدعم مرضى السكر الصائمين.

ابو مالك
20 - 07 - 2012, 11:14
http://www.manshetat.com/up/uploads/13411337387.png
http://iraqnaa.com/ico/image/076.gif

nosa_aic
23 - 07 - 2012, 10:05
http://www.manshetat.com/up/uploads/13411337387.png
http://iraqnaa.com/ico/image/076.gif

http://www.waraqat.net/2008/09/mobark-rmadan22.gif (http://www.dlu3at.net/vb/redirector.php?url=http%3A%2F%2Fwww.fr7.com%2Fredi rector.php%3Furl%3Dhttp%253A%252F%252Fwww.waraqat. net%252F875%252F)

nosa_aic
23 - 07 - 2012, 15:56
المتاعب الصحية للصيام وطرق التغلب عليها


http://l.yimg.com/os/401/2012/07/22/110938096-jpg_085620.jpg (http://www.dlu3at.net/vb/article67978.html)



قد تنتج عن الصيام بعض المتاعب الصحية الشائعة، فيما يلي نعرض لكم أبرزها وطرق الوقاية منها لصيام صحي وآمن ..


حموضة المعدة:


الصيام يقلل عادة من افراز كمية الأحماض والبكتريا في المعدة والتى تعمل على هضم الطعام.بالإضافة الى ذلك فإن التفكير بالطعام خلال فترة الصيام أو الرائحة يدفع الدماغ باعطاء أوامر للمعذة لانتاج المزيد من الأحماض مما قد يؤدي إلى الشعور بالحرقة.
وينصح الأطباء الأشخاص الذين يعانون من الحموضة بأخذ مضادات الهستامين و مضادات الحموضة.و الوقت المناسب للقيام بذلك يكون قبل البدء بوجبة السحور.
كما يمكن أن يساعد في السيطرة على حرقة المعدة أو التجشؤ تناول الطعام في اعتدال، وتجنب الأغذية الدهنية و المقلية أو الحاره جدا. ويمكن الحد من تناول الكافيين و التوقف عن التدخين.
كما يعمل زيت النعناع على التقليل من التجشؤ أو المغص.وينصح باستخدام الوسائد المنخفضة عند النوم والتى تقلل من هذه المشكلة.



المصابون بانخفاض السكر:


ينصح الأطباء الأشخاص الذين يعانون من نقص السكر والذين يتعاطون حقن الأنسولين بعدم الصيام، والذين لا يأخذون حقن الأنسولين يجب عليهم أن يتشاوروا مع أطبائهم قبل البدء بالصيام.
فانخفاض مستوى السكر بالدم وعدم القدرة للسيطرة عليها قد تؤدي الى الدخول في غيبوبة.
ان شعر هؤلاء الأشخاص باعراض كبالدوار والتعرق وتشتت الذهن يجب عليهم أن يفطروا بالحال، وان يلجؤا الى تناول مشروبات سكرية أو قطعة حلوى.



الصداع:


يعاني كثيرون من الصداع خلال فترة الصيام نتيجة لعدة عوامل مثل الجفاف والجوع وانخفاض نسبة الكافيين والنيكوتين بالدم.
للتغلب على هذه المشكلة ينصح الأطباء باتباع نظام غذائي معتدل وأخذ كمية كافية من السوائل بالإضافة الى أهمية تناول وجبة السحور واللجوء الى بعض المسكنات المعروفة.
كما ينصح بعدم التعرض لأشعة الشمس المباشرة ولبس قبعة ونظارات شمسية تساهم في التقليل من مشاكل الصداع.



الجفاف:


الشعور بالجفاف أمر طبيعي في رمضان بسبب نقص السوائل والأملاح من الجسم. ان كنت لا تشرب كمية كافية من السوائل فانك ستعرض نفسك للخطر وخاصة للأشخاص كبار السن والذين يتناولون حبوب مدره للبول.
ان شعرت بأعراض مثل الدوار وعدم القدرة على الوقوف عليك أن تشرب كمية معتدلة من الماء المذاب بداخله ملح أو سكر.
ولتجنب هذا الشعور ينصحك الأطباء بالتمدد ورفع القدمين للأعلى، كما يجب المواظبة على الترطيب المستمر وتعاطي السوائل بشكل دائم.



الإمساك:


يتغير نظامك الغذائي في رمضان مما يسبب لك الإمساك أحياناً، لتتجنبه ينصحك الأطباء بشرب وتناول الطعام بانتظام، بالإضافة الى الإكثار من تناول الخضروات والفواكه والأغذية التى تحتوي على الألياف.



التوتر:


نقص الطعام والماء والتغير من روتينك الغذائي وقلة النوم كلها عوامل تؤدي الى الشعور بالتوتر، لذلك من المهم جداً الابتعاد عن مسببات التوتر من خلال عدم الاجهاد والتحدث كثيراً وعدم ممارسة التمارين الرياضية في الأوقات الحارة والامتناع عن التدخين.

nosa_aic
25 - 07 - 2012, 06:30
كيف تتعامل مع حرارة الجو فى رمضان


http://l.yimg.com/os/401/2012/07/21/104259904-jpg_075248.jpg (http://www.dlu3at.net/vb/article67993.html)

إن ارتفاع درجة الحرارة هذه الأيام يؤدى إلى العطش، ويلعب نوع الغذاء الذى يتناوله الصائم دوراً كبيراً فى تحمل العطش أثناء ساعات الصيام ولكى تتغلب على الإحساس بالعطش
اليك بعض النصائح التى يمكن اتباعها وهى

- تجنب تناول الأكلات والأغذية المحتوية على نسبة كبيرة من البهارات والتوابل، وأيضاً الأغذية المالحة والمخللات بخاصة عند وجبة السحور، لأنها تزيد من حاجة الجسم لكميات كبيرة من الماء بعد تناولها.

- تناول الخضراوات والفواكه الطازجة عند السحور، فإن هذه الأغذية تحتوى على كميات جيدة من الماء والألياف التى تمكث فترة طويلة فى الأمعاء مما يقلل من الإحساس بالجوع والعطش .

- يعتقد بعض الأشخاص إن شرب كميات كبيرة من الماء عند السحور يحميهم من الشعور بالعطش أثناء الصيام، وهذا اعتقاد خاطئ لأن معظم هذه المياه زائدة عن حاجة الجسم لذا تقوم الكلية بفرزها بعد ساعات قليلة من تناولها، لذا حاول أن تشرب كميات قليلة من الماء فى فترات متقطعة من الليل.

- إن الإكثار من السوائل فى رمضان مثل العصائر المختلفة والمياه الغازية يؤثر بشدة على المعدة ويقلل كفاءة الهضم، كما يعمد بعض الأفراد إلى شرب الماء المثلج بخاصة عند بداية الإفطار، وهذا لا يروى العطش بل يؤدى إلى انقباض الشعيرات الدموية، وبالتالى ضعف الهضم، لذا يجب أن تكون درجة الماء معتدلة أو متوسطة البرودة وأن يشربها الفرد متأنياً وليس دفعه واحدة.

- تجنب شرب الماء أثناء الأكل فهذه طريقة خاطئة، لأنها لا تعطى فرصة للهضم.

ـ تجنب شرب العصائر التى تحتوى على مواد مصنعة وملونة والتى تحتوى على كميات كبيرة من السكر، وينصح باستبدالها بالعصائر الطازجة والفواكه.

- الإكثار من تناول السلطة، لأنها تحتوى على عناصر غذائية مرطبة ومفيدة وغنية بالألياف والمعادن والفيتامينات التى تمد الجسم بالحيوية والنشاط والماء اللازم له، والسلطة كاملة القيمة الغذائية تتكون من بقدونس، والكرفس وخيار والبندورة والبصل والقرنبيط وأنواع أخرى من الخضراوات.

-يؤكد الخبراء أن البطيخ من الفاكهة الصيفية المفيدة فى أيام الصيام، حيث يغنى عن عشرات الأصناف من الخضراوات واللحوم، لما له من أثر ملطف على المعدة، إضافة إلى غناه بالعديد من العناصر التى تكفى حاجة الإنسان من الماء والفيتامينات والمعادن طوال اليوم، خاصةً فى أيام الصيف الحارة.

nosa_aic
28 - 07 - 2012, 05:42
الأكلات المسموح بها للمصاب بالقولون فى رمضان

هذا المرض يجب أن يراعى المرض فيه طعامه وشرابه الذى يتناوله حتى لا يتسبب له الإهمال فى تنظيم طعامه ومواعيدها وأنواعها فى إصابة القولون بأى عرض جانبى خطير أو أى تطور غير مرغوب فيه.
وعن الأنظمة الغذائية والأطعمة التى على المريض اتباعها خلال شهر رمضان : إن على المرضى تناول الأكلات التى تحتوى على الاوميجا 3 والاوميجا 7 والاوميجا 8، وكذلك الاوميجا 9 وهى عناصر مهمة جدا، كما يفضل أن يتناول المريض اللوز وعين الجمل والبندق وغيرها وذلك لأنها عكس الاعتقاد السائد فهى تكون مفيدة لهذا المرض، كذلك هناك نوع من الزيوت يسمى زيت السمك أثبت فائدته لهؤلاء المرضى أيضا.
وذلك لأن الأمراض القولونية يجب أن يتم اتباع نظام غذائى لها حتى لا يصيب المريض بشىء غير مستحب، خاصة فى شهر الصيام شهر رمضان، والذى تتنوع فيه الأطعمة والمشروبات وقد يهمل المريض فى الحفاظ على طعامه.

http://l.yimg.com/os/401/2012/07/23/99960380-jpg_072317.jpg (http://www.dlu3at.net/vb/article68049.html)

nosa_aic
29 - 07 - 2012, 02:39
مرضى الكبد وكيفية الصيام في رمضان

http://www.akhbar-today.com/images/cms//5c78aabded0113939e7f2bed483d84006f02dcbe-8ac7-431e-9f22-5d9e99fe03ff.jpg (http://www.dlu3at.net/vb/article68335.html)

يعتبر الغذاء السليم والمقنن من أهم الاشياء المساندة لعلاج أمراض الكبد

هل يصوم مرضى الكبد؟

نعم يمكنهم الصيام إذا كان المرض غير مزمن وليس في مراحله المتأخرة، ولا توجد لديهم مضاعفات ، ايضاً عدم وجود أدوية تؤخذ على فترات متقاربة أو مدرات للبول تؤخذ بجرعات عالية، وذلك لتجنب المريض خطورة فقد السوائل الحاد مع الصيام.

وقد يكون الصيام مفيداً بعض المرضى مثل المصابين بتشحم الكبد، حيث إن الصيام مع الحمية الغذائية المناسبة قد يؤدي إلى انخفاض الوزن وانخفاض نسبة الدهون في الدم ومن ثم تحسن الكبد.

متى يفضل عدم الصيام؟

* المرضى المصابون بتليف الكبد والمصاحبة بفشل كبدي، ووجود مضاعفات مثل تكرر الغيبوبة الكبدية والتهاب الغشاء البريتوني في البطن والإعياء العام.

* المرضى الذين يتعاطون أدوية مدرة للبول وخصوصا بجرعات عالية لعلاج الاستسقاء واحتشاء السوائل في الجسم مما قد يعرضهم لفقد كميات كبيرة من السوائل والأملاح خصوصا في فصل الصيف والجو حار ومدة الصيام تكون أطول، ففي هذه الحالة يكون عدم الصيام أفضل.

* المرضى الذين يتعاطون أدوية تؤخذ على فترات متقاربة مثل الملينات التي تعطى للمرضى المصابين باعتلال المخ الكبدي والغيبوبة الكبدية وتكرار حدوثها, أو المرضى الذين يتعاطون دواء الإنترفيرون (INTERFERONE) ويسبب لهم مضاعفات مثل ارتفاع درجة الحرارة والغثيان والتقيؤ أو الإعياء العام مما قد يجعل الصيام صعبا.

* بعض المرضى وبعد علاج نزيف دوالي المريء عن طريق المنظار بالحقن يكونون عرضة للإصابة بالقروح سواء في المريء أو المعده فيكون عدم الصيام أفضل.

ما هي المأكولات التي يجب الامتناع أو التقليل منها؟

* الابتعاد عن الأكل المضاف إليه ملح للذين لديهم استسقاء وتورم في القدمين وسوائل في تجويف البطن.
* التقليل قدر المستطاع من الدهون الحيوانية والموجودة في اللحم والالبان ومشتقاتها، واستخدام كميات قليلة من الدهون النباتية.
* تقليل كمية البروتينات للمرضى المصابين بمرض مزمن والمصابين بتكرر اعتلال المخ والغيبوبة الكبدية.
* عدم الإفراط في السوائل للمرضى الذين لديهم استسقاء وتورم في القدمين وسوائل في البطن.

هل يصوم المرضى الذين تمت لهم زراعة كبد؟

نعم, فغالبية هؤلاء المرضى اصحاء والحمد لله يستطيعون الصيام، فيما عدا نسبة قليلة منهم يكونون بحاجة إلى أخذ أدوية على فترات متقاربة أكثر من مرتين يومياً من مثبطات المناعة أو غيرها، أو لديهم ضعف في عمل الكلى ، أو لأسباب أخرى قد يفضل الطبيب فيها عدم صيامهم.

(http://www.dlu3at.net/vb/article68335.html)

ابو مالك
30 - 07 - 2012, 02:09
http://www.alqabas.com.kw:82//sites/default/files/imagecache/blockView15/article/main/2012/07/29/74765.gif (http://www.alqabas.com.kw/node/95261)

قلة حركة الجنين تستوجب الإفطار (http://www.alqabas.com.kw/node/95261)
يتعامل الجسم مع الصيام عن تناول الطعام والشراب من خلال آلية فريدة من نوعها، فأثناءه يمتص بقايا الطعام الموجودة في الامعاء، ثم يستخرج الغلوكوز من... المزيد (http://www.alqabas.com.kw/node/95261)

nosa_aic
30 - 07 - 2012, 06:45
إدارة مرض السكري في رمضان


http://www.balagh.com/images/texes/edarat-marda-al-suqer-fe-ramadan.jpg (http://www.dlu3at.net/vb/article68404.html)



بدأ شهر رمضان المبارك، الذي يحل هذه السنة خلال فصل الصيف، الأمر الذي يجعل العناية بالصحة خلال فترة الصوم أكثر صعوبة بالنسبة إلى من يعانون حالات مرضية مزمنة.
تعترف أغلبية السلطات الدينية بما قد يسببه الصيام من مضاعفات لدى من يعانون حالات مرضية مزمنة، إلا أنني أرى الكثيرين من المسلمين يقبلون على الصيام على الرغم من إصابتهم بمرض السكري. بالطبع هذا خيار شخصي، ويمكن من خلال الرعاية الصحية المناسبة المرافقة لبعض التعديلات في أسلوب الحياة والنظام الغذائي لبعض المصابين، أن يصوموا طوال شهر رمضان من دون التعرض للآثار الجانبية أو التعرض لها بالحد الأدنى.
أمّا بالنسبة إلى المصابين بمرض السكري، فالخطورة الكبرى تكمن في عدم القدرة على التحكم في مستويات السكر في الدم، وفي حين لا يشجع بعض الأطباء مرضى السكري على الصيام، إلا أنّه يمكن إدارة مرض السكري للمصابين بالنوع 2 من مرض السكري بصورة أكثر فعالية من المصابين بالنوع 1، إذ يعتمد هؤلاء إلى حد كبير على حقن الأنسولين بجرعات منتظمة. أوصي جميع المصابين بالسكري بالتوجه أوّلاً إلى أطبائهم قبل بدء الصوم مع تفحص نسبة السكري في الدم يومياً لتجنب الإصابة بنوبات هبوط سكر الدم أو ارتفاعه.
ينبغي على المصابين بمرض السكري تناول كميات كافية ومحددة من الطعام خلال فترات الصيام الطويلة، كما ينبغي عليهم، عموماً وأثناء الصيام، تجنب الأطعمة المقلية والتي تحتوي على نسب عالية من الدهون والسكريات. وفي حين يمكن لمرضى السكري تناول كميات محدودة من البلح واللوز، ينبغي على جميع الصائمين التقليل من استهلاك المشروبات التي تحتوي على الكافيين ومدرات البول، التي تؤدي إلى استنزاف الأملاح المعدنية الضرورية للجسم أثناء الصيام. أما زيادة شرب المياه فهي ضرورية لمرضى السكري وغيرهم على حدٍّ سواء خلال أشهر الحر الشديد.
ويفضل، في ما يتعلق بوجبة السحور، تجنب الإفراط في تناول الطعام قبل الذهاب للنوم، وذلك لتجنب الزيادة المفاجئة في مستوى السكر في الدم، ما يسبب صعوبات في التحكم في الشهية. ويتوجب على مرضى السكري عوضاً عن ذلك استهلاك كمية معتدلة من الكربوهيدرات المركبة الموجودة في الشوفان والخبز الأسمر والفاصولياء والبقوليات، والتي تحوي نسباً مرتفعة من الألياف التي تسهم في تنظيم معدل السكر في الدم.
يجب على مرضى السكري أيضاً أن يحافظوا على نشاطهم خلال فترة الصوم، إلا أنني لا أنصح بممارسة التمارين الرياضية أثناء فترات الصيام وفي درجات الحرارة المرتفعة.
في حال أحس مريض السكري بانخفاض في مستوى السكر في الدم، يتوجب عليه قياس نسبته: إن كانت النسبة أقل من 70 ملليغراماً/ ديسيليتر، يتوجب عليه الإفطار وتناول قطعة من الحلوى أو كوب من عصير الفواكه على الفور، وبعد ذلك ينتظر المريض 15 دقيقة ويعاود قياس نسبة السكر في الدم، فإن كانت لا تزال أقل من 70 ملليغراماً/ ديسيليتر يتوجب عليه تناول كمية أخرى مجدداً. أما في حال كانت نسبة السكر في الدم قد تجاوزت 70 ملليغراماً/ ديسيليتر فيجب على المريض تناول كربوهيدرات ترتفع فيها نسبة البروتينات، مثل الخبز الأسمر والجبن قليل الدسم.
ومن ناحية أخرى، يكون المصابون بالنوع 1 من السكري، الذين يعتمدون على جرعات الأنسولين، أكثر حساسية وعليهم استشارة الطبيب قبل اتخاذ القرار بالصيام. وعموماً، ننصح مرضى السكري ممن يشعرون بأيٍّ من الأعراض التالية بقياس نسبة سكر الدم لديهم خلال الصيام: التعرض أو الدوار أو تسرع خفقات القلب أو الارتجاف أو مشاكل في الرؤية أو الشحوب أو انعدام القدرة على التركيز أو غيرها من الأعراض غير الاعتيادية.

- إرشادات الصيام لمرضى السكري:

1- قياس نسبة السكر (الجلوكوز) في الدم بشكل متكرر خلال اليوم.
2- الإفطار في حال هبوط نسبة السكر في الدم إلى ما دون 60 ملليغراماً/ ديسيليتر (3.3 مللي مول/ ليتر) دائماً وفوراً.
3- الإفطار في حال جاء قياس مستوى سكر الدم خلال الساعات الأولى من الصيام أقل من 70 ملليغراماً/ ديسيليتر (3.9 مللي مول/ ليتر).
4- يجب الإفطار في حال تجاوز مستوى السكر في الدم 300 ملليغرام/ ديسيليتر (16.7 مللي مول/ ليتر).
5- عدم الصوم خلال أيام المرضى.
6- تجنب نقص السكر في الدم بعد تناول الطعام عن طريق تقسيم الوجبة إلى 3-4 حصص صغيرة خلال فترة الإفطار.
7- تجنب ممارسة التمارين قبل مرور ساعتين على تناول الإفطار.

nosa_aic
01 - 08 - 2012, 06:53
البدء بالماء البارد فى الافطار قد يؤدى الى مغص حاد



http://forum.hwaml.com/imgcache2/hwaml.com_1301704665_322.jpg (http://www.dlu3at.net/vb/article68510.html)
هناك بعض العادات الغذائية التي قد يقوم بها بعض الصائمين بدون معرفة
ومنها أن بعضهم يبدأ بشرب الماء البارد مباشرة وخاصة عند العطش الشديد
وهذا للأسف قد يؤدي إلى مغص حاد ناتج من تقلص في عضلات وجدار المعدة
وللحد من هذه المشكلة ينصح بالبدء بالتمر وشوربة دافئة وكأساً من الماء المعتدل وليس البارد
ونلاحظ أن البعض يحرص على الأكل مباشرة بعد أذان المغرب وقبل صلاة المغرب
والذي يحتوي على أنواع الطعام وخاصة الدسم منها
وللأسف فان هذه العادة تسبب عسرا في الهضم فينصح تأجيل الطعام بعد صلاة المغرب
ويفضل ان يكون الطعام الدسم بعد التراويح حيث تعتبر بمكان الغداء في الأيام العادية
و من العادات السيئة خلال شهر رمضان التجويع الشديد خلال الليل
حيث يعتقد بعض الناس ان ذلك سوف يساهم فى إنقاص الوزن
ولكن قد يكون له تأثير سلبي حيث يؤدي إلى خلل في توزيع مكونات الجسم
لذلك ننهى من الحد من التجويع خلال الليل
والتركيز على الأغذية الطبيعة والمتوازنة

nosa_aic
01 - 08 - 2012, 07:08
روشتة مجانية لتجنب مضاعفات الصيام .. ؟؟


عن الصيام وارتفاع السكر في الدم ، وعلاقة الغدة الدرقية بالتوتر والعصبية ، وعن تحاليل أمراض القلب ونقص الحديد والأنيميا ، وزيادة الكولسترول و أثر الصوم علي زيادة نسبة الأملاح بالجسم وكيف تعمل أجهزة الجسم خلال الصيام و كيف نتجنب المضاعفات غير ذلك .. للاحاطة بهذا الموضوع سوف يتم ذلك و لو بشكل متواضع من خلال سؤال وجواب :